5D22A

Structure of ovine granulocyte-macrophage colony-stimulating factor
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
120
structure length
120
Chain Sequence
b'QPSPVTRPWQHVDAIKEALSLLNDSTDTAAVMDETVEVVSEMFDSQEPTCLQTRLELYKQGLRGSLTSLTGSLTMMASHYKKHCPPTQETSCETQIITFKSFKENLKDFLFIIPFDCWEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Granulocyte-macrophage colony-stimulating factor
publication title Structural basis of GM-CSF and IL-2 sequestration by the viral decoy receptor GIF.
pubmed doi rcsb
source organism Ovis aries
molecule tags Cytokine
total genus 36
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01109 GM_CSF Granulocyte-macrophage colony-stimulating factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1250.10 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; Growth Hormone; Chain: A; 5d22A00
3DUHC 2B5IA 1A7MA 1CYLA 4NEMA 1AU1A 1P9MB 1RHGA 3D85C 1PY2A 3MZGA 5KNHI 1HUWA 1RCBA 3QB7A 1ITMA 3N06A 3NCEA 1LKIA 4YPGC 5FUCA 4WRLB 1BP3A 4NKQC 1CNT1 1FYHA 1EKUA 4I77Z 4RS1A 1Z92A 5E4EA 1A22A 1BGCA 4YDYI 2ILKA 1RW5A 1RFBA 2D9QA 1PW6A 1EMRA 4NEJA 3PIVA 1CSGA 1IK0A 3UF5A 3HHRA 1Y6ML 3HMXB 3NPZA 1Z7CA 2O27A 1CD9A 3DGCL 4MHLA 1JLIA 5FHXA 3N0PA 2KZ1A 1BGEA 5D22A 1AX8A 1BCNA 3BESL 1IL6A 1ALUA 1NBPA 5C7XA 3BPNA 5D28B 3BPLA 3QT2C 4DOHA 1D9GA 3NCCA 1BGDA 5LQBA 4CNIC 1HZIA 1ITIA 2CYKA 1FG9A 2L3OA 1HWGA 1YKBA 3L5XA 5D72A 4Z5RD 1LQSL 1INRA 3SE4B 2H24A 1ILKA 1M48A 2B8XA 1V7NV 1Y6NL 1AXIA 2B8ZA 3BPOA 1BBNA 3B5KA 2GMFA 3QWRB 3UEZE 1M49A 4J4LC 1EVSA 1J7VL 1IJZA 3LB6B 3G6DA 1LK3A 3D48P 2ERJD 3LB6A 3DLQI 2B8UA 3UF2A 1BUYA 2LMSA 5L6YC 1CN4C 4X51A 2Q98A 1B5LA 4ZS7A 2INTA 5D70A 2Q7NB 1HGUA 2B91A 4YQXA 4ZF7A 3NCBA 1I1RB 1D9CA 1EXZA 4PS4A 1QVNA 4O9HA 3Q1SI 4GRWA 1M4RA 3INKC 1Y6KL 1KF9A 1N1FA 2B8YA 3UX9A 3NCFA 3D87A 3G9VB 1HIJA 2O26A 1M47A 1VLKA 1M4BA 2E9WC 3OQ3A 1PGRA 1EERA 3QAZA 1PVHB 3WCYI 3S9DA 1ITFA 1ETEA 1V7MV 2L3YA 1M4CA 3L5WI 5D71A 4FA8E 4NI7A 2D48A 1IRLA 3EW3A 3SE3B 2IL6A 4NI9A 1SCFA 1M4AA 4YUEC 1IARA 3QB1A 2LAGA 1GA3A 2B90A 3VA2A 1HIKA 1WU3I 1F6FA 1F45B 1HULA 3PIWA 1HWHA 1GNCA 4O6KA 2HYMB 3EJJA 1ITLA
