5E4EA

Engineered interleukin-13 bound to receptor
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
113
structure length
111
Chain Sequence
b'PGPVPPSTAVRELIEELINITQNAPLCNGSMVWSINRTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRSSKIEVAQFVKDLLFHLRTLFREGQFN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-13
publication title Instructive roles for cytokine-receptor binding parameters in determining signaling and functional potency.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 30
structure length 111
sequence length 113
ec nomenclature
pdb deposition date 2015-10-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1250.10 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; Growth Hormone; Chain: A; 5e4eA00
1ALUA 4YQXA 5D28B 1HWHA 1LKIA 3QWRB 1IJZA 1BBNA 1ITLA 3EJJA 2B8YA 1GA3A 3BESL 1M4CA 1SCFA 3L5XA 3PIWA 3MZGA 1M48A 1LQSL 1VLKA 3D85C 1YKBA 1BGCA 2B8UA 4O6KA 1HWGA 1RCBA 1BCNA 1Y6KL 5C7XA 1FYHA 4NEJA 1ITMA 1PVHB 3N0PA 1CN4C 3UX9A 2ILKA 2KZ1A 1V7NV 5E4EA 3UEZE 2L3OA 4MHLA 1V7MV 3EW3A 4CNIC 1HULA 1I1RB 1P9MB 1AXIA 4ZF7A 5LQBA 3LB6A 1HUWA 3BPNA 1B5LA 1AX8A 1BGDA 3QT2C 3QAZA 1PW6A 1CNT1 3HHRA 5D22A 2LAGA 1Z7CA 3BPLA 3DGCL 1ILKA 1BP3A 3SE3B 1IARA 1RFBA 2ERJD 3DLQI 1CSGA 4DOHA 1A7MA 1F45B 4WRLB 2LMSA 3L5WI 1INRA 4NKQC 2L3YA 5KNHI 1WU3I 3D87A 3NPZA 3QB1A 1JLIA 4YUEC 1D9GA 3UF5A 2IL6A 4X51A 1Y6NL 1A22A 1FG9A 1NBPA 1PGRA 4Z5RD 1M47A 3INKC 5D72A 3NCBA 1LK3A 1AU1A 1M4AA 2D9QA 4O9HA 1IL6A 3G6DA 1RW5A 5FUCA 2D48A 1M4RA 2CYKA 2Q98A 1EVSA 1KF9A 4GRWA 4YPGC 5L6YC 1IRLA 1CD9A 4NEMA 1M49A 3UF2A 2B8ZA 4ZS7A 1D9CA 5D70A 5D71A 1ITFA 3LB6B 2B91A 2HYMB 1Z92A 1EKUA 2B90A 3BPOA 3N06A 4J4LC 1N1FA 3DUHC 2GMFA 1CYLA 3VA2A 3G9VB 3NCCA 1RHGA 1EMRA 1F6FA 1M4BA 1IK0A 3NCEA 1BGEA 1Y6ML 3WCYI 3NCFA 1BUYA 1ITIA 1ETEA 1HIKA 1HZIA 1EXZA 2B5IA 2O27A 4I77Z 1PY2A 2INTA 3PIVA 3B5KA 4RS1A 2O26A 3QB7A 3SE4B 3OQ3A 3Q1SI 1J7VL 2Q7NB 3HMXB 1HIJA 4NI9A 4FA8E 1EERA 4PS4A 5FHXA 4YDYI 2H24A 2B8XA 4NI7A 1HGUA 3S9DA 1GNCA 3D48P 2E9WC 1QVNA
