1IK0A

Solution structure of human il-13
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
113
structure length
113
Chain Sequence
MGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of human IL-13 and implication for receptor binding.
pubmed doi rcsb
molecule keywords INTERLEUKIN-13
molecule tags Cytokine
source organism Homo sapiens
total genus 23
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2001-05-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1250.10 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; Growth Hormone; Chain: A; 1ik0A00
1RCBA 3EW3A 1A7MA 2L3OA 3S9DA 3VA2A 2CYKA 3L5XA 4O6KA 1Y6NL 1HULA 1IK0A 1GA3A 1Z7CA 1M49A 3BPLA 1D9CA 1YKBA 3LB6A 3QB7A 3B5KA 3G9VB 2B90A 1KF9A 1RW5A 1Y6KL 3LB6B 3UF5A 1WU3I 2B91A 3L5WI 1N1FA 1I1RB 2LMSA 4GRWA 1ITIA 1AX8A 3UX9A 3NCCA 3BPOA 3HHRA 1BCNA 1RHGA 1M4AA 2O27A 1HUWA 1ALUA 3OQ3A 1A22A 1SCFA 1FG9A 5D71A 3QAZA 1AU1A 1CD9A 1PY2A 4ZF7A 3QB1A 1BGDA 2O26A 3EJJA 3N0PA 1VLKA 1BGCA 5D72A 3NCFA 2INTA 1ETEA 4NI9A 3D85C 1CN4C 1EERA 4ZS7A 4CNIC 4X51A 1Y6ML 1V7MV 3SE4B 1BUYA 1LQSL 2L3YA 4J4LC 1IRLA 1JLIA 5FHXA 1EVSA 4YUEC 1BP3A 1D9GA 1LKIA 3DLQI 1EMRA 4YQXA 4FA8E 1HZIA 1EXZA 2E9WC 4MHLA 5C7XA 3MZGA 1LK3A 1PGRA 2B8ZA 2B8XA 3UEZE 3HMXB 2B5IA 3G6DA 1B5LA 1HGUA 4RS1A 3N06A 3QWRB 1Z92A 1FYHA 3D48P 4WRLB 1CSGA 1IJZA 3D87A 5FUCA 1F6FA 3BPNA 1BBNA 1AXIA 2ILKA 2ERJD 1HIJA 3INKC 3NCBA 4PS4A 1M4CA 3BESL 1GNCA 1EKUA 1ITMA 5D28B 2Q7NB 5L6YC 3UF2A 2HYMB 5D22A 1HWGA 1ITLA 1PW6A 3Q1SI 4I77Z 4NKQC 3DUHC 1RFBA 2GMFA 1PVHB 1CNT1 1ITFA 5KNHI 1CYLA 1BGEA 1V7NV 1HWHA 2KZ1A 4O9HA 1M47A 2H24A 5E4EA 4Z5RD 3SE3B 1M48A 3PIWA 1M4RA 4NEJA 1ILKA 3PIVA 1M4BA 5LQBA 1IL6A 1HIKA 5D70A 1F45B 2LAGA 1QVNA 3DGCL 2D48A 4NI7A 3WCYI 4DOHA 2IL6A 4YPGC 2B8YA 4YDYI 3NCEA 1NBPA 3QT2C 1IARA 1INRA 1P9MB 4NEMA 3NPZA 1J7VL 2D9QA 2B8UA 2Q98A
chains in the Genus database with same CATH superfamily