chains in the Genus database with same CATH superfamily
1PW4A 3IRHA 4BXXD 4IU9A 2Q14A 4IKXA 4IU8A 1PY2A 3HOYD 3HOUD 3QB7A 4IKZA 4APSA 3I4MD 4WRLB 1FYHA 4A3BD 5E4EA 2ILKA 2D9QA 3PIVA 1IK0A 2JA6D 1Y6ML 1Z7CA 2CFPA 1CD9A 2O27A 3FKID 1JLIA 3N0PA 2KZ1A 1BCNA 1IL6A 3QT2C 4ZW9A 5D6KA 4A3GD 1D9GA 3NCCA 5LQBA 5FLMD 4BBSD 2V8NA 1HWGA 4XNIA 3BPOA 3UEZE 3O7PA 3H3VE 4GS7A 4BBRD 4A3ID 4O9HA 2B8YA 1VLKA 2E9WC 1PGRA 4A93D 5EQHA 4OAAA 4U4TA 5C65A 3DI3A 2Z3QA 5C44D 1HIKA 4IKYA 4J05A 1GNCA 4O6KA 2HYMB 4EXPA 1CYLA 4A3MD 1RHGA 3D85C 4JREA 5KNHI 1RCBA 3N06A 1LKIA 4YPGC 1BP3A 1CNT1 4Q65A 4I77Z 4GC0A 1RW5A 1RFBA 3UF5A 1Y1VD 3HHRA 3HMXB 3DGCL 5FHXA 2JA5D 4A3ED 5C7XA 4A3JD 1BGDA 4U4VA 4ZWBA 5D72A 3L5XA 4DKDA 1ILKA 4LRLA 5IYCD 1V7NV 1AXIA 3H0GD 2B8ZA 3QWRB 2R7ZD 5IYBD 1IJZA 3G6DA 1LK3A 2OQPA 3DLQI 1BUYA 4X51A 3HOZD 5EQIA 1HGUA 4D2DA 2B91A 4YQXA 4PS4A 1D9CA 5IP9D 1M4RA 2PSMA 5D58A 1N1FA 3NCFA 2O26A 2R92D 3OQ3A 4IKVA 1ITFA 1V7MV 2L3YA 3L5WI 4FA8E 2R93D 5C4XD 2IL6A 1SCFA 4YUEC 1IARA 3QB1A 1GA3A 3VA2A 1F6FA 3OG6A 1HWHA 3EJJA 3PO3D 4YB9D 3DUHC 2B5IA 4ZYRA 1A7MA 5C3ED 4NN6A 2JA7D 1AU1A 3WDOA 2XQBA 3NCEA 3PO2D 5FUCA 4RS1A 1Z92A 1BGCA 2Z3RA 4D2BA 1PW6A 4IKWA 1CSGA 3AYHA 4MHLA 2XUTA 5D22A 4W6VA 1Y1WD 1NBPA 3BPNA 5D28B 1ITIA 1FG9A 4BY1D 2L3OA 4Z5RD 1LQSL 1INRA 2H24A 5GXBA 4JA3A 1M49A 4TPJA 3HOWD 3D48P 2ERJD 4TPGA 3UF2A 5L6YC 2LMSA 4UVMA 2Q98A 1B5LA 4ZS7A 4ZF7A 3NCBA 3Q1SI 4GRWA 4QIQA 5EQGA 3INKC 1KF9A 3TGXB 4A3FD 1WCMD 4GBYA 1M47A 2JA8D 1PVHB 2VUMD 1ETEA 1M4CA 3I4ND 4NI7A 2D48A 1IRLA 3EW3A 3SE3B 4NI9A 3OG4A 2C35A 4OH3A 4TPHA 5TS9A 1HULA 4U4WA 4JR9A 1Y14A 1ITLA 4NEMA 4D2CA 4NN5A 1P9MB 4YBQA 4LDSA 4A3KD 3MZGA 1HUWA 1ITMA 4A3CD 4DKFA 4NKQC 1EKUA 1PV6A 1A22A 4YDYI 1EMRA 4GBZA 4NEJA 3DI2A 3NPZA 1BGEA 1AX8A 2B63D 3BESL 1ALUA 4DKEA 3BPLA 4DOHA 4CNIC 1HZIA 2CYKA 1YKBA 3SE4B 3HOVD 4ZWCA 1M48A 2B8XA 5A2OA 4A3LD 1Y6NL 5A2NA 4A3DD 1BBNA 3B5KA 2GMFA 4J4LC 2Y5YA 1EVSA 1J7VL 3LB6B 3LB6A 2B8UA 3HHCA 1CN4C 2CFQA 4XNJA 2INTA 3HOXD 5D70A 2Q7NB 3O7QA 1I1RB 1EXZA 2O6IA 4DKCA 1QVNA 4LEPA 1Y6KL 3UX9A 3D87A 3G9VB 1HIJA 1M4BA 3S9DA 3WCYI 1EERA 5IYDD 3QAZA 4NN7A 5D71A 4EXNA 4PYPA 1M4AA 5IP7D 2LAGA 4BY7D 2B90A 1WU3I 1F45B 3PIWA 1PV7A 5D59A