chains in the Genus database with same CATH superfamily
5D28B 1HWHA 4OAAA 4UVMA 4TPGA 3HHCA 4A3FD 1SCFA 4DKDA 4JREA 4A3ED 4O6KA 3HOZD 1BCNA 1Y6KL 2JA7D 4NEJA 1ITMA 4DKFA 3N0PA 4DKEA 3EW3A 2Y5YA 4NN5A 1HUWA 4D2BA 3BPNA 1B5LA 1AX8A 1BGDA 1PW6A 5D22A 2Z3QA 3BPLA 2R7ZD 2ERJD 3DLQI 1WU3I 4IKXA 4YUEC 1D9GA 2XQBA 4X51A 4J05A 1PGRA 3INKC 1LK3A 4O9HA 1IL6A 1WCMD 4A3ID 1M4RA 2CYKA 4GRWA 1IRLA 1M49A 2Q14A 4ZW9A 4ZS7A 5IP7D 1ITFA 2B91A 1Z92A 2B90A 2XUTA 1CYLA 5IP9D 1EMRA 1F6FA 4LDSA 2PSMA 4GBZA 1M4BA 5C44D 3NCFA 5D59A 1ITIA 1HZIA 2CFPA 3I4MD 2INTA 3PIVA 3SE4B 3OQ3A 4A3GD 4NN6A 3HMXB 5FHXA 5TS9A 2R92D 1HGUA 3D48P 1Y14A 3OG6A 1Y1WD 5C65A 3HOYD 5A2OA 4EXNA 1LKIA 3QWRB 1IJZA 3HOXD 2V8NA 4JA3A 1ITLA 4U4TA 2B8YA 3HOWD 3MZGA 2CFQA 1VLKA 1LQSL 1BGCA 1HWGA 5C7XA 1FYHA 4A3KD 5IYDD 5E4EA 4A3BD 4MHLA 1HULA 1I1RB 5LQBA 4ZF7A 3FKID 3QAZA 1CNT1 4IKWA 1Z7CA 1BP3A 4QIQA 4U4VA 4EXPA 2JA6D 1F45B 2LMSA 5KNHI 3D87A 3NPZA 4A3JD 3QB1A 4IU8A 4ZYRA 1FG9A 2B63D 4GS7A 1PW4A 1M4AA 2D9QA 4Q65A 5FUCA 4LRLA 4YBQA 1EVSA 2O6IA 4ZWBA 4YB9D 2B8ZA 5GXBA 2Z3RA 5D70A 5EQGA 3LB6B 1EKUA 3BPOA 1N1FA 3G9VB 3WCYI 1ETEA 4I77Z 3DI3A 4IKZA 1PY2A 3I4ND 3B5KA 4RS1A 3QB7A 3HOVD 1HIJA 4NI9A 4YDYI 4PS4A 4NI7A 1GNCA 1QVNA 1ALUA 4YQXA 1BBNA 3TGXB 3BESL 3L5XA 1M48A 3D85C 5D6KA 3AYHA 1RCBA 2JA8D 3UX9A 2ILKA 4DKCA 1V7NV 4CNIC 2L3OA 1AXIA 4IKVA 3QT2C 3HHRA 2LAGA 3DGCL 4GC0A 4DOHA 1ILKA 1CSGA 4WRLB 3L5WI 1PV7A 4NKQC 4BBSD 4NN7A 1JLIA 4ZWCA 3UF5A 4LEPA 4APSA 5IYCD 1M47A 5IYBD 3WDOA 1AU1A 4BXXD 4PYPA 2C35A 1KF9A 4D2DA 4YPGC 5L6YC 5C3ED 4NEMA 3UF2A 3PO2D 3N06A 4J4LC 5EQIA 3DUHC 2GMFA 2JA5D 3NCCA 1RHGA 5FLMD 1BGEA 3OG4A 1BUYA 1HIKA 4U4WA 2O26A 4BBRD 4FA8E 1EERA 3O7QA 2H24A 2B8XA 4D2CA 3DI2A 2R93D 3HOUD 3EJJA 1GA3A 3PIWA 1M4CA 4BY1D 4GBYA 1YKBA 5EQHA 2B8UA 4JR9A 1PVHB 1CN4C 2OQPA 2KZ1A 3H3VE 5A2NA 3UEZE 1V7MV 1P9MB 4TPHA 3LB6A 4A3DD 4A3LD 3SE3B 1IARA 1RFBA 1A7MA 1INRA 4XNJA 2L3YA 2IL6A 1Y6NL 1A22A 4TPJA 1NBPA 4Z5RD 5D72A 3NCBA 3G6DA 1RW5A 5C4XD 2D48A 2Q98A 1Y1VD 4W6VA 4BY7D 3H0GD 4A3MD 1CD9A 3O7PA 1D9CA 5D71A 2HYMB 2VUMD 3VA2A 4A93D 4OH3A 4XNIA 1IK0A 3NCEA 1Y6ML 4A3CD 2B5IA 2O27A 1EXZA 3Q1SI 1J7VL 2Q7NB 4IKYA 3S9DA 3PO3D 4IU9A 2E9WC 1PV6A 3IRHA 5D58A