3DI2A 1A7MA 5IYDD 4NN5A 2CYKA 3BPLA 3IRHA 3B5KA 4GC0A 4LRLA 1KF9A 3WDOA 3UF5A 1WU3I 3L5WI 1ITIA 4JA3A 1HUWA 4A3JD 5D59A 2O26A 4ZW9A 4GS7A 1VLKA 1BGCA 3NCFA 1CN4C 3OG4A 3PO3D 1BP3A 1LKIA 4FA8E 5C7XA 1PGRA 2B8ZA 5C4XD 4ZWCA 4IU8A 1B5LA 4RS1A 1Z92A 3D48P 4A3FD 3BPNA 4A3ED 4D2CA 3HOUD 4TPHA 5A2OA 1GNCA 3HOXD 1ITMA 5L6YC 3UF2A 2HYMB 5D22A 1HWGA 2Z3RA 4NKQC 1RFBA 3HOVD 1CYLA 2OQPA 1M47A 2H24A 1M48A 4NEJA 4UVMA 1ILKA 5LQBA 3HOWD 4NN6A 2D48A 3TGXB 4DOHA 4YPGC 4A3LD 2B8YA 4IU9A 2JA7D 4ZWBA 4A3GD 1INRA 1P9MB 4NEMA 2CFPA 4PYPA 4BBRD 4APSA 1RCBA 3H3VE 3L5XA 1HULA 1IK0A 1GA3A 3AYHA 1Z7CA 4IKXA 2B63D 1YKBA 2VUMD 4OH3A 2B90A 1RW5A 3LB6B 4J05A 4QIQA 1I1RB 2LMSA 5IP9D 3O7PA 3UX9A 3NCCA 1BCNA 1SCFA 4TPGA 1CD9A 4ZF7A 1PW4A 1BGDA 3EJJA 4Q65A 3N0PA 3PO2D 5D72A 4BBSD 2INTA 1ETEA 3SE4B 4J4LC 1EVSA 3DI3A 1EMRA 1EXZA 2E9WC 2B8XA 4DKEA 5C65A 3N06A 2JA5D 4U4VA 3D87A 1IJZA 4GBZA 2ERJD 1HIJA 2V8NA 3NCBA 1M4CA 2Z3QA 4A3BD 2Q7NB 1ITLA 1PW6A 3Q1SI 1PV6A 3DUHC 2GMFA 1CNT1 1ITFA 5D58A 3FKID 1PV7A 4O9HA 4Z5RD 3OG6A 3PIWA 1M4RA 5A2NA 2Q14A 4XNJA 3O7QA 1M4BA 1QVNA 4W6VA 5EQIA 3NCEA 1NBPA 1IARA 4A3ID 2D9QA 2B8UA 3VA2A 4O6KA 1Y6NL 4A3MD 1M49A 3LB6A 3QB7A 3G9VB 5IP7D 3HHRA 1RHGA 1M4AA 2O27A 1ALUA 1A22A 1FG9A 1WCMD 3QB1A 5TS9A 2Y5YA 1EERA 4ZS7A 1BUYA 1LQSL 2L3YA 2XUTA 2JA6D 5FHXA 4YUEC 5C3ED 4A3DD 1LK3A 3UEZE 5IYBD 2C35A 4LDSA 1HGUA 4DKDA 3QWRB 5D6KA 5EQHA 4WRLB 1AXIA 4BY7D 2ILKA 4PS4A 4JREA 3HOYD 5D28B 4IKZA 4GBYA 5GXBA 1PVHB 3HOZD 4EXPA 1BGEA 4LEPA 1V7NV 5E4EA 3SE3B 2PSMA 4BXXD 4BY1D 4YBQA 2CFQA 1Y1WD 1IL6A 1HIKA 5D70A 3DGCL 1Y1VD 3H0GD 4NI7A 3WCYI 2IL6A 3QT2C 4OAAA 2R7ZD 4DKFA 3NPZA 1J7VL 3PIVA 4A3KD 3EW3A 2L3OA 3S9DA 4A93D 2JA8D 4ZYRA 1D9CA 1Y14A 1Y6KL 2B91A 1N1FA 2XQBA 4GRWA 1AX8A 3BPOA 4JR9A 3OQ3A 5D71A 3QAZA 1AU1A 4D2DA 1PY2A 4NI9A 3D85C 4CNIC 4X51A 1Y6ML 1V7MV 2R92D 1IRLA 1JLIA 1D9GA 3DLQI 4YQXA 1HZIA 3I4MD 4MHLA 3MZGA 3HMXB 2B5IA 3G6DA 1FYHA 5FUCA 1CSGA 4TPJA 5C44D 3I4ND 1F6FA 1BBNA 2R93D 3HHCA 4U4WA 3INKC 3BESL 4IKWA 5FLMD 1EKUA 4NN7A 5EQGA 5IYCD 4I77Z 5KNHI 1HWHA 2KZ1A 4XNIA 2O6IA 4IKYA 4U4TA 4D2BA 1F45B 2LAGA 4IKVA 4A3CD 4EXNA 4YDYI 4YB9D 4DKCA 2Q98A