chains in the Genus database with same CATH topology
3DUHC 4EXPA 2B5IA 1A7MA 1CYLA 3IRHA 4NEMA 4NN6A 4NN5A 5C3ED 2JA7D 1AU1A 1P9MB 4A3MD 4BXXD 1RHGA 3D85C 2Q14A 4A3KD 1PY2A 3HOYD 3MZGA 5KNHI 1HUWA 3HOUD 1RCBA 3QB7A 1ITMA 3N06A 2XQBA 3NCEA 1LKIA 4A3CD 4YPGC 4DKFA 3PO2D 3I4MD 5FUCA 2VUMD 4WRLB 1BP3A 4NKQC 1CNT1 1FYHA 1EKUA 4A3BD 4I77Z 4RS1A 1Z92A 5E4EA 1A22A 1BGCA 4YDYI 2ILKA 1RW5A 2Z3RA 1RFBA 2D9QA 1PW6A 1EMRA 4NEJA 3PIVA 1CSGA 1IK0A 3UF5A 1Y1VD 3AYHA 2JA6D 3HHRA 3DI2A 1Y6ML 3HMXB 3NPZA 1Z7CA 2O27A 1CD9A 3DGCL 3FKID 1JLIA 4MHLA 5FHXA 3N0PA 2KZ1A 1BGEA 5D22A 1Y1WD 1AX8A 1BCNA 2B63D 2JA5D 4A3ED 3BESL 1IL6A 1ALUA 1NBPA 4DKEA 5C7XA 3BPNA 5D28B 4A3JD 3BPLA 3QT2C 4A3GD 4DOHA 1D9GA 3NCCA 1BGDA 5LQBA 5FLMD 4CNIC 4BBSD 1HZIA 1ITIA 2CYKA 1FG9A 4BY1D 2L3OA 1HWGA 1YKBA 3L5XA 5D72A 4Z5RD 1LQSL 1INRA 3SE4B 3HOVD 2H24A 1ILKA 4DKDA 4LRLA 1M48A 5IYCD 2B8XA 3EJJA 1V7NV 1Y6NL 4A3LD 1AXIA 3H0GD 2B8ZA 3BPOA 2JA8D 4A3DD 1BBNA 3B5KA 2GMFA 3QWRB 3UEZE 1M49A 4J4LC 2R7ZD 1EVSA 3H3VE 5IYBD 1J7VL 1IJZA 3LB6B 3G6DA 3HOWD 1LK3A 2OQPA 3D48P 2ERJD 3LB6A 3DLQI 2B8UA 3UF2A 1BUYA 2LMSA 3HHCA 1CN4C 4X51A 5L6YC 2Q98A 1B5LA 4ZS7A 3HOZD 4A93D 2INTA 3HOXD 5D70A 4GS7A 1HGUA 2Q7NB 4BBRD 2B91A 4YQXA 4A3ID 4ZF7A 3NCBA 1I1RB 1D9CA 1EXZA 4PS4A 2O6IA 4DKCA 5IP9D 1QVNA 4O9HA 3Q1SI 4GRWA 1M4RA 2PSMA 3INKC 1ITFA 1Y6KL 1KF9A 3TGXB 1N1FA 2B8YA 3UX9A 3NCFA 3D87A 3G9VB 4A3FD 1HIJA 1WCMD 2O26A 1M47A 1VLKA 2R92D 1M4BA 2E9WC 3OQ3A 1PGRA 1EERA 3QAZA 1PVHB 3WCYI 3S9DA 5IYDD 4NN7A 1ETEA 1V7MV 2L3YA 1M4CA 3L5WI 5D71A 4EXNA 4FA8E 2R93D 3I4ND 5C4XD 4NI7A 2D48A 1IRLA 3EW3A 3SE3B 2IL6A 4NI9A 1SCFA 1M4AA 5IP7D 3OG4A 2C35A 4YUEC 1IARA 3QB1A 2LAGA 3DI3A 2Z3QA 4BY7D 5C44D 1GA3A 2B90A 3VA2A 1HIKA 1WU3I 1F6FA 5TS9A 1F45B 1HULA 3PIWA 3OG6A 1HWHA 1GNCA 4O6KA 2HYMB 1Y14A 3PO3D 1ITLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DUH