1BP3A

The xray structure of a growth hormone-prolactin receptor complex
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
190
structure length
186
Chain Sequence
FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEERIQTLMGRLEDGSPRTGQIFKQTYSKFDTDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The X-ray structure of a growth hormone-prolactin receptor complex.
pubmed doi rcsb
molecule keywords PROTEIN (GROWTH HORMONE)
molecule tags Hormone/growth factor
source organism Homo sapiens
total genus 58
structure length 186
sequence length 190
ec nomenclature
pdb deposition date 1998-08-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1250.10 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; Growth Hormone; Chain: A; 1bp3A00
1ALUA 3DGCL 3BPOA 5L6YC 3BPNA 2IL6A 1LQSL 3QB7A 2O26A 3QWRB 1EXZA 1LK3A 2B8YA 1A22A 1ETEA 1HGUA 1M4CA 3HMXB 2ERJD 3PIWA 4NEMA 1Z92A 1FG9A 1V7NV 5FUCA 1ILKA 1QVNA 1CSGA 5D71A 1CN4C 1HIKA 2Q7NB 3G9VB 4X51A 1EMRA 3S9DA 3SE3B 1BGDA 1N1FA 1JLIA 1AXIA 2HYMB 3QB1A 4NEJA 4NI7A 2H24A 1CYLA 2KZ1A 1V7MV 2B90A 1IRLA 1PVHB 3DUHC 1M4BA 4MHLA 1BBNA 2LAGA 1IJZA 1I1RB 5E4EA 2LMSA 1RHGA 1ITLA 4PS4A 3EW3A 1D9CA 1GNCA 1HZIA 1BCNA 1M47A 1AU1A 1HUWA 3NCEA 2B5IA 5FHXA 1ITFA 1RW5A 3N0PA 5KNHI 1Z7CA 1HIJA 4RS1A 3LB6B 1FYHA 1WU3I 2L3OA 1IARA 3DLQI 1BGCA 1CNT1 4YPGC 3VA2A 4O9HA 5D28B 4Z5RD 3B5KA 1VLKA 2B8UA 3HHRA 4ZS7A 1IK0A 2GMFA 1M49A 2INTA 1ITIA 1M4AA 3INKC 1EERA 1D9GA 1BUYA 1BP3A 3L5XA 3UF2A 1PW6A 3D87A 2B8XA 3NCCA 3LB6A 3SE4B 1HWHA 1KF9A 1P9MB 1CD9A 1PGRA 1YKBA 2B91A 5D22A 4YDYI 2D9QA 3WCYI 1A7MA 3UEZE 3BESL 1HWGA 3D85C 4GRWA 1F6FA 2Q98A 4WRLB 5C7XA 2ILKA 3BPLA 4DOHA 3EJJA 1J7VL 3UF5A 4J4LC 4NI9A 2B8ZA 3D48P 1Y6ML 3N06A 2E9WC 1NBPA 3UX9A 4FA8E 1RFBA 1SCFA 1HULA 1M4RA 2CYKA 2O27A 1F45B 4YQXA 1B5LA 4CNIC 3NPZA 1Y6NL 3Q1SI 4ZF7A 1Y6KL 1EKUA 3L5WI 2D48A 4YUEC 5LQBA 1ITMA 1INRA 1M48A 1RCBA 3G6DA 4O6KA 2L3YA 3QT2C 3MZGA 1BGEA 4I77Z 4NKQC 1EVSA 5D72A 1GA3A 1IL6A 1PY2A 5D70A 3OQ3A 3NCBA 3NCFA 1AX8A 3QAZA 3PIVA 1LKIA
