4ZW9A

Crystal structure of human glut3 bound to d-glucose in the outward-occluded conformation at 1.5 angstrom
Total Genus 224
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
224
sequence length
470
structure length
470
Chain Sequence
b'MGTQKVTPALIFAITVATIGSFQFGYNTGVINAPEKIIKEFITKTLTDKGNAPPSEVLLTSLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLIVNLLAVTGGCFMGLCKVAKSVEMLILGRLVIGLFCGLCTGFVPMYIGEISPTALRGAFGTLNQLGIVVGILVAQIFGLEFILGSEELWPLLLGFTILPAILQSAALPFCPESPRFLLINRKEEENAKQILQRLWGTQDVSQDIQEMKDESARMSQEKQVTVLELFRVSSYRQPIIISIVLQLSQQLSGINAVFYYSTGIFKDAGVQEPIYATIGAGVVNTIFTVVSLFLVERAGRRTLHMIGLGGMAFCSTLMTVSLLLKDNYNGMSFVCIGAILVFVAFFEIGPGPIPWFIVAELFSQGPRPAAMAVAGCSNWTSNFLVGLLFPSAAHYLGAYVFIIFTGFLITFLAFTFFKVPETRGRTFEDITRAFEGQAH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Solute carrier family 2, facilitated glucose transporter mem
publication title Molecular basis of ligand recognition and transport by glucose transporters
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 224
structure length 470
sequence length 470
ec nomenclature
pdb deposition date 2015-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00083 Sugar_tr Sugar (and other) transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1250.20 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; MFS general substrate transporter like domains 4zw9A00
4YBQA 4D2DA 4GBYA 4LDSA 5EQIA 2Y5YA 4JA3A 2CFQA 4IKYA 4TPGA 2CFPA 2V8NA 4U4WA 5A2OA 4JR9A 1PW4A 4ZW9A 5EQHA 4ZWCA 4Q65A 4U4TA 3O7PA 4GBZA 4ZYRA 1PV7A 4IKXA 5D6KA 4APSA 5GXBA 4XNIA 4PYPA 4UVMA 5EQGA 3WDOA 4QIQA 4IU8A 4IKWA 4IU9A 4LEPA 4D2BA 4J05A 5D59A 4GC0A 4TPHA 4OAAA 4YB9D 4TPJA 5A2NA 3O7QA 1PV6A 4JREA 5C65A 4XNJA 4OH3A 4IKVA 4U4VA 5D58A 4ZWBA 4IKZA 4D2CA 2XUTA 4W6VA
chains in the Genus database with same CATH superfamily
3QWRB 5IP9D 1YKBA 1HUWA 5L6YC 1HIKA 2L3OA 4EXNA 1M48A 4DKCA 2Z3RA 3BPLA 3UEZE 1RHGA 3NPZA 1IK0A 2R93D 1PGRA 1ITIA 4Z5RD 4D2CA 1BGCA 4W6VA 3DI2A 3B5KA 1ALUA 3UF2A 1PW4A 3PO2D 1D9GA 4ZYRA 1Y6ML 3WDOA 2L3YA 4O9HA 1CD9A 4CNIC 4ZS7A 1V7MV 1HWGA 4DKFA 3VA2A 4QIQA 4NEJA 4A3ID 1IRLA 4ZF7A 1Y1VD 1ILKA 2Z3QA 5FLMD 1ITMA 2OQPA 1PV6A 3LB6B 1RW5A 5D58A 1M4AA 1BUYA 5EQIA 5E4EA 4A3DD 2E9WC 2O6IA 3NCFA 3PIVA 