chains in the Genus database with same CATH topology
1RCBA 3EW3A 3H3VE 3DI2A 1A7MA 5IYDD 2L3OA 4NN5A 3S9DA 3VA2A 2CYKA 3L5XA 4O6KA 4A93D 1Y6NL 1HULA 1IK0A 1GA3A 3AYHA 4A3MD 2JA8D 1Z7CA 2B63D 1M49A 3BPLA 1D9CA 1Y14A 1YKBA 2VUMD 3IRHA 3LB6A 3QB7A 3B5KA 3G9VB 2B90A 1KF9A 1RW5A 1Y6KL 3LB6B 4LRLA 1WU3I 3UF5A 2B91A 3L5WI 1N1FA 2XQBA 1I1RB 2LMSA 4GRWA 1ITIA 5IP9D 1AX8A 3UX9A 3NCCA 3BPOA 5IP7D 3HHRA 1BCNA 1RHGA 1M4AA 2O27A 1HUWA 1ALUA 3OQ3A 4A3JD 1A22A 1SCFA 1FG9A 5D71A 3QAZA 1GNCA 1AU1A 1WCMD 1CD9A 1PY2A 4ZF7A 3QB1A 1BGDA 2O26A 3EJJA 3N0PA 4GS7A 3PO2D 1VLKA 1BGCA 5D72A 5TS9A 4BBSD 3NCFA 2INTA 1ETEA 4NI9A 3D85C 1CN4C 1EERA 4ZS7A 3OG4A 4CNIC 4X51A 1Y6ML 1V7MV 3SE4B 2R92D 1BUYA 1LQSL 2L3YA 4J4LC 1IRLA 1JLIA 2JA6D 3PO3D 5FHXA 1EVSA 4YUEC 1BP3A 5C3ED 1D9GA 1LKIA 3DI3A 3DLQI 4A3DD 1EMRA 4YQXA 4FA8E 1HZIA 3I4MD 1EXZA 2E9WC 4MHLA 5C7XA 3MZGA 1LK3A 1PGRA 2B8ZA 2B8XA 3UEZE 5IYBD 3HMXB 5C4XD 2C35A 4DKEA 2B5IA 3G6DA 1B5LA 1HGUA 4RS1A 3N06A 3QWRB 4DKDA 2JA5D 1Z92A 1FYHA 3D48P 4WRLB 1CSGA 1IJZA 3D87A 5FUCA 5C44D 4A3FD 3I4ND 1F6FA 3BPNA 1BBNA 4A3ED 2R93D 3HOUD 1AXIA 4BY7D 2ILKA 3HHCA 2ERJD 1HIJA 3INKC 3NCBA 4PS4A 1M4CA 3BESL 5FLMD 1EKUA 1ITMA 2Z3QA 5D28B 4NN7A 2Q7NB 5L6YC 3HOXD 3UF2A 2HYMB 3HOYD 4A3BD 5D22A 5IYCD 1HWGA 1ITLA 1PW6A 2Z3RA 3Q1SI 4I77Z 3DUHC 4NKQC 1RFBA 2GMFA 1PVHB 3HOVD 1CNT1 1ITFA 3HOZD 5KNHI 4EXPA 1CYLA 2OQPA 1BGEA 1V7NV 3FKID 1HWHA 2KZ1A 4O9HA 1M47A 2H24A 5E4EA 2PSMA 4Z5RD 1M48A 3OG6A 3PIWA 1M4RA 4NEJA 3SE3B 4BXXD 4BY1D 2O6IA 1ILKA 2Q14A 3PIVA 1Y1WD 1M4BA 5LQBA 1IL6A 1HIKA 5D70A 3HOWD 1F45B 2LAGA 1QVNA 3DGCL 2D48A 1Y1VD 3H0GD 4NN6A 3TGXB 4A3CD 4NI7A 3WCYI 4EXNA 4DOHA 2IL6A 4YPGC 2B8YA 4A3LD 2JA7D 4YDYI 3NCEA 1NBPA 3QT2C 4A3GD 1IARA 1INRA 1P9MB 2R7ZD 4A3ID 4NEMA 4DKFA 3NPZA 1J7VL 2D9QA 4BBRD 2B8UA 4DKCA 2Q98A 4A3KD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RCB