2B8XA

Crystal structure of the interleukin-4 variant f82d
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
129
structure length
129
Chain Sequence
HKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRDLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A modular interface of IL-4 allows for scalable affinity without affecting specificity for the IL-4 receptor
pubmed doi rcsb
molecule keywords Interleukin-4
molecule tags Cytokine
source organism Homo sapiens
total genus 48
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2005-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00727 IL4 Interleukin 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1250.10 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; Growth Hormone; Chain: A; 2b8xA00
3EW3A 3WCYI 4DOHA 1WU3I 2B8ZA 1QVNA 3UX9A 3B5KA 3UF5A 2CYKA 1AX8A 1EKUA 1V7MV 4WRLB 3PIWA 2Q7NB 1ITLA 1HIJA 2D9QA 1INRA 1HUWA 4I77Z 1HWHA 4GRWA 3UF2A 1LQSL 2H24A 1HGUA 3D48P 3MZGA 4O9HA 5KNHI 3HMXB 4NI9A 1KF9A 1BP3A 3DLQI 3INKC 1ILKA 2IL6A 3DUHC 1D9GA 3L5XA 3D85C 1EVSA 3QB1A 1M4RA 2GMFA 2L3YA 5FHXA 1VLKA 1M48A 4J4LC 1IJZA 3QAZA 3OQ3A 3SE3B 1J7VL 4RS1A 3LB6A 1Z92A 3D87A 1Y6KL 1F45B 1AU1A 1HULA 1PVHB 5D72A 3NCCA 1P9MB 3BPOA 1BGDA 3QB7A 4PS4A 4YDYI 5C7XA 1A7MA 1D9CA 3UEZE 3PIVA 1ITFA 1AXIA 1BGEA 3NCEA 3BPLA 1HIKA 4YUEC 5D28B 3N06A 1CNT1 2ERJD 1CSGA 1N1FA 3QT2C 1F6FA 1M4BA 3HHRA 3QWRB 3NCBA 1PY2A 3VA2A 1CYLA 1V7NV 1IK0A 2B5IA 3S9DA 2E9WC 2L3OA 2ILKA 2B8UA 2O27A 1IRLA 3G9VB 4YPGC 3L5WI 4ZF7A 1GNCA 1PW6A 2LMSA 1M47A 4FA8E 3G6DA 1IARA 1HZIA 2HYMB 1BUYA 2KZ1A 1M49A 5L6YC 1B5LA 1HWGA 1CN4C 4X51A 1ITIA 2B8XA 4ZS7A 5LQBA 4NEJA 1GA3A 5D70A 1RFBA 1ITMA 1BGCA 3LB6B 1EMRA 4NI7A 2LAGA 4O6KA 2INTA 5E4EA 1EXZA 1IL6A 1FYHA 3BESL 3EJJA 3NCFA 4NKQC 1LKIA 2O26A 2B8YA 1YKBA 1I1RB 4MHLA 1RCBA 1NBPA 3N0PA 2B90A 3BPNA 5D71A 4CNIC 1BBNA 1BCNA 1A22A 3DGCL 1FG9A 3Q1SI 1LK3A 1Z7CA 2B91A 2D48A 1Y6ML 1RHGA 4NEMA 1SCFA 1JLIA 1CD9A 1EERA 1Y6NL 3SE4B 5FUCA 4Z5RD 1M4AA 2Q98A 4YQXA 1M4CA 3NPZA 1RW5A 1PGRA 1ETEA 5D22A 1ALUA