3INKC 3WCYI 1ITLA 5GXBA 5C44D 1EXZA 4NI7A 4A3LD 4BY1D 4NN7A 3N0PA 4TPJA 3O7QA 1D9CA 4X51A 4D2DA 2Q7NB 1BCNA 1F6FA 2B5IA 5D28B 3QT2C 4U4TA 1ITFA 4GBZA 4DKEA 5EQGA 2R92D 2B90A 1CNT1 4J05A 1WU3I 1CSGA 4IKZA 4NN6A 3QAZA 3N06A 2CFQA 3D48P 4GRWA 1M4CA 4A3ED 2D48A 5FHXA 3BPOA 4A3JD 3G9VB 5IP7D 3TGXB 3HOZD 1GA3A 2Q14A 4MHLA 4WRLB 4A93D 1M47A 4LDSA 1VLKA 4A3GD 4U4WA 4BBRD 5D70A 4A3KD 1Y14A 3SE3B 4GS7A 1AXIA 1BGDA 1LQSL 2B8YA 1PW6A 1EERA 2ILKA 4IU8A 2B8ZA 3PO3D 4NN5A 1INRA 1WCMD 5C65A 2KZ1A 1EVSA 2IL6A 3DGCL 4TPGA 2C35A 4JR9A 2B91A 1EMRA 1BBNA 4PS4A 5C4XD 1RFBA 4A3BD 2ERJD 2JA6D 2CYKA 2GMFA 5FUCA 5TS9A 3FKID 4YQXA 1J7VL 1V7NV 4NI9A 4IKVA 2JA7D 4BBSD 4ZWBA 1BP3A 3Q1SI 2XQBA 1JLIA 3HHRA 4GBYA 1Y6NL 2JA5D 3D87A 3AYHA 4YPGC 1LK3A 1PV7A 4DKDA 4XNIA 4UVMA 3BPNA 5D71A 4IKWA 3S9DA 2PSMA 2B8XA 2HYMB 1B5LA 4JREA 5LQBA 3L5XA 3NCEA 1RCBA 4U4VA 2XUTA 3OG6A 5IYCD 1A22A 1HZIA 1Z92A 4IKXA 1M4RA 3OQ3A 4TPHA 4BY7D 2INTA 5D22A 4OH3A 2B8UA 5IYDD 3OG4A 3HOUD 4FA8E 1LKIA 5EQHA 4J4LC 4YUEC 2O27A 1HWHA 3PIWA 4IU9A 3HOXD 1A7MA 5D59A 4GC0A 1AX8A 5A2NA 1CN4C 1P9MB 1BGEA 3MZGA 1FG9A 1M49A 4IKYA 3QB7A 4ZW9A 1PY2A 1M4BA 5D6KA 1I1RB 3DUHC 1EKUA 2H24A 4EXPA 3DI3A 4LEPA 5KNHI 3QB1A 4XNJA 3DLQI 3L5WI 3BESL 3EJJA 1CYLA 3HOVD 4O6KA 3HOWD 4YDYI 4Q65A 3O7PA 3UF5A 1GNCA 3G6DA 4A3MD 2B63D 4NEMA 2LMSA 4YBQA 2R7ZD 1KF9A 5A2OA 4A3FD 3HMXB 2D9QA 1IARA 4NKQC 4I77Z 4DOHA 2O26A 5IYBD 1IL6A 4BXXD 2JA8D 4OAAA 1IJZA 3HHCA 3LB6A 3H3VE 1Y1WD 2LAGA 5C7XA 3IRHA 2Y5YA 4JA3A 3I4ND 1HGUA 2CFPA 1AU1A 3UX9A 1HIJA 4A3CD 1QVNA 1Z7CA 3EW3A 1N1FA 5C3ED 1NBPA 2VUMD 4D2BA 4LRLA 1FYHA 3D85C 3NCBA 1PVHB 4APSA 1ETEA 4RS1A 5D72A 2V8NA 1SCFA 4ZWCA 1HULA 2Q98A 3HOYD 4PYPA 4YB9D 3NCCA 3I4MD 1F45B 3SE4B 1Y6KL 3H0GD
chains in the Genus database with same CATH topology
4YBQA 4D2DA 4GBYA 4LDSA 5EQIA 2Y5YA 4JA3A 2CFQA 4IKYA 4TPGA 2CFPA 2V8NA 4U4WA 5A2OA 4JR9A 1PW4A 4ZW9A 5EQHA 4ZWCA 4Q65A 4U4TA 3O7PA 4GBZA 4ZYRA 1PV7A 4IKXA 5D6KA 4APSA 5GXBA 4XNIA 4PYPA 4UVMA 5EQGA 3WDOA 4QIQA 4IU8A 4IKWA 4IU9A 4LEPA 4D2BA 4J05A 5D59A 4GC0A 4TPHA 4OAAA 4YB9D 4TPJA 5A2NA 3O7QA 1PV6A 4JREA 5C65A 4XNJA 4OH3A 4IKVA 4U4VA 5D58A 4ZWBA 4IKZA 4D2CA 2XUTA 4W6VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YBQ A;  4D2D A;  4GBY A;  