A;  3EW3 A;  1A7M A;  2L3O A;  3S9D A;  3VA2 A;  2CYK A;  3L5X A;  4O6K A;  1Y6N L;  1HUL A;  1IK0 A;  1GA3 A;  1Z7C A;  1M49 A;  3BPL A;  1D9C A;  1YKB A;  3LB6 A;  3QB7 A;  3B5K A;  3G9V B;  2B90 A;  1KF9 A;  1RW5 A;  1Y6K L;  3LB6 B;  3UF5 A;  1WU3 I;  2B91 A;  3L5W I;  1N1F A;  1I1R B;  2LMS A;  4GRW A;  1ITI A;  1AX8 A;  3UX9 A;  3NCC A;  3BPO A;  3HHR A;  1BCN A;  1RHG A;  1M4A A;  2O27 A;  1HUW A;  1ALU A;  3OQ3 A;  1A22 A;  1SCF A;  1FG9 A;  5D71 A;  3QAZ A;  1AU1 A;  1CD9 A;  1PY2 A;  4ZF7 A;  3QB1 A;  1BGD A;  2O26 A;  3EJJ A;  3N0P A;  1VLK A;  1BGC A;  5D72 A;  3NCF A;  2INT A;  1ETE A;  4NI9 A;  3D85 C;  1CN4 C;  1EER A;  4ZS7 A;  4CNI C;  4X51 A;  1Y6M L;  1V7M V;  3SE4 B;  1BUY A;  1LQS L;  2L3Y A;  4J4L C;  1IRL A;  1JLI A;  5FHX A;  1EVS A;  4YUE C;  1BP3 A;  1D9G A;  1LKI A;  3DLQ I;  1EMR A;  4YQX A;  4FA8 E;  1HZI A;  1EXZ A;  2E9W C;  4MHL A;  5C7X A;  3MZG A;  1LK3 A;  1PGR A;  2B8Z A;  2B8X A;  3UEZ E;  3HMX B;  2B5I A;  3G6D A;  1B5L A;  1HGU A;  4RS1 A;  3N06 A;  3QWR B;  1Z92 A;  1FYH A;  3D48 P;  4WRL B;  1CSG A;  1IJZ A;  3D87 A;  5FUC A;  1F6F A;  3BPN A;  1BBN A;  1AXI A;  2ILK A;  2ERJ D;  1HIJ A;  3INK C;  3NCB A;  4PS4 A;  1M4C A;  3BES L;  1GNC A;  1EKU A;  1ITM A;  5D28 B;  2Q7N B;  5L6Y C;  3UF2 A;  2HYM B;  5D22 A;  1HWG A;  1ITL A;  1PW6 A;  3Q1S I;  4I77 Z;  4NKQ C;  3DUH C;  1RFB A;  2GMF A;  1PVH B;  1CNT 1;  1ITF A;  5KNH I;  1CYL A;  1BGE A;  1V7N V;  1HWH A;  2KZ1 A;  4O9H A;  1M47 A;  2H24 A;  5E4E A;  4Z5R D;  3SE3 B;  1M48 A;  3PIW A;  1M4R A;  4NEJ A;  1ILK A;  3PIV A;  1M4B A;  5LQB A;  1IL6 A;  1HIK A;  5D70 A;  1F45 B;  2LAG A;  1QVN A;  3DGC L;  2D48 A;  4NI7 A;  3WCY I;  4DOH A;  2IL6 A;  4YPG C;  2B8Y A;  4YDY I;  3NCE A;  1NBP A;  3QT2 C;  1IAR A;  1INR A;  1P9M B;  4NEM A;  3NPZ A;  1J7V L;  2D9Q A;  2B8U A;  2Q98 A; 
#chains in the Genus database with same CATH topology