chains in the Genus database with same CATH superfamily
4GC0A 1V7MV 2XQBA 2CFPA 3PIWA 4TPJA 1Y1VD 3HOXD 4IU8A 1LQSL 2H24A 3D48P 3DI3A 4O9HA 5D6KA 4A3ED 3L5XA 3D85C 4A3MD 1IJZA 3QAZA 1J7VL 3PO2D 5D72A 3BPOA 4NN6A 4DKEA 3OG6A 4YDYI 4A3LD 1AXIA 1HIKA 3QT2C 3QWRB 3VA2A 2JA7D 2E9WC 3G9VB 4IKVA 4ZF7A 1GNCA 2LMSA 5L6YC 4IKWA 2B8XA 4NEJA 4LRLA 5D70A 1ITMA 1BGCA 4NI7A 2B63D 1FYHA 3EJJA 5C3ED 2B8YA 4YB9D 4OH3A 3I4ND 3N0PA 2B90A 5D71A 5A2NA 1A22A 5FLMD 1Y14A 1FG9A 2Q14A 3Q1SI 2R93D 2D48A 1RHGA 1JLIA 1CD9A 3AYHA 5IYBD 1Y6NL 4U4VA 4XNJA 3HHCA 4YQXA 1RW5A 4DOHA 1QVNA 4UVMA 2Y5YA 3FKID 1EKUA 5C44D 4XNIA 3HOWD 1INRA 3UF2A 3DI2A 4NI9A 4GS7A 1M4RA 2GMFA 4NN7A 1M48A 4J4LC 3D87A 1PVHB 4GBZA 1PV7A 2V8NA 4PS4A 1D9CA 3PIVA 4GBYA 1BGEA 3NCEA 2ERJD 1N1FA 4A3GD 5IYDD 4W6VA 1CYLA 5C65A 2R92D 4APSA 4QIQA 2VUMD 4PYPA 1M49A 1CN4C 4X51A 4NN5A 4ZS7A 4ZW9A 2Z3RA 1GA3A 5E4EA 1IL6A 4BY1D 3BESL 3NCFA 4NKQC 5D58A 1I1RB 1WCMD 1BCNA 3BPNA 2C35A 4IKXA 4BY7D 4NEMA 2Q98A 5TS9A 1M4CA 1PGRA 4A3CD 3WCYI 1WU3I 2B8ZA 4BBRD 3B5KA 2CYKA 1AX8A 3H3VE 1Y1WD 4WRLB 2D9QA 1HUWA 3HOUD 3OG4A 3I4MD 1BP3A 4D2BA 2IL6A 3HOZD 1EVSA 3QB1A 2L3YA 4J05A 4ZWCA 3OQ3A 4DKFA 3PO3D 4RS1A 1Z92A 1Y6KL 5EQGA 3NCCA 4A3FD 3WDOA 5IP9D 5C7XA 4DKDA 2OQPA 3BPLA 3H0GD 4YUEC 5D28B 1CSGA 1F6FA 3HHRA 3NCBA 1PY2A 1V7NV 1IK0A 2B5IA 4BBSD 3S9DA 2L3OA 2O27A 2R7ZD 3L5WI 4ZYRA 1PW6A 4U4TA 2XUTA 4U4WA 4DKCA 1HZIA 2HYMB 2PSMA 3HOVD 1B5LA 5EQIA 1RFBA 4O6KA 4A3DD 1LKIA 5A2OA 4MHLA 1RCBA 1NBPA 4CNIC 3O7QA 5EQHA 1LK3A 1Z7CA 2JA8D 1Y6ML 3SE4B 1M4AA 2Z3QA 4JREA 4IKYA 1ETEA 5D22A 1ALUA 3EW3A 3UX9A 3UF5A 4EXPA 2Q7NB 1ITLA 1HIJA 4I77Z 1HWHA 4GRWA 4A93D 1HGUA 3MZGA 5KNHI 4LEPA 2O6IA 3HMXB 1KF9A 3DLQI 4A3ID 3INKC 4Q65A 1ILKA 2CFQA 3DUHC 1D9GA 4A3KD 2JA5D 3HOYD 5FHXA 3TGXB 1VLKA 4D2CA 3SE3B 3LB6A 1F45B 1AU1A 1HULA 2JA6D 1P9MB 1BGDA 3QB7A 4D2DA 1A7MA 3UEZE 1ITFA 3N06A 1CNT1 4JA3A 5C4XD 1M4BA 4LDSA 2ILKA 2B8UA 4YPGC 1IRLA 4TPHA 4YBQA 1M47A 4FA8E 3G6DA 1IARA 4TPGA 4IKZA 1BUYA 2KZ1A 1HWGA 1ITIA 4A3BD 3IRHA 1PV6A 5LQBA 3LB6B 5IP7D 1EMRA 2LAGA 1PW4A 2INTA 5IYCD 1EXZA 4ZWBA 4IU9A 2O26A 1YKBA 4EXNA 1BBNA 4JR9A 3O7PA 3DGCL 4OAAA 5GXBA 2B91A 4BXXD 1SCFA 4A3JD 1EERA 5D59A 5FUCA 4Z5RD 3NPZA