chains in the Genus database with same CATH topology
3OG6A 2R93D 1Y1WD 1ALUA 3HOYD 4YQXA 5D28B 1HWHA 1LKIA 3QWRB 1IJZA 1BBNA 4EXNA 3HOXD 3HOUD 3HHCA 4A3FD 1ITLA 3EJJA 2B8YA 3TGXB 3BESL 1M4CA 1SCFA 3L5XA 3PIWA 3MZGA 4BY1D 1GA3A 4DKDA 1M48A 1LQSL 1VLKA 3D85C 4A3ED 1YKBA 1BGCA 2B8UA 3AYHA 1HWGA 1RCBA 4O6KA 2JA8D 3HOZD 1BCNA 1Y6KL 5C7XA 1FYHA 2JA7D 4NEJA 1ITMA 1PVHB 4DKFA 3N0PA 1CN4C 4DKEA 5IYDD 4A3KD 3UX9A 2ILKA 2OQPA 4DKCA 2KZ1A 3H3VE 1V7NV 5E4EA 3UEZE 2L3OA 4MHLA 1V7MV 3EW3A 4CNIC 4A3BD 4NN5A 1HULA 1I1RB 1P9MB 1AXIA 4ZF7A 5LQBA 3LB6A 1HUWA 3BPNA 1B5LA 4A3DD 1AX8A 1BGDA 3QT2C 3FKID 3QAZA 1PW6A 1CNT1 3HHRA 5D22A 2Z3QA 2LAGA 1Z7CA 3BPLA 2R7ZD 3DGCL 4A3LD 1ILKA 1BP3A 3SE3B 1IARA 1RFBA 2ERJD 3DLQI 1CSGA 4DOHA 1A7MA 4EXPA 2JA6D 1F45B 4WRLB 2LMSA 3L5WI 1INRA 4NKQC 2L3YA 5KNHI 1WU3I 3D87A 4BBSD 3NPZA 4A3JD 4NN7A 3QB1A 1JLIA 4YUEC 1D9GA 3UF5A 2XQBA 2IL6A 4X51A 1Y6NL 1A22A 1FG9A 1NBPA 2B63D 1PGRA 4Z5RD 1M47A 3INKC 5D72A 3NCBA 1LK3A 1AU1A 4GS7A 5IYBD 5IYCD 1M4AA 2D9QA 4O9HA 4BXXD 1IL6A 3G6DA 1WCMD 1RW5A 5C4XD 2C35A 2D48A 5FUCA 4A3ID 1M4RA 2CYKA 2Q98A 4LRLA 1Y1VD 3HOWD 1EVSA 2O6IA 1KF9A 4GRWA 4BY7D 4YPGC 5L6YC 3H0GD 5C3ED 4A3MD 1IRLA 1CD9A 4NEMA 1M49A 2Q14A 3UF2A 2B8ZA 2Z3RA 4ZS7A 1D9CA 5IP7D 5D70A 5D71A 1ITFA 3LB6B 3PO2D 2B91A 2HYMB 1Z92A 1EKUA 2B90A 3BPOA 3N06A 4J4LC 1N1FA 3DUHC 2GMFA 2VUMD 1CYLA 3VA2A 4A93D 5IP9D 3G9VB 2JA5D 3NCCA 1RHGA 1EMRA 5FLMD 1F6FA 2PSMA 1M4BA 1IK0A 3NCEA 1BGEA 1Y6ML 3WCYI 5C44D 4A3CD 3OG4A 3NCFA 1BUYA 1ITIA 1ETEA 1HIKA 1HZIA 1EXZA 2B5IA 2O27A 4I77Z 3DI3A 1PY2A 3I4MD 2INTA 3I4ND 3PIVA 3B5KA 4RS1A 2O26A 3QB7A 3SE4B 3OQ3A 3Q1SI 3HOVD 4A3GD 1J7VL 4NN6A 2Q7NB 3HMXB 1HIJA 4NI9A 4BBRD 4FA8E 1EERA 4PS4A 5FHXA 4YDYI 5TS9A 2H24A 2B8XA 4NI7A 1HGUA 3S9DA 2R92D 3PO3D 