4ZW9A

Crystal structure of human glut3 bound to d-glucose in the outward-occluded conformation at 1.5 angstrom
Total Genus 224
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
224
sequence length
470
structure length
470
Chain Sequence
MGTQKVTPALIFAITVATIGSFQFGYNTGVINAPEKIIKEFITKTLTDKGNAPPSEVLLTSLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLIVNLLAVTGGCFMGLCKVAKSVEMLILGRLVIGLFCGLCTGFVPMYIGEISPTALRGAFGTLNQLGIVVGILVAQIFGLEFILGSEELWPLLLGFTILPAILQSAALPFCPESPRFLLINRKEEENAKQILQRLWGTQDVSQDIQEMKDESARMSQEKQVTVLELFRVSSYRQPIIISIVLQLSQQLSGINAVFYYSTGIFKDAGVQEPIYATIGAGVVNTIFTVVSLFLVERAGRRTLHMIGLGGMAFCSTLMTVSLLLKDNYNGMSFVCIGAILVFVAFFEIGPGPIPWFIVAELFSQGPRPAAMAVAGCSNWTSNFLVGLLFPSAAHYLGAYVFIIFTGFLITFLAFTFFKVPETRGRTFEDITRAFEGQAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of ligand recognition and transport by glucose transporters
pubmed doi rcsb
molecule keywords Solute carrier family 2, facilitated glucose transporter mem
molecule tags Transport protein
source organism Homo sapiens
total genus 224
structure length 470
sequence length 470
ec nomenclature
pdb deposition date 2015-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00083 Sugar_tr Sugar (and other) transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1250.20 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; MFS general substrate transporter like domains 4zw9A00
4D2CA 4OAAA 4IKXA 1PV6A 4J05A 4ZYRA 4XNIA 4IU9A 4W6VA 4JA3A 4XNJA 4APSA 4UVMA 4GBZA 5D58A 5A2NA 4IKVA 4JREA 2CFPA 4JR9A 4ZWCA 4ZWBA 4Q65A 5C65A 4LEPA 4D2DA 4YBQA 4IKWA 4U4TA 4TPHA 3O7PA 4GBYA 5A2OA 3WDOA 4U4VA 4ZW9A 2CFQA 1PW4A 2Y5YA 4IKZA 4OH3A 3O7QA 4PYPA 4IKYA 4IU8A 5D59A 5EQHA 4U4WA 2XUTA 4D2BA 4LDSA 5D6KA 5EQGA 4YB9D 4TPGA 4QIQA 1PV7A 4GC0A 5EQIA 4TPJA 5GXBA 2V8NA
chains in the Genus database with same CATH superfamily
1WU3I 5IYBD 1BGDA 3UEZE 4GBZA 3G9VB 3QWRB 1PGRA 2B8YA 3PIWA 4TPHA 1INRA 2R7ZD 1PVHB 3DI2A 4A3DD 4IKYA 5D6KA 4X51A 1D9CA 2V8NA 4JA3A 3L5XA 1Y1WD 5C65A 4O6KA 4ZWCA 3NCFA 1Y6ML 3QAZA 1HIJA 1EKUA 4YUEC 4IKWA 2JA7D 1M4RA 1QVNA 2B8UA 4NI9A 4PS4A 3PO2D 3HMXB 2B91A 4NN6A 4EXNA 1EXZA 4A3JD 3N0PA 1Y6KL 4A3LD 5D58A 4YDYI 3AYHA 4BBRD 1P9MB 4A3ED 2CFQA 1PW4A 5EQHA 4U4WA 4A3KD 4FA8E 1CSGA 4XNIA 