chains in the Genus database with same CATH topology
3EW3A 3WCYI 4DOHA 1WU3I 2B8ZA 4BBRD 1QVNA 3UX9A 3B5KA 3UF5A 2CYKA 1AX8A 1EKUA 1V7MV 2XQBA 3FKID 3H3VE 1Y1WD 4WRLB 3PIWA 4EXPA 5C44D 1Y1VD 1ITLA 1HIJA 2D9QA 2Q7NB 3HOXD 3HOWD 1INRA 1HUWA 4I77Z 1HWHA 4GRWA 3UF2A 3HOUD 4A93D 1LQSL 2H24A 1HGUA 3D48P 3DI3A 3MZGA 3DI2A 4O9HA 5KNHI 2O6IA 3HMXB 4GS7A 4NI9A 3OG4A 3I4MD 1KF9A 1BP3A 3DLQI 4A3ID 3INKC 1ILKA 2IL6A 4A3ED 4A3KD 3DUHC 1D9GA 3L5XA 2JA5D 3D85C 3HOYD 3HOZD 1EVSA 3QB1A 1M4RA 2GMFA 2L3YA 5FHXA 3TGXB 4A3MD 4NN7A 1VLKA 1M48A 4J4LC 1IJZA 3QAZA 3OQ3A 3SE3B 4DKFA 1J7VL 3PO3D 3PO2D 4RS1A 3LB6A 1Z92A 3D87A 1Y6KL 1F45B 1AU1A 1HULA 1PVHB 5D72A 3NCCA 1P9MB 3BPOA 2JA6D 1BGDA 4NN6A 3QB7A 4A3FD 4DKEA 3OG6A 4PS4A 5IP9D 4YDYI 5C7XA 1A7MA 1D9CA 3UEZE 3PIVA 4A3LD 1ITFA 4DKDA 1AXIA 1BGEA 3NCEA 2OQPA 3BPLA 1HIKA 3H0GD 4YUEC 5D28B 3N06A 1CNT1 2ERJD 1CSGA 5C4XD 1N1FA 3QT2C 1F6FA 1M4BA 5IYDD 3HHRA 3QWRB 4A3GD 3NCBA 1PY2A 3VA2A 2JA7D 1CYLA 1V7NV 1IK0A 2B5IA 2R92D 4BBSD 3S9DA 2E9WC 2L3OA 2ILKA 2B8UA 2O27A 1IRLA 3G9VB 4YPGC 2R7ZD 3L5WI 4ZF7A 1GNCA 1PW6A 2LMSA 1M47A 4FA8E 3G6DA 1IARA 4DKCA 2VUMD 1HZIA 2HYMB 1BUYA 2PSMA 2KZ1A 1M49A 5L6YC 3HOVD 1B5LA 1HWGA 1CN4C 4X51A 4NN5A 1ITIA 2B8XA 4A3BD 3IRHA 4ZS7A 5LQBA 2Z3RA 4NEJA 1GA3A 4LRLA 1RFBA 5D70A 1ITMA 1BGCA 3LB6B 5IP7D 1EMRA 4NI7A 2LAGA 4O6KA 2INTA 4A3DD 5E4EA 1EXZA 1IL6A 5IYCD 4BY1D 2B63D 1FYHA 3BESL 3EJJA 3NCFA 4NKQC 5C3ED 1LKIA 2O26A 2B8YA 1YKBA 1I1RB 4MHLA 1RCBA 3I4ND 1NBPA 1WCMD 3N0PA 2B90A 3BPNA 5D71A 4CNIC 1BBNA 2C35A 4EXNA 1BCNA 1A22A 5FLMD 3DGCL 1Y14A 4BY7D 1FG9A 2Q14A 3Q1SI 2R93D 1LK3A 1Z7CA 2JA8D 2B91A 2D48A 1Y6ML 4BXXD 1RHGA 4NEMA 1SCFA 1JLIA 1CD9A 3AYHA 5IYBD 4A3JD 1EERA 1Y6NL 3SE4B 5FUCA 3HHCA 4Z5RD 1M4AA 2Q98A 5TS9A 