4LDS A;  5EQI A;  2Y5Y A;  4JA3 A;  2CFQ A;  4IKY A;  4TPG A;  2CFP A;  2V8N A;  4U4W A;  5A2O A;  4JR9 A;  1PW4 A;  4ZW9 A;  5EQH A;  4ZWC A;  4Q65 A;  4U4T A;  3O7P A;  4GBZ A;  4ZYR A;  1PV7 A;  4IKX A;  5D6K A;  4APS A;  5GXB A;  4XNI A;  4PYP A;  4UVM A;  5EQG A;  3WDO A;  4QIQ A;  4IU8 A;  4IKW A;  4IU9 A;  4LEP A;  4D2B A;  4J05 A;  5D59 A;  4GC0 A;  4TPH A;  4OAA A;  4YB9 D;  4TPJ A;  5A2N A;  3O7Q A;  1PV6 A;  4JRE A;  5C65 A;  4XNJ A;  4OH3 A;  4IKV A;  4U4V A;  5D58 A;  4ZWB A;  4IKZ A;  4D2C A;  2XUT A;  4W6V A; 
#chains in the Genus database with same CATH topology
 3QWR B;  5IP9 D;  1YKB A;  1HUW A;  5L6Y C;  1HIK A;  2L3O A;  4EXN A;  1M48 A;  4DKC A;  2Z3R A;  3BPL A;  3UEZ E;  1RHG A;  3NPZ A;  1IK0 A;  2R93 D;  1PGR A;  1ITI A;  4Z5R D;  4D2C A;  1BGC A;  4W6V A;  3DI2 A;  3B5K A;  1ALU A;  3UF2 A;  1PW4 A;  3PO2 D;  1D9G A;  4ZYR A;  1Y6M L;  3WDO A;  2L3Y A;  4O9H A;  1CD9 A;  4CNI C;  4ZS7 A;  1V7M V;  1HWG A;  4DKF A;  3VA2 A;  4QIQ A;  4NEJ A;  4A3I D;  1IRL A;  4ZF7 A;  1Y1V D;  1ILK A;  2Z3Q A;  5FLM D;  1ITM A;  2OQP A;  1PV6 A;  3LB6 B;  1RW5 A;  5D58 A;  1M4A A;  1BUY A;  5EQI A;  5E4E A;  4A3D D;  2E9W C;  2O6I A;  3NCF A;  3PIV A;  3INK C;  3WCY I;  1ITL A;  5GXB A;  5C44 D;  1EXZ A;  4NI7 A;  4A3L D;  4BY1 D;  4NN7 A;  3N0P A;  4TPJ A;  3O7Q A;  1D9C A;  4X51 A;  4D2D A;  2Q7N B;  1BCN A;  1F6F A;  2B5I A;  5D28 B;  3QT2 C;  4U4T A;  1ITF A;  4GBZ A;  4DKE A;  5EQG A;  2R92 D;  2B90 A;  1CNT 1;  4J05 A;  1WU3 I;  1CSG A;  4IKZ A;  4NN6 A;  3QAZ A;  3N06 A;  2CFQ A;  3D48 P;  4GRW A;  1M4C A;  4A3E D;  2D48 A;  5FHX A;  3BPO A;  4A3J D;  3G9V B;  5IP7 D;  3TGX B;  3HOZ D;  1GA3 A;  2Q14 A;  4MHL A;  4WRL B;  4A93 D;  1M47 A;  4LDS A;  1VLK A;  4A3G D;  4U4W A;  4BBR D;  5D70 A;  4A3K D;  1Y14 A;  3SE3 B;  4GS7 A;  1AXI A;  1BGD A;  1LQS L;  2B8Y A;  1PW6 A;  1EER A;  2ILK A;  4IU8 A;  2B8Z A;  3PO3 D;  4NN5 A;  1INR A;  1WCM D;  5C65 A;  2KZ1 A;  1EVS A;  2IL6 A;  3DGC L;  4TPG A;  2C35 A;  4JR9 A;  2B91 A;  1EMR A;  1BBN A;  4PS4 A;  5C4X D;  1RFB A;  4A3B D;  2ERJ D;  2JA6 D;  2CYK A;  2GMF A;  5FUC A;  5TS9 A;  3FKI D;  4YQX A;  1J7V L;  1V7N V;  4NI9 A;  4IKV A;  2JA7 D;  4BBS D;  4ZWB A;  1BP3 A;  