1GNCA 3D48P 2E9WC 3DI2A 3IRHA 1QVNA 1Y14A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ALU A;  4YQX A;  5D28 B;  1HWH A;  1LKI A;  3QWR B;  1IJZ A;  1BBN A;  1ITL A;  3EJJ A;  2B8Y A;  1GA3 A;  3BES L;  1M4C A;  1SCF A;  3L5X A;  3PIW A;  3MZG A;  1M48 A;  1LQS L;  1VLK A;  3D85 C;  1YKB A;  1BGC A;  2B8U A;  4O6K A;  1HWG A;  1RCB A;  1BCN A;  1Y6K L;  5C7X A;  1FYH A;  4NEJ A;  1ITM A;  1PVH B;  3N0P A;  1CN4 C;  3UX9 A;  2ILK A;  2KZ1 A;  1V7N V;  5E4E A;  3UEZ E;  2L3O A;  4MHL A;  1V7M V;  3EW3 A;  4CNI C;  1HUL A;  1I1R B;  1P9M B;  1AXI A;  4ZF7 A;  5LQB A;  3LB6 A;  1HUW A;  3BPN A;  1B5L A;  1AX8 A;  1BGD A;  3QT2 C;  3QAZ A;  1PW6 A;  1CNT 1;  3HHR A;  5D22 A;  2LAG A;  1Z7C A;  3BPL A;  3DGC L;  1ILK A;  1BP3 A;  3SE3 B;  1IAR A;  1RFB A;  2ERJ D;  3DLQ I;  1CSG A;  4DOH A;  1A7M A;  1F45 B;  4WRL B;  2LMS A;  3L5W I;  1INR A;  4NKQ C;  2L3Y A;  5KNH I;  1WU3 I;  3D87 A;  3NPZ A;  3QB1 A;  1JLI A;  4YUE C;  1D9G A;  3UF5 A;  2IL6 A;  4X51 A;  1Y6N L;  1A22 A;  1FG9 A;  1NBP A;  1PGR A;  4Z5R D;  1M47 A;  3INK C;  5D72 A;  3NCB A;  1LK3 A;  1AU1 A;  1M4A A;  2D9Q A;  4O9H A;  1IL6 A;  3G6D A;  1RW5 A;  5FUC A;  2D48 A;  1M4R A;  2CYK A;  2Q98 A;  1EVS A;  1KF9 A;  4GRW A;  4YPG C;  5L6Y C;  1IRL A;  1CD9 A;  4NEM A;  1M49 A;  3UF2 A;  2B8Z A;  4ZS7 A;  1D9C A;  5D70 A;  5D71 A;  1ITF A;  3LB6 B;  2B91 A;  2HYM B;  1Z92 A;  1EKU A;  2B90 A;  3BPO A;  3N06 A;  4J4L C;  1N1F A;  3DUH C;  2GMF A;  1CYL A;  3VA2 A;  3G9V B;  3NCC A;  1RHG A;  1EMR A;  1F6F A;  1M4B A;  1IK0 A;  3NCE A;  1BGE A;  1Y6M L;  3WCY I;  3NCF A;  1BUY A;  1ITI A;  1ETE A;  1HIK A;  1HZI A;  1EXZ A;  2B5I A;  2O27 A;  4I77 Z;  1PY2 A;  2INT A;  3PIV A;  3B5K A;  4RS1 A;  2O26 A;  3QB7 A;  3SE4 B;  3OQ3 A;  3Q1S I;  1J7V L;  2Q7N B;  3HMX B;  1HIJ A;  4NI9 A;  4FA8 E;  1EER A;  4PS4 A;  5FHX A;  4YDY I;  2H24 A;  2B8X A;  4NI7 A;  1HGU A;  3S9D A;  1GNC A;  3D48 P;  2E9W C;  1QVN A; 