2Z3QA 4YQXA 1M4CA 3NPZA 1RW5A 1PGRA 1ETEA 4A3CD 5D22A 1ALUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EW3 A;  3WCY I;  4DOH A;  1WU3 I;  2B8Z A;  1QVN A;  3UX9 A;  3B5K A;  3UF5 A;  2CYK A;  1AX8 A;  1EKU A;  1V7M V;  4WRL B;  3PIW A;  2Q7N B;  1ITL A;  1HIJ A;  2D9Q A;  1INR A;  1HUW A;  4I77 Z;  1HWH A;  4GRW A;  3UF2 A;  1LQS L;  2H24 A;  1HGU A;  3D48 P;  3MZG A;  4O9H A;  5KNH I;  3HMX B;  4NI9 A;  1KF9 A;  1BP3 A;  3DLQ I;  3INK C;  1ILK A;  2IL6 A;  3DUH C;  1D9G A;  3L5X A;  3D85 C;  1EVS A;  3QB1 A;  1M4R A;  2GMF A;  2L3Y A;  5FHX A;  1VLK A;  1M48 A;  4J4L C;  1IJZ A;  3QAZ A;  3OQ3 A;  3SE3 B;  1J7V L;  4RS1 A;  3LB6 A;  1Z92 A;  3D87 A;  1Y6K L;  1F45 B;  1AU1 A;  1HUL A;  1PVH B;  5D72 A;  3NCC A;  1P9M B;  3BPO A;  1BGD A;  3QB7 A;  4PS4 A;  4YDY I;  5C7X A;  1A7M A;  1D9C A;  3UEZ E;  3PIV A;  1ITF A;  1AXI A;  1BGE A;  3NCE A;  3BPL A;  1HIK A;  4YUE C;  5D28 B;  3N06 A;  1CNT 1;  2ERJ D;  1CSG A;  1N1F A;  3QT2 C;  1F6F A;  1M4B A;  3HHR A;  3QWR B;  3NCB A;  1PY2 A;  3VA2 A;  1CYL A;  1V7N V;  1IK0 A;  2B5I A;  3S9D A;  2E9W C;  2L3O A;  2ILK A;  2B8U A;  2O27 A;  1IRL A;  3G9V B;  4YPG C;  3L5W I;  4ZF7 A;  1GNC A;  1PW6 A;  2LMS A;  1M47 A;  4FA8 E;  3G6D A;  1IAR A;  1HZI A;  2HYM B;  1BUY A;  2KZ1 A;  1M49 A;  5L6Y C;  1B5L A;  1HWG A;  1CN4 C;  4X51 A;  1ITI A;  2B8X A;  4ZS7 A;  5LQB A;  4NEJ A;  1GA3 A;  5D70 A;  1RFB A;  1ITM A;  1BGC A;  3LB6 B;  1EMR A;  4NI7 A;  2LAG A;  4O6K A;  2INT A;  5E4E A;  1EXZ A;  1IL6 A;  1FYH A;  3BES L;  3EJJ A;  3NCF A;  4NKQ C;  1LKI A;  2O26 A;  2B8Y A;  1YKB A;  1I1R B;  4MHL A;  1RCB A;  1NBP A;  3N0P A;  2B90 A;  3BPN A;  5D71 A;  4CNI C;  1BBN A;  1BCN A;  1A22 A;  3DGC L;  1FG9 A;  3Q1S I;  1LK3 A;  1Z7C A;  2B91 A;  2D48 A;  1Y6M L;  1RHG A;  4NEM A;  1SCF A;  1JLI A;  1CD9 A;  1EER A;  1Y6N L;  3SE4 B;  5FUC A;  4Z5R D;  1M4A A;  2Q98 A;  4YQX A;  1M4C A;  3NPZ A;  1RW5 A;  1PGR A;  1ETE A;  5D22 A;  1ALU A; 