3Q1S I;  2XQB A;  1JLI A;  3HHR A;  4GBY A;  1Y6N L;  2JA5 D;  3D87 A;  3AYH A;  4YPG C;  1LK3 A;  1PV7 A;  4DKD A;  4XNI A;  4UVM A;  3BPN A;  5D71 A;  4IKW A;  3S9D A;  2PSM A;  2B8X A;  2HYM B;  1B5L A;  4JRE A;  5LQB A;  3L5X A;  3NCE A;  1RCB A;  4U4V A;  2XUT A;  3OG6 A;  5IYC D;  1A22 A;  1HZI A;  1Z92 A;  4IKX A;  1M4R A;  3OQ3 A;  4TPH A;  4BY7 D;  2INT A;  5D22 A;  4OH3 A;  2B8U A;  5IYD D;  3OG4 A;  3HOU D;  4FA8 E;  1LKI A;  5EQH A;  4J4L C;  4YUE C;  2O27 A;  1HWH A;  3PIW A;  4IU9 A;  3HOX D;  1A7M A;  5D59 A;  4GC0 A;  1AX8 A;  5A2N A;  1CN4 C;  1P9M B;  1BGE A;  3MZG A;  1FG9 A;  1M49 A;  4IKY A;  3QB7 A;  4ZW9 A;  1PY2 A;  1M4B A;  5D6K A;  1I1R B;  3DUH C;  1EKU A;  2H24 A;  4EXP A;  3DI3 A;  4LEP A;  5KNH I;  3QB1 A;  4XNJ A;  3DLQ I;  3L5W I;  3BES L;  3EJJ A;  1CYL A;  3HOV D;  4O6K A;  3HOW D;  4YDY I;  4Q65 A;  3O7P A;  3UF5 A;  1GNC A;  3G6D A;  4A3M D;  2B63 D;  4NEM A;  2LMS A;  4YBQ A;  2R7Z D;  1KF9 A;  5A2O A;  4A3F D;  3HMX B;  2D9Q A;  1IAR A;  4NKQ C;  4I77 Z;  4DOH A;  2O26 A;  5IYB D;  1IL6 A;  4BXX D;  2JA8 D;  4OAA A;  1IJZ A;  3HHC A;  3LB6 A;  3H3V E;  1Y1W D;  2LAG A;  5C7X A;  3IRH A;  2Y5Y A;  4JA3 A;  3I4N D;  1HGU A;  2CFP A;  1AU1 A;  3UX9 A;  1HIJ A;  4A3C D;  1QVN A;  1Z7C A;  3EW3 A;  1N1F A;  5C3E D;  1NBP A;  2VUM D;  4D2B A;  4LRL A;  1FYH A;  3D85 C;  3NCB A;  1PVH B;  4APS A;  1ETE A;  4RS1 A;  5D72 A;  2V8N A;  1SCF A;  4ZWC A;  1HUL A;  2Q98 A;  3HOY D;  4PYP A;  4YB9 D;  3NCC A;  3I4M D;  1F45 B;  3SE4 B;  1Y6K L;  3H0G D; 
#chains in the Genus database with same CATH homology
 4YBQ A;  4D2D A;  4GBY A;  4LDS A;  5EQI A;  2Y5Y A;  4JA3 A;  2CFQ A;  4IKY A;  4TPG A;  2CFP A;  2V8N A;  4U4W A;  5A2O A;  4JR9 A;  1PW4 A;  4ZW9 A;  5EQH A;  4ZWC A;  4Q65 A;  4U4T A;  3O7P A;  4GBZ A;  4ZYR A;  1PV7 A;  4IKX A;  5D6K A;  4APS A;  5GXB A;  4XNI A;  4PYP A;  4UVM A;  5EQG A;  3WDO A;  4QIQ A;  4IU8 A;  4IKW A;  4IU9 A;  4LEP A;  4D2B A;  4J05 A;  5D59 A;  4GC0 A;  4TPH A;  4OAA A;  4YB9 D;  4TPJ A;  5A2N A;  3O7Q A;  1PV6 A;  4JRE A;  5C65 A;  4XNJ A;  4OH3 A;  4IKV A;  4U4V A;  5D58 A;  4ZWB A;  4IKZ A;  4D2C A;  2XUT A;  4W6V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...