1BCNA 2R93D 1IRLA 3UF5A 3H3VE 1KF9A 4LRLA 5D59A 1VLKA 4TPGA 3I4ND 1M47A 4NEMA 1EVSA 2GMFA 1ITFA 1V7MV 1B5LA 1HIKA 4LEPA 4YBQA 3HOUD 4U4TA 4DKEA 1IL6A 4NI7A 3WDOA 1BGCA 4U4VA 5FUCA 2Z3QA 5KNHI 3B5KA 3SE4B 3I4MD 3D85C 5E4EA 3UF2A 3DGCL 3EW3A 4WRLB 2D48A 3DI3A 4YPGC 1Y14A 3OQ3A 1M4CA 2Q7NB 1V7NV 4A3GD 3N06A 5D22A 3QB1A 1Z7CA 1CD9A 3HOYD 5D72A 4A93D 1M4AA 4A3FD 3HOZD 4IU9A 1A22A 4JR9A 1LQSL 2C35A 4D2DA 4NEJA 4BBSD 1WCMD 2ERJD 5A2OA 1PW6A 2INTA 4OH3A 4MHLA 2JA8D 2H24A 4IU8A 2XQBA 5C44D 2PSMA 3DUHC 2Q14A 2B5IA 1PV7A 3HOVD 5IP9D 1AXIA 4BXXD 3LB6A 4W6VA 4APSA 1IJZA 4UVMA 4IKVA 2CFPA 3BPNA 4ZWBA 2B90A 1HZIA 3DLQI 3QB7A 3SE3B 3D48P 2IL6A 1NBPA 3QT2C 2CYKA 4CNIC 1GNCA 1A7MA 2O26A 4QIQA 2B63D 4GC0A 4RS1A 4TPJA 1PV6A 1I1RB 5A2NA 1IARA 4I77Z 5D70A 5C7XA 5D28B 3OG6A 4ZS7A 1Y6NL 2Y5YA 1ITLA 1RFBA 3S9DA 3VA2A 3NCCA 5FLMD 5C3ED 1ITMA 1HWGA 4NKQC 3NCEA 4XNJA 4DKFA 4A3MD 3O7PA 3HHCA 1AX8A 3O7QA 3UX9A 1F45B 2JA5D 2Z3RA 4EXPA 1N1FA 3BESL 1RCBA 2KZ1A 1D9GA 3NCBA 2HYMB 3G6DA 1LK3A 4GS7A 2ILKA 2VUMD 1CN4C 4O9HA 3WCYI 4Z5RD 4ZF7A 3LB6B 1RHGA 4JREA 2D9QA 2B8XA 1YKBA 5IYDD 3D87A 1Y1VD 5FHXA 3Q1SI 4LDSA 5D71A 5IYCD 1EERA 1ALUA 3BPLA 1AU1A 1CYLA 1BGEA 3HOWD 4GBYA 1M4BA 3TGXB 1RW5A 1IK0A 1HULA 1FG9A 2R92D 1HGUA 1ILKA 4GRWA 2LAGA 1F6FA 4NN7A 3PO3D 1JLIA 2JA6D 5EQIA 3HOXD 4D2CA 4DKDA 1CNT1 4OAAA 4J05A 4ZYRA 1EMRA 2OQPA 3PIVA 1SCFA 1Z92A 1ITIA 2LMSA 2L3YA 3INKC 1LKIA 3FKID 2E9WC 4DOHA 5L6YC 4IKZA 4A3CD 3L5WI 1BP3A 3EJJA 5EQGA 4YB9D 4YQXA 3H0GD 3HHRA 2B8ZA 4IKXA 3MZGA 2O6IA 3NPZA 4Q65A 1ETEA 4BY7D 1FYHA 3IRHA 2O27A 1PY2A 5TS9A 4D2BA 1J7VL 5LQBA 5IP7D 4J4LC 1BUYA 1HUWA 4BY1D 4DKCA 2L3OA 3BPOA 4ZW9A 3OG4A 4PYPA 4NN5A 4A3BD 1M48A 2XUTA 1GA3A 4A3ID 2Q98A 1HWHA 1M49A 5C4XD 1BBNA 5GXBA
chains in the Genus database with same CATH topology
4D2CA 4OAAA 4IKXA 1PV6A 4J05A 4ZYRA 4XNIA 4IU9A 4W6VA 4JA3A 4XNJA 4APSA 4UVMA 4GBZA 5D58A 5A2NA 4IKVA 4JREA 2CFPA 4JR9A 4ZWCA 4ZWBA 4Q65A 5C65A 4LEPA 4D2DA 4YBQA 4IKWA 4U4TA 4TPHA 3O7PA 4GBYA 5A2OA 3WDOA 4U4VA 4ZW9A 2CFQA 1PW4A 2Y5YA 4IKZA 4OH3A 3O7QA 4PYPA 4IKYA 4IU8A 5D59A 5EQHA 4U4WA 2XUTA 4D2BA 4LDSA 5D6KA 5EQGA 4YB9D 4TPGA 4QIQA 1PV7A 4GC0A 5EQIA 4TPJA 5GXBA 2V8NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D2C A;  4OAA A;  4IKX