 3DI2 A;  1A7M A;  5IYD D;  4NN5 A;  2CYK A;  3BPL A;  3IRH A;  3B5K A;  4GC0 A;  4LRL A;  1KF9 A;  3WDO A;  3UF5 A;  1WU3 I;  3L5W I;  1ITI A;  4JA3 A;  1HUW A;  4A3J D;  5D59 A;  2O26 A;  4ZW9 A;  4GS7 A;  1VLK A;  1BGC A;  3NCF A;  1CN4 C;  3OG4 A;  3PO3 D;  1BP3 A;  1LKI A;  4FA8 E;  5C7X A;  1PGR A;  2B8Z A;  5C4X D;  4ZWC A;  4IU8 A;  1B5L A;  4RS1 A;  1Z92 A;  3D48 P;  4A3F D;  3BPN A;  4A3E D;  4D2C A;  3HOU D;  4TPH A;  5A2O A;  1GNC A;  3HOX D;  1ITM A;  5L6Y C;  3UF2 A;  2HYM B;  5D22 A;  1HWG A;  2Z3R A;  4NKQ C;  1RFB A;  3HOV D;  1CYL A;  2OQP A;  1M47 A;  2H24 A;  1M48 A;  4NEJ A;  4UVM A;  1ILK A;  5LQB A;  3HOW D;  4NN6 A;  2D48 A;  3TGX B;  4DOH A;  4YPG C;  4A3L D;  2B8Y A;  4IU9 A;  2JA7 D;  4ZWB A;  4A3G D;  1INR A;  1P9M B;  4NEM A;  2CFP A;  4PYP A;  4BBR D;  4APS A;  1RCB A;  3H3V E;  3L5X A;  1HUL A;  1IK0 A;  1GA3 A;  3AYH A;  1Z7C A;  4IKX A;  2B63 D;  1YKB A;  2VUM D;  4OH3 A;  2B90 A;  1RW5 A;  3LB6 B;  4J05 A;  4QIQ A;  1I1R B;  2LMS A;  5IP9 D;  3O7P A;  3UX9 A;  3NCC A;  1BCN A;  1SCF A;  4TPG A;  1CD9 A;  4ZF7 A;  1PW4 A;  1BGD A;  3EJJ A;  4Q65 A;  3N0P A;  3PO2 D;  5D72 A;  4BBS D;  2INT A;  1ETE A;  3SE4 B;  4J4L C;  1EVS A;  3DI3 A;  1EMR A;  1EXZ A;  2E9W C;  2B8X A;  4DKE A;  5C65 A;  3N06 A;  2JA5 D;  4U4V A;  3D87 A;  1IJZ A;  4GBZ A;  2ERJ D;  1HIJ A;  2V8N A;  3NCB A;  1M4C A;  2Z3Q A;  4A3B D;  2Q7N B;  1ITL A;  1PW6 A;  3Q1S I;  1PV6 A;  3DUH C;  2GMF A;  1CNT 1;  1ITF A;  5D58 A;  3FKI D;  1PV7 A;  4O9H A;  4Z5R D;  3OG6 A;  3PIW A;  1M4R A;  5A2N A;  2Q14 A;  4XNJ A;  3O7Q A;  1M4B A;  1QVN A;  4W6V A;  5EQI A;  3NCE A;  1NBP A;  1IAR A;  4A3I D;  2D9Q A;  2B8U A;  3VA2 A;  4O6K A;  1Y6N L;  4A3M D;  1M49 A;  3LB6 A;  3QB7 A;  3G9V B;  5IP7 D;  3HHR A;  1RHG A;  1M4A A;  2O27 A;  1ALU A;  1A22 A;  1FG9 A;  1WCM D;  3QB1 A;  5TS9 A;  2Y5Y A;  1EER A;  4ZS7 A;  1BUY A;  1LQS L;  2L3Y A;  2XUT A;  2JA6 D;  5FHX A;  4YUE C;  5C3E D;  4A3D D;  1LK3 A;  3UEZ E;  