chains in the Genus database with same CATH superfamily
1ALUA 5L6YC 4ZWBA 4OH3A 2IL6A 1A22A 1ETEA 3HMXB 3PIWA 2Y5YA 5D71A 5FLMD 1CN4C 2Q7NB 3G9VB 4X51A 1BGDA 1N1FA 2JA5D 1JLIA 5A2OA 4U4WA 2B63D 1V7MV 3DUHC 1M4BA 5IYCD 1IJZA 1PV7A 4IKWA 2R93D 1M47A 1AU1A 1HUWA 4A3CD 1ITFA 1RW5A 5KNHI 4D2DA 1Z7CA 4A3LD 3HHCA 4YPGC 4TPGA 2VUMD 1VLKA 1IK0A 2INTA 1EERA 2CFQA 4APSA 2XQBA 4NN5A 3SE4B 4LDSA 1HWHA 1KF9A 2XUTA 1P9MB 1CD9A 4YDYI 5D22A 2D9QA 3WCYI 4DKCA 1A7MA 4WRLB 4DOHA 4BY7D 4XNJA 2O6IA 4J4LC 4NI9A 5D6KA 5EQGA 1Y6ML 3IRHA 2E9WC 1NBPA 4A3BD 2CYKA 1B5LA 4D2CA 4IU8A 3Q1SI 1Y6NL 4YUEC 5LQBA 1RCBA 3G6DA 1PY2A 3PIVA 3BPNA 5IYDD 5D58A 3QWRB 1EXZA 1LK3A 4NEMA 5EQIA 1FG9A 1V7NV 1ILKA 1CSGA 4A3ED 1EMRA 4BBRD 3SE3B 4NI7A 1CYLA 2Z3QA 1PVHB 3DI3A 1BBNA 5E4EA 4A3DD 1ITLA 3H3VE 4PS4A 5C65A 4GBZA 4TPHA 1D9CA 3HOWD 1HZIA 3HOVD 1BCNA 1Y1WD 5IYBD 3H0GD 1WCMD 1WU3I 1IARA 3VA2A 1CNT1 4O9HA 4A93D 3FKID 3HHRA 4ZS7A 2GMFA 2JA6D 1BUYA 3D87A 3HOZD 2B8XA 4IKVA 3LB6A 2CFPA 4YBQA 4NN6A 1HWGA 1F6FA 2Q98A 2ILKA 1J7VL 4IU9A 4U4VA 4U4TA 4ZW9A 4FA8E 1M4RA 2O27A 4ZF7A 5A2NA 3PO3D 4GC0A 3L5WI 2D48A 1ITMA 3HOXD 2L3YA 2Q14A 3DI2A 1BGEA 2JA7D 1GA3A 1IL6A 4A3KD 3NCBA 3NCFA 4IKZA 3DGCL 3BPOA 1LQSL 3QB7A 4A3MD 2B8YA 3WDOA 1HGUA 2ERJD 4BBSD 1QVNA 2PSMA 1HIKA 5TS9A 3S9DA 4BY1D 4EXNA 2HYMB 3QB1A 4NEJA 3TGXB 2H24A 3HOYD 2KZ1A 1IRLA 4DKDA 3O7QA 4MHLA 1I1RB 4JA3A 3O7PA 4PYPA 3EW3A 4GBYA 1GNCA 5FHXA 5C3ED 2JA8D 2R7ZD 1HIJA 4RS1A 4YB9D 1Y1VD 2L3OA 3DLQI 1BGCA 4IKYA 4A3JD 3B5KA 1M49A 4LEPA 4GS7A 3INKC 1D9GA 1BP3A 3L5XA 1PW6A 4A3ID 3NCCA 2V8NA 5C44D 4DKFA 2B91A 4BXXD 3BESL 3D85C 5C4XD 3BPLA 3EJJA 4ZYRA 2B8ZA 3I4MD 3N06A 1HULA 4W6VA 4YQXA 4EXPA 4XNIA 1INRA 4Q65A 4QIQA 2R92D 3MZGA 3OG4A 4NKQC 5D72A 5D70A 1AX8A 1LKIA 2C35A 4UVMA 2O26A 4NN7A 5C7XA 1M4CA 5IP7D 1Z92A 5FUCA 1Y14A 4DKEA 3I4ND 1AXIA 5IP9D 1PV6A 2B90A 3AYHA 5GXBA 2LAGA 2LMSA 1RHGA 3NCEA 2B5IA 3N0PA 4A3GD 3LB6B 1FYHA 5D59A 5D28B 4Z5RD 2B8UA 1ITIA 1M4AA 4ZWCA 3UF2A 3PO2D 4IKXA 3OG6A 1YKBA 1PGRA 3UEZE 4GRWA 5EQHA 3UF5A 4TPJA 3D48P 2OQPA 3UX9A 1RFBA 1SCFA 4JR9A 1F45B 4JREA 4CNIC 3HOUD 3NPZA 4D2BA 1Y6KL 1EKUA 4J05A 1M48A 4O6KA 4OAAA 3QT2C 4I77Z 1PW4A 1EVSA 4LRLA 2Z3RA 3OQ3A 4A3FD 3QAZA