#chains in the Genus database with same CATH topology
 4GC0 A;  1V7M V;  2XQB A;  2CFP A;  3PIW A;  4TPJ A;  1Y1V D;  3HOX D;  4IU8 A;  1LQS L;  2H24 A;  3D48 P;  3DI3 A;  4O9H A;  5D6K A;  4A3E D;  3L5X A;  3D85 C;  4A3M D;  1IJZ A;  3QAZ A;  1J7V L;  3PO2 D;  5D72 A;  3BPO A;  4NN6 A;  4DKE A;  3OG6 A;  4YDY I;  4A3L D;  1AXI A;  1HIK A;  3QT2 C;  3QWR B;  3VA2 A;  2JA7 D;  2E9W C;  3G9V B;  4IKV A;  4ZF7 A;  1GNC A;  2LMS A;  5L6Y C;  4IKW A;  2B8X A;  4NEJ A;  4LRL A;  5D70 A;  1ITM A;  1BGC A;  4NI7 A;  2B63 D;  1FYH A;  3EJJ A;  5C3E D;  2B8Y A;  4YB9 D;  4OH3 A;  3I4N D;  3N0P A;  2B90 A;  5D71 A;  5A2N A;  1A22 A;  5FLM D;  1Y14 A;  1FG9 A;  2Q14 A;  3Q1S I;  2R93 D;  2D48 A;  1RHG A;  1JLI A;  1CD9 A;  3AYH A;  5IYB D;  1Y6N L;  4U4V A;  4XNJ A;  3HHC A;  4YQX A;  1RW5 A;  4DOH A;  1QVN A;  4UVM A;  2Y5Y A;  3FKI D;  1EKU A;  5C44 D;  4XNI A;  3HOW D;  1INR A;  3UF2 A;  3DI2 A;  4NI9 A;  4GS7 A;  1M4R A;  2GMF A;  4NN7 A;  1M48 A;  4J4L C;  3D87 A;  1PVH B;  4GBZ A;  1PV7 A;  2V8N A;  4PS4 A;  1D9C A;  3PIV A;  4GBY A;  1BGE A;  3NCE A;  2ERJ D;  1N1F A;  4A3G D;  5IYD D;  4W6V A;  1CYL A;  5C65 A;  2R92 D;  4APS A;  4QIQ A;  2VUM D;  4PYP A;  1M49 A;  1CN4 C;  4X51 A;  4NN5 A;  4ZS7 A;  4ZW9 A;  2Z3R A;  1GA3 A;  5E4E A;  1IL6 A;  4BY1 D;  3BES L;  3NCF A;  4NKQ C;  5D58 A;  1I1R B;  1WCM D;  1BCN A;  3BPN A;  2C35 A;  4IKX A;  4BY7 D;  4NEM A;  2Q98 A;  5TS9 A;  1M4C A;  1PGR A;  4A3C D;  3WCY I;  1WU3 I;  2B8Z A;  4BBR D;  3B5K A;  2CYK A;  1AX8 A;  3H3V E;  1Y1W D;  4WRL B;  2D9Q A;  1HUW A;  3HOU D;  3OG4 A;  3I4M D;  1BP3 A;  4D2B A;  2IL6 A;  3HOZ D;  1EVS A;  3QB1 A;  2L3Y A;  4J05 A;  4ZWC A;  3OQ3 A;  4DKF A;  3PO3 D;  4RS1 A;  1Z92 A;  1Y6K L;  5EQG A;  3NCC A;  4A3F D;  3WDO A;  5IP9 D;  5C7X A;  4DKD A;  2OQP A;  3BPL A;  3H0G D;  4YUE C;  5D28 B;  1CSG A;  1F6F A;  3HHR A;  3NCB A;  1PY2 A;  1V7N V;  1IK0 A;  2B5I A;  4BBS D;  3S9D A;  2L3O A;  2O27 A;  2R7Z D;  3L5W I;  4ZYR