#chains in the Genus database with same CATH topology
 5D28 B;  1HWH A;  4OAA A;  4UVM A;  4TPG A;  3HHC A;  4A3F D;  1SCF A;  4DKD A;  4JRE A;  4A3E D;  4O6K A;  3HOZ D;  1BCN A;  1Y6K L;  2JA7 D;  4NEJ A;  1ITM A;  4DKF A;  3N0P A;  4DKE A;  3EW3 A;  2Y5Y A;  4NN5 A;  1HUW A;  4D2B A;  3BPN A;  1B5L A;  1AX8 A;  1BGD A;  1PW6 A;  5D22 A;  2Z3Q A;  3BPL A;  2R7Z D;  2ERJ D;  3DLQ I;  1WU3 I;  4IKX A;  4YUE C;  1D9G A;  2XQB A;  4X51 A;  4J05 A;  1PGR A;  3INK C;  1LK3 A;  4O9H A;  1IL6 A;  1WCM D;  4A3I D;  1M4R A;  2CYK A;  4GRW A;  1IRL A;  1M49 A;  2Q14 A;  4ZW9 A;  4ZS7 A;  5IP7 D;  1ITF A;  2B91 A;  1Z92 A;  2B90 A;  2XUT A;  1CYL A;  5IP9 D;  1EMR A;  1F6F A;  4LDS A;  2PSM A;  4GBZ A;  1M4B A;  5C44 D;  3NCF A;  5D59 A;  1ITI A;  1HZI A;  2CFP A;  3I4M D;  2INT A;  3PIV A;  3SE4 B;  3OQ3 A;  4A3G D;  4NN6 A;  3HMX B;  5FHX A;  5TS9 A;  2R92 D;  1HGU A;  3D48 P;  1Y14 A;  3OG6 A;  1Y1W D;  5C65 A;  3HOY D;  5A2O A;  4EXN A;  1LKI A;  3QWR B;  1IJZ A;  3HOX D;  2V8N A;  4JA3 A;  1ITL A;  4U4T A;  2B8Y A;  3HOW D;  3MZG A;  2CFQ A;  1VLK A;  1LQS L;  1BGC A;  1HWG A;  5C7X A;  1FYH A;  4A3K D;  5IYD D;  5E4E A;  4A3B D;  4MHL A;  1HUL A;  1I1R B;  5LQB A;  4ZF7 A;  3FKI D;  3QAZ A;  1CNT 1;  4IKW A;  1Z7C A;  1BP3 A;  4QIQ A;  4U4V A;  4EXP A;  2JA6 D;  1F45 B;  2LMS A;  5KNH I;  3D87 A;  3NPZ A;  4A3J D;  3QB1 A;  4IU8 A;  4ZYR A;  1FG9 A;  2B63 D;  4GS7 A;  1PW4 A;  1M4A A;  2D9Q A;  4Q65 A;  5FUC A;  4LRL A;  4YBQ A;  1EVS A;  2O6I A;  4ZWB A;  4YB9 D;  2B8Z A;  5GXB A;  2Z3R A;  5D70 A;  5EQG A;  3LB6 B;  1EKU A;  3BPO A;  1N1F A;  3G9V B;  3WCY I;  1ETE A;  4I77 Z;  3DI3 A;  4IKZ A;  1PY2 A;  3I4N D;  3B5K A;  4RS1 A;  3QB7 A;  3HOV D;  1HIJ A;  4NI9 A;  4YDY I;  4PS4 A;  4NI7 A;  1GNC A;  1QVN A;  1ALU A;  4YQX A;  1BBN A;  3TGX B;  3BES L;  3L5X A;  1M48 A;  3D85 C;  5D6K A;  3AYH A;  1RCB A;  2JA8 D;  3UX9 A;  2ILK A;  4DKC A;  1V7N V;  4CNI C;  2L3O A;  1AXI A;  4IKV A;  3QT2 C;  3HHR A;  2LAG