chains in the Genus database with same CATH topology
1ALUA 3DGCL 3BPOA 5L6YC 2C35A 3BPNA 5IYDD 2IL6A 1LQSL 3QB7A 4A3MD 2O26A 3QWRB 1EXZA 1LK3A 2B8YA 1A22A 1ETEA 1HGUA 1M4CA 3HMXB 2ERJD 3PIWA 4NEMA 5IP7D 1Z92A 4BBSD 1FG9A 1V7NV 5FUCA 1ILKA 1QVNA 1CSGA 2PSMA 5D71A 5FLMD 1CN4C 1HIKA 2Q7NB 5TS9A 1Y14A 3G9VB 4X51A 1EMRA 4BBRD 3SE3B 4DKEA 3S9DA 4A3ED 4BY1D 1BGDA 1N1FA 4EXNA 2JA5D 3I4ND 1JLIA 1AXIA 2HYMB 3QB1A 4NEJA 3TGXB 4NI7A 2H24A 5IP9D 2B63D 1CYLA 3HOYD 2KZ1A 1V7MV 2Z3QA 2B90A 3AYHA 1IRLA 1PVHB 4DKDA 3DUHC 1M4BA 3DI3A 4MHLA 5IYCD 1BBNA 2LAGA 1IJZA 1I1RB 5E4EA 2LMSA 1RHGA 4A3DD 1ITLA 3H3VE 4PS4A 3EW3A 1D9CA 3HOWD 1HZIA 2R93D 1GNCA 3HOVD 1BCNA 1M47A 1AU1A 1HUWA 3NCEA 2B5IA 5FHXA 4A3CD 5C3ED 2JA8D 1ITFA 2R7ZD 1RW5A 3N0PA 1Y1WD 5IYBD 3H0GD 5KNHI 4A3GD 1WCMD 1Z7CA 4A3LD 1HIJA 4NN7A 4RS1A 3HHCA 3LB6B 1Y1VD 1FYHA 1WU3I 2L3OA 1IARA 3DLQI 1BGCA 1CNT1 4YPGC 3VA2A 4O9HA 5D28B 4A3JD 4A93D 3FKID 3B5KA 1VLKA 2B8UA 3HHRA 4Z5RD 4ZS7A 2VUMD 2GMFA 1IK0A 1M49A 2INTA 1ITIA 1M4AA 2JA6D 4GS7A 3INKC 1EERA 1D9GA 1BUYA 1BP3A 3L5XA 3UF2A 3PO2D 1PW6A 3D87A 3HOZD 2B8XA 2XQBA 4NN5A 4A3ID 3NCCA 3LB6A 3SE4B 5C44D 3OG6A 1HWHA 1KF9A 1P9MB 1CD9A 1PGRA 1YKBA 2B91A 5D22A 4DKFA 2D9QA 4NN6A 3WCYI 4DKCA 4YDYI 3UEZE 4BXXD 1A7MA 3BESL 1HWGA 3D85C 4GRWA 1F6FA 5C4XD 2Q98A 4WRLB 5C7XA 2ILKA 3BPLA 4DOHA 3EJJA 1J7VL 4BY7D 3UF5A 2O6IA 4J4LC 4NI9A 2B8ZA 3D48P 3I4MD 1Y6ML 3N06A 2R92D 3IRHA 2E9WC 1NBPA 2OQPA 3UX9A 4FA8E 4A3BD 1RFBA 1SCFA 1HULA 1M4RA 2CYKA 2O27A 1F45B 4YQXA 1B5LA 4CNIC 4EXPA 3HOUD 3NPZA 1Y6NL 3Q1SI 4ZF7A 1Y6KL 1EKUA 3PO3D 3L5WI 2D48A 4YUEC 5LQBA 1ITMA 1INRA 3HOXD 1M48A 1RCBA 3G6DA 4O6KA 2L3YA 3QT2C 3MZGA 2Q14A 3DI2A 1BGEA 4I77Z 2JA7D 3OG4A 1EVSA 4NKQC 4LRLA 5D72A 1IL6A 1PY2A 5D70A 2Z3RA 4A3KD 1GA3A 