5IYB D;  2C35 A;  4LDS A;  1HGU A;  4DKD A;  3QWR B;  5D6K A;  5EQH A;  4WRL B;  1AXI A;  4BY7 D;  2ILK A;  4PS4 A;  4JRE A;  3HOY D;  5D28 B;  4IKZ A;  4GBY A;  5GXB A;  1PVH B;  3HOZ D;  4EXP A;  1BGE A;  4LEP A;  1V7N V;  5E4E A;  3SE3 B;  2PSM A;  4BXX D;  4BY1 D;  4YBQ A;  2CFQ A;  1Y1W D;  1IL6 A;  1HIK A;  5D70 A;  3DGC L;  1Y1V D;  3H0G D;  4NI7 A;  3WCY I;  2IL6 A;  3QT2 C;  4OAA A;  2R7Z D;  4DKF A;  3NPZ A;  1J7V L;  3PIV A;  4A3K D;  3EW3 A;  2L3O A;  3S9D A;  4A93 D;  2JA8 D;  4ZYR A;  1D9C A;  1Y14 A;  1Y6K L;  2B91 A;  1N1F A;  2XQB A;  4GRW A;  1AX8 A;  3BPO A;  4JR9 A;  3OQ3 A;  5D71 A;  3QAZ A;  1AU1 A;  4D2D A;  1PY2 A;  4NI9 A;  3D85 C;  4CNI C;  4X51 A;  1Y6M L;  1V7M V;  2R92 D;  1IRL A;  1JLI A;  1D9G A;  3DLQ I;  4YQX A;  1HZI A;  3I4M D;  4MHL A;  3MZG A;  3HMX B;  2B5I A;  3G6D A;  1FYH A;  5FUC A;  1CSG A;  4TPJ A;  5C44 D;  3I4N D;  1F6F A;  1BBN A;  2R93 D;  3HHC A;  4U4W A;  3INK C;  3BES L;  4IKW A;  5FLM D;  1EKU A;  4NN7 A;  5EQG A;  5IYC D;  4I77 Z;  5KNH I;  1HWH A;  2KZ1 A;  4XNI A;  2O6I A;  4IKY A;  4U4T A;  4D2B A;  1F45 B;  2LAG A;  4IKV A;  4A3C D;  4EXN A;  4YDY I;  4YB9 D;  4DKC A;  2Q98 A; 
#chains in the Genus database with same CATH homology
 1RCB A;  3EW3 A;  3H3V E;  3DI2 A;  1A7M A;  5IYD D;  2L3O A;  4NN5 A;  3S9D A;  3VA2 A;  2CYK A;  3L5X A;  4O6K A;  4A93 D;  1Y6N L;  1HUL A;  1IK0 A;  1GA3 A;  3AYH A;  4A3M D;  2JA8 D;  1Z7C A;  2B63 D;  1M49 A;  3BPL A;  1D9C A;  1Y14 A;  1YKB A;  2VUM D;  3IRH A;  3LB6 A;  3QB7 A;  3B5K A;  3G9V B;  2B90 A;  1KF9 A;  1RW5 A;  1Y6K L;  3LB6 B;  4LRL A;  1WU3 I;  3UF5 A;  2B91 A;  3L5W I;  1N1F A;  2XQB A;  1I1R B;  2LMS A;  4GRW A;  1ITI A;  5IP9 D;  1AX8 A;  3UX9 A;  3NCC A;  3BPO A;  5IP7 D;  3HHR A;  1BCN A;  1RHG A;  1M4A A;  2O27 A;  1HUW A;  1ALU A;  3OQ3 A;  4A3J D;  1A22 A;  1SCF A;  1FG9 A;  5D71 A;  3QAZ A;  1GNC A;  1AU1 A;  1WCM D;  1CD9 A;  1PY2 A;  4ZF7 A;  3QB1 