A;  1PV6 A;  4J05 A;  4ZYR A;  4XNI A;  4IU9 A;  4W6V A;  4JA3 A;  4XNJ A;  4APS A;  4UVM A;  4GBZ A;  5D58 A;  5A2N A;  4IKV A;  4JRE A;  2CFP A;  4JR9 A;  4ZWC A;  4ZWB A;  4Q65 A;  5C65 A;  4LEP A;  4D2D A;  4YBQ A;  4IKW A;  4U4T A;  4TPH A;  3O7P A;  4GBY A;  5A2O A;  3WDO A;  4U4V A;  4ZW9 A;  2CFQ A;  1PW4 A;  2Y5Y A;  4IKZ A;  4OH3 A;  3O7Q A;  4PYP A;  4IKY A;  4IU8 A;  5D59 A;  5EQH A;  4U4W A;  2XUT A;  4D2B A;  4LDS A;  5D6K A;  5EQG A;  4YB9 D;  4TPG A;  4QIQ A;  1PV7 A;  4GC0 A;  5EQI A;  4TPJ A;  5GXB A;  2V8N A; 
#chains in the Genus database with same CATH topology
 1WU3 I;  5IYB D;  1BGD A;  3UEZ E;  4GBZ A;  3G9V B;  3QWR B;  1PGR A;  2B8Y A;  3PIW A;  4TPH A;  1INR A;  2R7Z D;  1PVH B;  3DI2 A;  4A3D D;  4IKY A;  5D6K A;  4X51 A;  1D9C A;  2V8N A;  4JA3 A;  3L5X A;  1Y1W D;  5C65 A;  4O6K A;  4ZWC A;  3NCF A;  1Y6M L;  3QAZ A;  1HIJ A;  1EKU A;  4YUE C;  4IKW A;  2JA7 D;  1M4R A;  1QVN A;  2B8U A;  4NI9 A;  4PS4 A;  3PO2 D;  3HMX B;  2B91 A;  4NN6 A;  4EXN A;  1EXZ A;  4A3J D;  3N0P A;  1Y6K L;  4A3L D;  5D58 A;  4YDY I;  3AYH A;  4BBR D;  1P9M B;  4A3E D;  2CFQ A;  1PW4 A;  5EQH A;  4U4W A;  4A3K D;  4FA8 E;  1CSG A;  4XNI A;  1BCN A;  2R93 D;  1IRL A;  3UF5 A;  3H3V E;  1KF9 A;  4LRL A;  5D59 A;  1VLK A;  4TPG A;  3I4N D;  1M47 A;  4NEM A;  1EVS A;  2GMF A;  1ITF A;  1V7M V;  1B5L A;  1HIK A;  4LEP A;  4YBQ A;  3HOU D;  4U4T A;  4DKE A;  1IL6 A;  4NI7 A;  3WDO A;  1BGC A;  4U4V A;  5FUC A;  2Z3Q A;  5KNH I;  3B5K A;  3SE4 B;  3I4M D;  3D85 C;  5E4E A;  3UF2 A;  3DGC L;  3EW3 A;  4WRL B;  2D48 A;  3DI3 A;  4YPG C;  1Y14 A;  3OQ3 A;  1M4C A;  2Q7N B;  1V7N V;  4A3G D;  3N06 A;  5D22 A;  3QB1 A;  1Z7C A;  1CD9 A;  3HOY D;  5D72 A;  4A93 D;  1M4A A;  4A3F D;  3HOZ D;  4IU9 A;  1A22 A;  4JR9 A;  1LQS L;  2C35 A;  4D2D A;  4NEJ A;  4BBS D;  1WCM D;  2ERJ D;  5A2O A;  1PW6 A;  2INT A;  4OH3 A;  4MHL A;  2JA8 D;  2H24 A;  4IU8 A;  2XQB A;  5C44 D;  2PSM A;  3DUH C;  2Q14 A;  2B5I A;  1PV7 A;  3HOV D;  5IP9 D;  1AXI A;  4BXX D;  3LB6 A;  4W6V A;  4APS A;  1IJZ A;  4UVM A;  4IKV A;  2CFP A;  3BPN A;  4ZWB A;  2B90 A;  1HZI A;  3DLQ I;  3QB7 A;  3SE3 B;  3D48 P;  2IL6 A;  1NBP A;  3QT2 C;  2CYK A;  4CNI C;  1GNC A;  1A7M