3OQ3A 3NCBA 3NCFA 4A3FD 1AX8A 3QAZA 3PIVA 1LKIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ALU A;  3DGC L;  3BPO A;  5L6Y C;  3BPN A;  2IL6 A;  1LQS L;  3QB7 A;  2O26 A;  3QWR B;  1EXZ A;  1LK3 A;  2B8Y A;  1A22 A;  1ETE A;  1HGU A;  1M4C A;  3HMX B;  2ERJ D;  3PIW A;  4NEM A;  1Z92 A;  1FG9 A;  1V7N V;  5FUC A;  1ILK A;  1QVN A;  1CSG A;  5D71 A;  1CN4 C;  1HIK A;  2Q7N B;  3G9V B;  4X51 A;  1EMR A;  3S9D A;  3SE3 B;  1BGD A;  1N1F A;  1JLI A;  1AXI A;  2HYM B;  3QB1 A;  4NEJ A;  4NI7 A;  2H24 A;  1CYL A;  2KZ1 A;  1V7M V;  2B90 A;  1IRL A;  1PVH B;  3DUH C;  1M4B A;  4MHL A;  1BBN A;  2LAG A;  1IJZ A;  1I1R B;  5E4E A;  2LMS A;  1RHG A;  1ITL A;  4PS4 A;  3EW3 A;  1D9C A;  1GNC A;  1HZI A;  1BCN A;  1M47 A;  1AU1 A;  1HUW A;  3NCE A;  2B5I A;  5FHX A;  1ITF A;  1RW5 A;  3N0P A;  5KNH I;  1Z7C A;  1HIJ A;  4RS1 A;  3LB6 B;  1FYH A;  1WU3 I;  2L3O A;  1IAR A;  3DLQ I;  1BGC A;  1CNT 1;  4YPG C;  3VA2 A;  4O9H A;  5D28 B;  4Z5R D;  3B5K A;  1VLK A;  2B8U A;  3HHR A;  4ZS7 A;  1IK0 A;  2GMF A;  1M49 A;  2INT A;  1ITI A;  1M4A A;  3INK C;  1EER A;  1D9G A;  1BUY A;  1BP3 A;  3L5X A;  3UF2 A;  1PW6 A;  3D87 A;  2B8X A;  3NCC A;  3LB6 A;  3SE4 B;  1HWH A;  1KF9 A;  1P9M B;  1CD9 A;  1PGR A;  1YKB A;  2B91 A;  5D22 A;  4YDY I;  2D9Q A;  3WCY I;  1A7M A;  3UEZ E;  3BES L;  1HWG A;  3D85 C;  4GRW A;  1F6F A;  2Q98 A;  4WRL B;  5C7X A;  2ILK A;  3BPL A;  4DOH A;  3EJJ A;  1J7V L;  3UF5 A;  4J4L C;  4NI9 A;  2B8Z A;  3D48 P;  1Y6M L;  3N06 A;  2E9W C;  1NBP A;  3UX9 A;  4FA8 E;  1RFB A;  1SCF A;  1HUL A;  1M4R A;  2CYK A;  2O27 A;  1F45 B;  4YQX A;  1B5L A;  4CNI C;  3NPZ A;  1Y6N L;  3Q1S I;  4ZF7 A;  1Y6K L;  1EKU A;  3L5W I;  2D48 A;  4YUE C;  5LQB A;  1ITM A;  1INR A;  1M48 A;  1RCB A;  3G6D A;  4O6K A;  2L3Y A;  3QT2 C;  3MZG A;  1BGE A;  4I77 Z;  4NKQ C;  1EVS A;  5D72 A;  1GA3 A;  1IL6 A;  1PY2 A;  5D70 A;  3OQ3 A;  3NCB A;  3NCF A;  1AX8 A;  3QAZ A;  3PIV A;  1LKI A; 