A;  3DGC L;  4GC0 A;  4DOH A;  1ILK A;  1CSG A;  4WRL B;  3L5W I;  1PV7 A;  4NKQ C;  4BBS D;  4NN7 A;  1JLI A;  4ZWC A;  3UF5 A;  4LEP A;  4APS A;  5IYC D;  1M47 A;  5IYB D;  3WDO A;  1AU1 A;  4BXX D;  4PYP A;  2C35 A;  1KF9 A;  4D2D A;  4YPG C;  5L6Y C;  5C3E D;  4NEM A;  3UF2 A;  3PO2 D;  3N06 A;  4J4L C;  5EQI A;  3DUH C;  2GMF A;  2JA5 D;  3NCC A;  1RHG A;  5FLM D;  1BGE A;  3OG4 A;  1BUY A;  1HIK A;  4U4W A;  2O26 A;  4BBR D;  4FA8 E;  1EER A;  3O7Q A;  2H24 A;  2B8X A;  4D2C A;  3DI2 A;  2R93 D;  3HOU D;  3EJJ A;  1GA3 A;  3PIW A;  1M4C A;  4BY1 D;  4GBY A;  1YKB A;  5EQH A;  2B8U A;  4JR9 A;  1PVH B;  1CN4 C;  2OQP A;  2KZ1 A;  3H3V E;  5A2N A;  3UEZ E;  1V7M V;  1P9M B;  4TPH A;  3LB6 A;  4A3D D;  4A3L D;  3SE3 B;  1IAR A;  1RFB A;  1A7M A;  1INR A;  4XNJ A;  2L3Y A;  2IL6 A;  1Y6N L;  1A22 A;  4TPJ A;  1NBP A;  4Z5R D;  5D72 A;  3NCB A;  3G6D A;  1RW5 A;  5C4X D;  2D48 A;  2Q98 A;  1Y1V D;  4W6V A;  4BY7 D;  3H0G D;  4A3M D;  1CD9 A;  3O7P A;  1D9C A;  5D71 A;  2HYM B;  2VUM D;  3VA2 A;  4A93 D;  4OH3 A;  4XNI A;  1IK0 A;  3NCE A;  1Y6M L;  4A3C D;  2B5I A;  2O27 A;  1EXZ A;  3Q1S I;  1J7V L;  2Q7N B;  4IKY A;  3S9D A;  3PO3 D;  4IU9 A;  2E9W C;  1PV6 A;  3IRH A;  5D58 A; 
#chains in the Genus database with same CATH homology
 3OG6 A;  2R93 D;  1Y1W D;  1ALU A;  3HOY D;  4YQX A;  5D28 B;  1HWH A;  1LKI A;  3QWR B;  1IJZ A;  1BBN A;  4EXN A;  3HOX D;  3HOU D;  3HHC A;  4A3F D;  1ITL A;  3EJJ A;  2B8Y A;  3TGX B;  3BES L;  1M4C A;  1SCF A;  3L5X A;  3PIW A;  3MZG A;  4BY1 D;  1GA3 A;  4DKD A;  1M48 A;  1LQS L;  1VLK A;  3D85 C;  4A3E D;  1YKB A;  1BGC A;  2B8U A;  3AYH A;  1HWG A;  1RCB A;  4O6K A;  2JA8 D;  3HOZ D;  1BCN A;  1Y6K L;  5C7X A;  1FYH A;  2JA7 D;  4NEJ A;  1ITM A;  1PVH B;  4DKF A;  3N0P A;  1CN4 C;  4DKE A;  5IYD D;  4A3K D;  3UX9 A;  2ILK A;  2OQP A;  4DKC A;  2KZ1 A;  3H3V E;  1V7N V;  5E4E A;  3UEZ E;  2L3O A;  4MHL A;  1V7M V;  3EW3 A;  4CNI C;  4A3B D;  4NN5 