A;  1PW6 A;  4U4T A;  2XUT A;  4U4W A;  4DKC A;  1HZI A;  2HYM B;  2PSM A;  3HOV D;  1B5L A;  5EQI A;  1RFB A;  4O6K A;  4A3D D;  1LKI A;  5A2O A;  4MHL A;  1RCB A;  1NBP A;  4CNI C;  3O7Q A;  5EQH A;  1LK3 A;  1Z7C A;  2JA8 D;  1Y6M L;  3SE4 B;  1M4A A;  2Z3Q A;  4JRE A;  4IKY A;  1ETE A;  5D22 A;  1ALU A;  3EW3 A;  3UX9 A;  3UF5 A;  4EXP A;  2Q7N B;  1ITL A;  1HIJ A;  4I77 Z;  1HWH A;  4GRW A;  4A93 D;  1HGU A;  3MZG A;  5KNH I;  4LEP A;  2O6I A;  3HMX B;  1KF9 A;  3DLQ I;  4A3I D;  3INK C;  4Q65 A;  1ILK A;  2CFQ A;  3DUH C;  1D9G A;  4A3K D;  2JA5 D;  3HOY D;  5FHX A;  3TGX B;  1VLK A;  4D2C A;  3SE3 B;  3LB6 A;  1F45 B;  1AU1 A;  1HUL A;  2JA6 D;  1P9M B;  1BGD A;  3QB7 A;  4D2D A;  1A7M A;  3UEZ E;  1ITF A;  3N06 A;  1CNT 1;  4JA3 A;  5C4X D;  1M4B A;  4LDS A;  2ILK A;  2B8U A;  4YPG C;  1IRL A;  4TPH A;  4YBQ A;  1M47 A;  4FA8 E;  3G6D A;  1IAR A;  4TPG A;  4IKZ A;  1BUY A;  2KZ1 A;  1HWG A;  1ITI A;  4A3B D;  3IRH A;  1PV6 A;  5LQB A;  3LB6 B;  5IP7 D;  1EMR A;  2LAG A;  1PW4 A;  2INT A;  5IYC D;  1EXZ A;  4ZWB A;  4IU9 A;  2O26 A;  1YKB A;  4EXN A;  1BBN A;  4JR9 A;  3O7P A;  3DGC L;  4OAA A;  5GXB A;  2B91 A;  4BXX D;  1SCF A;  4A3J D;  1EER A;  5D59 A;  5FUC A;  4Z5R D;  3NPZ A; 
#chains in the Genus database with same CATH homology
 3EW3 A;  3WCY I;  4DOH A;  1WU3 I;  2B8Z A;  4BBR D;  1QVN A;  3UX9 A;  3B5K A;  3UF5 A;  2CYK A;  1AX8 A;  1EKU A;  1V7M V;  2XQB A;  3FKI D;  3H3V E;  1Y1W D;  4WRL B;  3PIW A;  4EXP A;  5C44 D;  1Y1V D;  1ITL A;  1HIJ A;  2D9Q A;  2Q7N B;  3HOX D;  3HOW D;  1INR A;  1HUW A;  4I77 Z;  1HWH A;  4GRW A;  3UF2 A;  3HOU D;  4A93 D;  1LQS L;  2H24 A;  1HGU A;  3D48 P;  3DI3 A;  3MZG A;  3DI2 A;  4O9H A;  5KNH I;  2O6I A;  3HMX B;  4GS7 A;  4NI9 A;  3OG4 A;  3I4M D;  1KF9 A;  1BP3 A;  3DLQ I;  4A3I D;  3INK C;  1ILK A;  2IL6 A;  4A3E D;  4A3K D;  3DUH C;  1D9G A;  3L5X A;  2JA5 D;  3D85 C;  3HOY D;  3HOZ D;  1EVS A;  3QB1 A;  1M4R A;  2GMF A;  2L3Y A;  