#chains in the Genus database with same CATH topology
 1ALU A;  5L6Y C;  4ZWB A;  4OH3 A;  2IL6 A;  1A22 A;  1ETE A;  3HMX B;  3PIW A;  2Y5Y A;  5D71 A;  5FLM D;  1CN4 C;  2Q7N B;  3G9V B;  4X51 A;  1BGD A;  1N1F A;  2JA5 D;  1JLI A;  5A2O A;  4U4W A;  2B63 D;  1V7M V;  3DUH C;  1M4B A;  5IYC D;  1IJZ A;  1PV7 A;  4IKW A;  2R93 D;  1M47 A;  1AU1 A;  1HUW A;  4A3C D;  1ITF A;  1RW5 A;  5KNH I;  4D2D A;  1Z7C A;  4A3L D;  3HHC A;  4YPG C;  4TPG A;  2VUM D;  1VLK A;  1IK0 A;  2INT A;  1EER A;  2CFQ A;  4APS A;  2XQB A;  4NN5 A;  3SE4 B;  4LDS A;  1HWH A;  1KF9 A;  2XUT A;  1P9M B;  1CD9 A;  4YDY I;  5D22 A;  2D9Q A;  3WCY I;  4DKC A;  1A7M A;  4WRL B;  4DOH A;  4BY7 D;  4XNJ A;  2O6I A;  4J4L C;  4NI9 A;  5D6K A;  5EQG A;  1Y6M L;  3IRH A;  2E9W C;  1NBP A;  4A3B D;  2CYK A;  1B5L A;  4D2C A;  4IU8 A;  3Q1S I;  1Y6N L;  4YUE C;  5LQB A;  1RCB A;  3G6D A;  1PY2 A;  3PIV A;  3BPN A;  5IYD D;  5D58 A;  3QWR B;  1EXZ A;  1LK3 A;  4NEM A;  5EQI A;  1FG9 A;  1V7N V;  1ILK A;  1CSG A;  4A3E D;  1EMR A;  4BBR D;  3SE3 B;  4NI7 A;  1CYL A;  2Z3Q A;  1PVH B;  3DI3 A;  1BBN A;  5E4E A;  4A3D D;  1ITL A;  3H3V E;  4PS4 A;  5C65 A;  4GBZ A;  4TPH A;  1D9C A;  3HOW D;  1HZI A;  3HOV D;  1BCN A;  1Y1W D;  5IYB D;  3H0G D;  1WCM D;  1WU3 I;  1IAR A;  3VA2 A;  1CNT 1;  4O9H A;  4A93 D;  3FKI D;  3HHR A;  4ZS7 A;  2GMF A;  2JA6 D;  1BUY A;  3D87 A;  3HOZ D;  2B8X A;  4IKV A;  3LB6 A;  2CFP A;  4YBQ A;  4NN6 A;  1HWG A;  1F6F A;  2Q98 A;  2ILK A;  1J7V L;  4IU9 A;  4U4V A;  4U4T A;  4ZW9 A;  4FA8 E;  1M4R A;  2O27 A;  4ZF7 A;  5A2N A;  3PO3 D;  4GC0 A;  3L5W I;  2D48 A;  1ITM A;  3HOX D;  2L3Y A;  2Q14 A;  3DI2 A;  1BGE A;  2JA7 D;  1GA3 A;  1IL6 A;  4A3K D;  3NCB A;  3NCF A;  4IKZ A;  3DGC L;  3BPO A;  1LQS L;  3QB7 A;  4A3M D;  2B8Y A;  3WDO A;  1HGU A;  2ERJ D;  4BBS D;  1QVN A;  2PSM A;  1HIK A;  5TS9 A;  3S9D A;  4BY1 D;  4EXN A;  2HYM B;  3QB1 A;  4NEJ A;  3TGX B;  2H24 A;  3HOY D;  2KZ1 A;  1IRL A;  4DKD A;  3O7Q A;  