A;  1BGD A;  2O26 A;  3EJJ A;  3N0P A;  4GS7 A;  3PO2 D;  1VLK A;  1BGC A;  5D72 A;  5TS9 A;  4BBS D;  3NCF A;  2INT A;  1ETE A;  4NI9 A;  3D85 C;  1CN4 C;  1EER A;  4ZS7 A;  3OG4 A;  4CNI C;  4X51 A;  1Y6M L;  1V7M V;  3SE4 B;  2R92 D;  1BUY A;  1LQS L;  2L3Y A;  4J4L C;  1IRL A;  1JLI A;  2JA6 D;  3PO3 D;  5FHX A;  1EVS A;  4YUE C;  1BP3 A;  5C3E D;  1D9G A;  1LKI A;  3DI3 A;  3DLQ I;  4A3D D;  1EMR A;  4YQX A;  4FA8 E;  1HZI A;  3I4M D;  1EXZ A;  2E9W C;  4MHL A;  5C7X A;  3MZG A;  1LK3 A;  1PGR A;  2B8Z A;  2B8X A;  3UEZ E;  5IYB D;  3HMX B;  5C4X D;  2C35 A;  4DKE A;  2B5I A;  3G6D A;  1B5L A;  1HGU A;  4RS1 A;  3N06 A;  3QWR B;  4DKD A;  2JA5 D;  1Z92 A;  1FYH A;  3D48 P;  4WRL B;  1CSG A;  1IJZ A;  3D87 A;  5FUC A;  5C44 D;  4A3F D;  3I4N D;  1F6F A;  3BPN A;  1BBN A;  4A3E D;  2R93 D;  3HOU D;  1AXI A;  4BY7 D;  2ILK A;  3HHC A;  2ERJ D;  1HIJ A;  3INK C;  3NCB A;  4PS4 A;  1M4C A;  3BES L;  5FLM D;  1EKU A;  1ITM A;  2Z3Q A;  5D28 B;  4NN7 A;  2Q7N B;  5L6Y C;  3HOX D;  3UF2 A;  2HYM B;  3HOY D;  4A3B D;  5D22 A;  5IYC D;  1HWG A;  1ITL A;  1PW6 A;  2Z3R A;  3Q1S I;  4I77 Z;  3DUH C;  4NKQ C;  1RFB A;  2GMF A;  1PVH B;  3HOV D;  1CNT 1;  1ITF A;  3HOZ D;  5KNH I;  4EXP A;  1CYL A;  2OQP A;  1BGE A;  1V7N V;  3FKI D;  1HWH A;  2KZ1 A;  4O9H A;  1M47 A;  2H24 A;  5E4E A;  2PSM A;  4Z5R D;  1M48 A;  3OG6 A;  3PIW A;  1M4R A;  4NEJ A;  3SE3 B;  4BXX D;  4BY1 D;  2O6I A;  1ILK A;  2Q14 A;  3PIV A;  1Y1W D;  1M4B A;  5LQB A;  1IL6 A;  1HIK A;  5D70 A;  3HOW D;  1F45 B;  2LAG A;  1QVN A;  3DGC L;  2D48 A;  1Y1V D;  3H0G D;  4NN6 A;  3TGX B;  4A3C D;  4NI7 A;  3WCY I;  4EXN A;  4DOH A;  2IL6 A;  4YPG C;  2B8Y A;  4A3L D;  2JA7 D;  4YDY I;  3NCE A;  1NBP A;  3QT2 C;  4A3G D;  1IAR A;  1INR A;  1P9M B;  2R7Z D;  4A3I D;  4NEM A;  4DKF A;  3NPZ A;  1J7V L;  2D9Q A;  4BBR D;  2B8U A;  4DKC A;  2Q98 A;  4A3K D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...