5FHX A;  3TGX B;  4A3M D;  4NN7 A;  1VLK A;  1M48 A;  4J4L C;  1IJZ A;  3QAZ A;  3OQ3 A;  3SE3 B;  4DKF A;  1J7V L;  3PO3 D;  3PO2 D;  4RS1 A;  3LB6 A;  1Z92 A;  3D87 A;  1Y6K L;  1F45 B;  1AU1 A;  1HUL A;  1PVH B;  5D72 A;  3NCC A;  1P9M B;  3BPO A;  2JA6 D;  1BGD A;  4NN6 A;  3QB7 A;  4A3F D;  4DKE A;  3OG6 A;  4PS4 A;  5IP9 D;  4YDY I;  5C7X A;  1A7M A;  1D9C A;  3UEZ E;  3PIV A;  4A3L D;  1ITF A;  4DKD A;  1AXI A;  1BGE A;  3NCE A;  2OQP A;  3BPL A;  1HIK A;  3H0G D;  4YUE C;  5D28 B;  3N06 A;  1CNT 1;  2ERJ D;  1CSG A;  5C4X D;  1N1F A;  3QT2 C;  1F6F A;  1M4B A;  5IYD D;  3HHR A;  3QWR B;  4A3G D;  3NCB A;  1PY2 A;  3VA2 A;  2JA7 D;  1CYL A;  1V7N V;  1IK0 A;  2B5I A;  2R92 D;  4BBS D;  3S9D A;  2E9W C;  2L3O A;  2ILK A;  2B8U A;  2O27 A;  1IRL A;  3G9V B;  4YPG C;  2R7Z D;  3L5W I;  4ZF7 A;  1GNC A;  1PW6 A;  2LMS A;  1M47 A;  4FA8 E;  3G6D A;  1IAR A;  4DKC A;  2VUM D;  1HZI A;  2HYM B;  1BUY A;  2PSM A;  2KZ1 A;  1M49 A;  5L6Y C;  3HOV D;  1B5L A;  1HWG A;  1CN4 C;  4X51 A;  4NN5 A;  1ITI A;  2B8X A;  4A3B D;  3IRH A;  4ZS7 A;  5LQB A;  2Z3R A;  4NEJ A;  1GA3 A;  4LRL A;  1RFB A;  5D70 A;  1ITM A;  1BGC A;  3LB6 B;  5IP7 D;  1EMR A;  4NI7 A;  2LAG A;  4O6K A;  2INT A;  4A3D D;  5E4E A;  1EXZ A;  1IL6 A;  5IYC D;  4BY1 D;  2B63 D;  1FYH A;  3BES L;  3EJJ A;  3NCF A;  4NKQ C;  5C3E D;  1LKI A;  2O26 A;  2B8Y A;  1YKB A;  1I1R B;  4MHL A;  1RCB A;  3I4N D;  1NBP A;  1WCM D;  3N0P A;  2B90 A;  3BPN A;  5D71 A;  4CNI C;  1BBN A;  2C35 A;  4EXN A;  1BCN A;  1A22 A;  5FLM D;  3DGC L;  1Y14 A;  4BY7 D;  1FG9 A;  2Q14 A;  3Q1S I;  2R93 D;  1LK3 A;  1Z7C A;  2JA8 D;  2B91 A;  2D48 A;  1Y6M L;  4BXX D;  1RHG A;  4NEM A;  1SCF A;  1JLI A;  1CD9 A;  3AYH A;  5IYB D;  4A3J D;  1EER A;  1Y6N L;  3SE4 B;  5FUC A;  3HHC A;  4Z5R D;  1M4A A;  2Q98 A;  5TS9 A;  2Z3Q A;  4YQX A;  1M4C A;  3NPZ A;  1RW5 A;  1PGR A;  1ETE A;  4A3C D;  5D22 A;  1ALU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...