4MHL A;  1I1R B;  4JA3 A;  3O7P A;  4PYP A;  3EW3 A;  4GBY A;  1GNC A;  5FHX A;  5C3E D;  2JA8 D;  2R7Z D;  1HIJ A;  4RS1 A;  4YB9 D;  1Y1V D;  2L3O A;  3DLQ I;  1BGC A;  4IKY A;  4A3J D;  3B5K A;  1M49 A;  4LEP A;  4GS7 A;  3INK C;  1D9G A;  1BP3 A;  3L5X A;  1PW6 A;  4A3I D;  3NCC A;  2V8N A;  5C44 D;  4DKF A;  2B91 A;  4BXX D;  3BES L;  3D85 C;  5C4X D;  3BPL A;  3EJJ A;  4ZYR A;  2B8Z A;  3I4M D;  3N06 A;  1HUL A;  4W6V A;  4YQX A;  4EXP A;  4XNI A;  1INR A;  4Q65 A;  4QIQ A;  2R92 D;  3MZG A;  3OG4 A;  4NKQ C;  5D72 A;  5D70 A;  1AX8 A;  1LKI A;  2C35 A;  4UVM A;  2O26 A;  4NN7 A;  5C7X A;  1M4C A;  5IP7 D;  1Z92 A;  5FUC A;  1Y14 A;  4DKE A;  3I4N D;  1AXI A;  5IP9 D;  1PV6 A;  2B90 A;  3AYH A;  5GXB A;  2LAG A;  2LMS A;  1RHG A;  3NCE A;  2B5I A;  3N0P A;  4A3G D;  3LB6 B;  1FYH A;  5D59 A;  5D28 B;  4Z5R D;  2B8U A;  1ITI A;  1M4A A;  4ZWC A;  3UF2 A;  3PO2 D;  4IKX A;  3OG6 A;  1YKB A;  1PGR A;  3UEZ E;  4GRW A;  5EQH A;  3UF5 A;  4TPJ A;  3D48 P;  2OQP A;  3UX9 A;  1RFB A;  1SCF A;  4JR9 A;  1F45 B;  4JRE A;  4CNI C;  3HOU D;  3NPZ A;  4D2B A;  1Y6K L;  1EKU A;  4J05 A;  1M48 A;  4O6K A;  4OAA A;  3QT2 C;  4I77 Z;  1PW4 A;  1EVS A;  4LRL A;  2Z3R A;  3OQ3 A;  4A3F D;  3QAZ A; 
#chains in the Genus database with same CATH homology
 1ALU A;  3DGC L;  3BPO A;  5L6Y C;  2C35 A;  3BPN A;  5IYD D;  2IL6 A;  1LQS L;  3QB7 A;  4A3M D;  2O26 A;  3QWR B;  1EXZ A;  1LK3 A;  2B8Y A;  1A22 A;  1ETE A;  1HGU A;  1M4C A;  3HMX B;  2ERJ D;  3PIW A;  4NEM A;  5IP7 D;  1Z92 A;  4BBS D;  1FG9 A;  1V7N V;  5FUC A;  1ILK A;  1QVN A;  1CSG A;  2PSM A;  5D71 A;  5FLM D;  1CN4 C;  1HIK A;  2Q7N B;  5TS9 A;  1Y14 A;  3G9V B;  4X51 A;  1EMR A;  4BBR D;  3SE3 B;  4DKE A;  3S9D A;  4A3E D;  4BY1 D;  1BGD A;  1N1F A;  4EXN A;  2JA5 D;  3I4N D;  1JLI A;  1AXI A;  2HYM B;  3QB1 A;  4NEJ A;  3TGX B;  4NI7 A;  2H24 A;  5IP9 D;  2B63 D;  1CYL A;  3HOY D;  2KZ1 A;  1V7M V;  2Z3Q A;  2B90 A;  3AYH A;  1IRL A;  1PVH