A;  2O26 A;  4QIQ A;  2B63 D;  4GC0 A;  4RS1 A;  4TPJ A;  1PV6 A;  1I1R B;  5A2N A;  1IAR A;  4I77 Z;  5D70 A;  5C7X A;  5D28 B;  3OG6 A;  4ZS7 A;  1Y6N L;  2Y5Y A;  1ITL A;  1RFB A;  3S9D A;  3VA2 A;  3NCC A;  5FLM D;  5C3E D;  1ITM A;  1HWG A;  4NKQ C;  3NCE A;  4XNJ A;  4DKF A;  4A3M D;  3O7P A;  3HHC A;  1AX8 A;  3O7Q A;  3UX9 A;  1F45 B;  2JA5 D;  2Z3R A;  4EXP A;  1N1F A;  3BES L;  1RCB A;  2KZ1 A;  1D9G A;  3NCB A;  2HYM B;  3G6D A;  1LK3 A;  4GS7 A;  2ILK A;  2VUM D;  1CN4 C;  4O9H A;  3WCY I;  4Z5R D;  4ZF7 A;  3LB6 B;  1RHG A;  4JRE A;  2D9Q A;  2B8X A;  1YKB A;  5IYD D;  3D87 A;  1Y1V D;  5FHX A;  3Q1S I;  4LDS A;  5D71 A;  5IYC D;  1EER A;  1ALU A;  3BPL A;  1AU1 A;  1CYL A;  1BGE A;  3HOW D;  4GBY A;  1M4B A;  3TGX B;  1RW5 A;  1IK0 A;  1HUL A;  1FG9 A;  2R92 D;  1HGU A;  1ILK A;  4GRW A;  2LAG A;  1F6F A;  4NN7 A;  3PO3 D;  1JLI A;  2JA6 D;  5EQI A;  3HOX D;  4D2C A;  4DKD A;  1CNT 1;  4OAA A;  4J05 A;  4ZYR A;  1EMR A;  2OQP A;  3PIV A;  1SCF A;  1Z92 A;  1ITI A;  2LMS A;  2L3Y A;  3INK C;  1LKI A;  3FKI D;  2E9W C;  4DOH A;  5L6Y C;  4IKZ A;  4A3C D;  3L5W I;  1BP3 A;  3EJJ A;  5EQG A;  4YB9 D;  4YQX A;  3H0G D;  3HHR A;  2B8Z A;  4IKX A;  3MZG A;  2O6I A;  3NPZ A;  4Q65 A;  1ETE A;  4BY7 D;  1FYH A;  3IRH A;  2O27 A;  1PY2 A;  5TS9 A;  4D2B A;  1J7V L;  5LQB A;  5IP7 D;  4J4L C;  1BUY A;  1HUW A;  4BY1 D;  4DKC A;  2L3O A;  3BPO A;  4ZW9 A;  3OG4 A;  4PYP A;  4NN5 A;  4A3B D;  1M48 A;  2XUT A;  1GA3 A;  4A3I D;  2Q98 A;  1HWH A;  1M49 A;  5C4X D;  1BBN A;  5GXB A; 
#chains in the Genus database with same CATH homology
 4D2C A;  4OAA A;  4IKX A;  1PV6 A;  4J05 A;  4ZYR A;  4XNI A;  4IU9 A;  4W6V A;  4JA3 A;  4XNJ A;  4APS A;  4UVM A;  4GBZ A;  5D58 A;  5A2N A;  4IKV A;  4JRE A;  2CFP A;  4JR9 A;  4ZWC A;  4ZWB A;  4Q65 A;  5C65 A;  4LEP A;  4D2D A;  4YBQ A;  4IKW A;  4U4T A;  4TPH A;  3O7P A;  4GBY A;  5A2O A;  3WDO A;  4U4V A;  4ZW9 A;  2CFQ A;  1PW4 A;  2Y5Y A;  4IKZ A;  4OH3 A;  3O7Q A;  4PYP A;  4IKY A;  4IU8 A;  5D59 A;  5EQH A;  4U4W A;  2XUT A;  4D2B A;  4LDS A;  5D6K A;  5EQG A;  4YB9 D;  4TPG A;  4QIQ A;  1PV7 A;  4GC0 A;  5EQI A;  4TPJ A;  5GXB A;  2V8N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...