A;  1HUL A;  1I1R B;  1P9M B;  1AXI A;  4ZF7 A;  5LQB A;  3LB6 A;  1HUW A;  3BPN A;  1B5L A;  4A3D D;  1AX8 A;  1BGD A;  3QT2 C;  3FKI D;  3QAZ A;  1PW6 A;  1CNT 1;  3HHR A;  5D22 A;  2Z3Q A;  2LAG A;  1Z7C A;  3BPL A;  2R7Z D;  3DGC L;  4A3L D;  1ILK A;  1BP3 A;  3SE3 B;  1IAR A;  1RFB A;  2ERJ D;  3DLQ I;  1CSG A;  4DOH A;  1A7M A;  4EXP A;  2JA6 D;  1F45 B;  4WRL B;  2LMS A;  3L5W I;  1INR A;  4NKQ C;  2L3Y A;  5KNH I;  1WU3 I;  3D87 A;  4BBS D;  3NPZ A;  4A3J D;  4NN7 A;  3QB1 A;  1JLI A;  4YUE C;  1D9G A;  3UF5 A;  2XQB A;  2IL6 A;  4X51 A;  1Y6N L;  1A22 A;  1FG9 A;  1NBP A;  2B63 D;  1PGR A;  4Z5R D;  1M47 A;  3INK C;  5D72 A;  3NCB A;  1LK3 A;  1AU1 A;  4GS7 A;  5IYB D;  5IYC D;  1M4A A;  2D9Q A;  4O9H A;  4BXX D;  1IL6 A;  3G6D A;  1WCM D;  1RW5 A;  5C4X D;  2C35 A;  2D48 A;  5FUC A;  4A3I D;  1M4R A;  2CYK A;  2Q98 A;  4LRL A;  1Y1V D;  3HOW D;  1EVS A;  2O6I A;  1KF9 A;  4GRW A;  4BY7 D;  4YPG C;  5L6Y C;  3H0G D;  5C3E D;  4A3M D;  1IRL A;  1CD9 A;  4NEM A;  1M49 A;  2Q14 A;  3UF2 A;  2B8Z A;  2Z3R A;  4ZS7 A;  1D9C A;  5IP7 D;  5D70 A;  5D71 A;  1ITF A;  3LB6 B;  3PO2 D;  2B91 A;  2HYM B;  1Z92 A;  1EKU A;  2B90 A;  3BPO A;  3N06 A;  4J4L C;  1N1F A;  3DUH C;  2GMF A;  2VUM D;  1CYL A;  3VA2 A;  4A93 D;  5IP9 D;  3G9V B;  2JA5 D;  3NCC A;  1RHG A;  1EMR A;  5FLM D;  1F6F A;  2PSM A;  1M4B A;  1IK0 A;  3NCE A;  1BGE A;  1Y6M L;  3WCY I;  5C44 D;  4A3C D;  3OG4 A;  3NCF A;  1BUY A;  1ITI A;  1ETE A;  1HIK A;  1HZI A;  1EXZ A;  2B5I A;  2O27 A;  4I77 Z;  3DI3 A;  1PY2 A;  3I4M D;  2INT A;  3I4N D;  3PIV A;  3B5K A;  4RS1 A;  2O26 A;  3QB7 A;  3SE4 B;  3OQ3 A;  3Q1S I;  3HOV D;  4A3G D;  1J7V L;  4NN6 A;  2Q7N B;  3HMX B;  1HIJ A;  4NI9 A;  4BBR D;  4FA8 E;  1EER A;  4PS4 A;  5FHX A;  4YDY I;  5TS9 A;  2H24 A;  2B8X A;  4NI7 A;  1HGU A;  3S9D A;  2R92 D;  3PO3 D;  1GNC A;  3D48 P;  2E9W C;  3DI2 A;  3IRH A;  1QVN A;  1Y14 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...