B;  4DKD A;  3DUH C;  1M4B A;  3DI3 A;  4MHL A;  5IYC D;  1BBN A;  2LAG A;  1IJZ A;  1I1R B;  5E4E A;  2LMS A;  1RHG A;  4A3D D;  1ITL A;  3H3V E;  4PS4 A;  3EW3 A;  1D9C A;  3HOW D;  1HZI A;  2R93 D;  1GNC A;  3HOV D;  1BCN A;  1M47 A;  1AU1 A;  1HUW A;  3NCE A;  2B5I A;  5FHX A;  4A3C D;  5C3E D;  2JA8 D;  1ITF A;  2R7Z D;  1RW5 A;  3N0P A;  1Y1W D;  5IYB D;  3H0G D;  5KNH I;  4A3G D;  1WCM D;  1Z7C A;  4A3L D;  1HIJ A;  4NN7 A;  4RS1 A;  3HHC A;  3LB6 B;  1Y1V D;  1FYH A;  1WU3 I;  2L3O A;  1IAR A;  3DLQ I;  1BGC A;  1CNT 1;  4YPG C;  3VA2 A;  4O9H A;  5D28 B;  4A3J D;  4A93 D;  3FKI D;  3B5K A;  1VLK A;  2B8U A;  3HHR A;  4Z5R D;  4ZS7 A;  2VUM D;  2GMF A;  1IK0 A;  1M49 A;  2INT A;  1ITI A;  1M4A A;  2JA6 D;  4GS7 A;  3INK C;  1EER A;  1D9G A;  1BUY A;  1BP3 A;  3L5X A;  3UF2 A;  3PO2 D;  1PW6 A;  3D87 A;  3HOZ D;  2B8X A;  2XQB A;  4NN5 A;  4A3I D;  3NCC A;  3LB6 A;  3SE4 B;  5C44 D;  3OG6 A;  1HWH A;  1KF9 A;  1P9M B;  1CD9 A;  1PGR A;  1YKB A;  2B91 A;  5D22 A;  4DKF A;  2D9Q A;  4NN6 A;  3WCY I;  4DKC A;  4YDY I;  3UEZ E;  4BXX D;  1A7M A;  3BES L;  1HWG A;  3D85 C;  4GRW A;  1F6F A;  5C4X D;  2Q98 A;  4WRL B;  5C7X A;  2ILK A;  3BPL A;  4DOH A;  3EJJ A;  1J7V L;  4BY7 D;  3UF5 A;  2O6I A;  4J4L C;  4NI9 A;  2B8Z A;  3D48 P;  3I4M D;  1Y6M L;  3N06 A;  2R92 D;  3IRH A;  2E9W C;  1NBP A;  2OQP A;  3UX9 A;  4FA8 E;  4A3B D;  1RFB A;  1SCF A;  1HUL A;  1M4R A;  2CYK A;  2O27 A;  1F45 B;  4YQX A;  1B5L A;  4CNI C;  4EXP A;  3HOU D;  3NPZ A;  1Y6N L;  3Q1S I;  4ZF7 A;  1Y6K L;  1EKU A;  3PO3 D;  3L5W I;  2D48 A;  4YUE C;  5LQB A;  1ITM A;  1INR A;  3HOX D;  1M48 A;  1RCB A;  3G6D A;  4O6K A;  2L3Y A;  3QT2 C;  3MZG A;  2Q14 A;  3DI2 A;  1BGE A;  4I77 Z;  2JA7 D;  3OG4 A;  1EVS A;  4NKQ C;  4LRL A;  5D72 A;  1IL6 A;  1PY2 A;  5D70 A;  2Z3R A;  4A3K D;  1GA3 A;  3OQ3 A;  3NCB A;  3NCF A;  4A3F D;  1AX8 A;  3QAZ A;  3PIV A;  1LKI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...