C;  2B5I A;  1A7M A;  1CYL A;  4NEM A;  1AU1 A;  1P9M B;  1RHG A;  3D85 C;  1PY2 A;  3MZG A;  5KNH I;  1HUW A;  1RCB A;  3QB7 A;  1ITM A;  3N06 A;  3NCE A;  1LKI A;  4YPG C;  5FUC A;  4WRL B;  1BP3 A;  4NKQ C;  1CNT 1;  1FYH A;  1EKU A;  4I77 Z;  4RS1 A;  1Z92 A;  5E4E A;  1A22 A;  1BGC A;  4YDY I;  2ILK A;  1RW5 A;  1RFB A;  2D9Q A;  1PW6 A;  1EMR A;  4NEJ A;  3PIV A;  1CSG A;  1IK0 A;  3UF5 A;  3HHR A;  1Y6M L;  3HMX B;  3NPZ A;  1Z7C A;  2O27 A;  1CD9 A;  3DGC L;  4MHL A;  1JLI A;  5FHX A;  3N0P A;  2KZ1 A;  1BGE A;  5D22 A;  1AX8 A;  1BCN A;  3BES L;  1IL6 A;  1ALU A;  1NBP A;  5C7X A;  3BPN A;  5D28 B;  3BPL A;  3QT2 C;  4DOH A;  1D9G A;  3NCC A;  1BGD A;  5LQB A;  4CNI C;  1HZI A;  1ITI A;  2CYK A;  1FG9 A;  2L3O A;  1HWG A;  1YKB A;  3L5X A;  5D72 A;  4Z5R D;  1LQS L;  1INR A;  3SE4 B;  2H24 A;  1ILK A;  1M48 A;  2B8X A;  1V7N V;  1Y6N L;  1AXI A;  2B8Z A;  3BPO A;  1BBN A;  3B5K A;  2GMF A;  3QWR B;  3UEZ E;  1M49 A;  4J4L C;  1EVS A;  1J7V L;  1IJZ A;  3LB6 B;  3G6D A;  1LK3 A;  3D48 P;  2ERJ D;  3LB6 A;  3DLQ I;  2B8U A;  3UF2 A;  1BUY A;  2LMS A;  5L6Y C;  1CN4 C;  4X51 A;  2Q98 A;  1B5L A;  4ZS7 A;  2INT A;  5D70 A;  2Q7N B;  1HGU A;  2B91 A;  4YQX A;  4ZF7 A;  3NCB A;  1I1R B;  1D9C A;  1EXZ A;  4PS4 A;  1QVN A;  4O9H A;  3Q1S I;  4GRW A;  1M4R A;  3INK C;  1Y6K L;  1KF9 A;  1N1F A;  2B8Y A;  3UX9 A;  3NCF A;  3D87 A;  3G9V B;  1HIJ A;  2O26 A;  1M47 A;  1VLK A;  1M4B A;  2E9W C;  3OQ3 A;  1PGR A;  1EER A;  3QAZ A;  1PVH B;  3WCY I;  3S9D A;  1ITF A;  1ETE A;  1V7M V;  2L3Y A;  1M4C A;  3L5W I;  5D71 A;  4FA8 E;  4NI7 A;  2D48 A;  1IRL A;  3EW3 A;  3SE3 B;  2IL6 A;  4NI9 A;  1SCF A;  1M4A A;  4YUE C;  1IAR A;  3QB1 A;  2LAG A;  1GA3 A;  2B90 A;  3VA2 A;  1HIK A;  1WU3 I;  1F6F A;  1F45 B;  1HUL A;  3PIW A;  1HWH A;  1GNC A;  4O6K A;  2HYM B;  3EJJ A;  1ITL A; 
#chains in the Genus database with same CATH topology
 1PW4 A;  3IRH A;  4BXX D;  4IU9 A;  2Q14 A;  4IKX A;  4IU8 A;  1PY2 A;  3HOY D;  3HOU D;  3QB7 A;  4IKZ A;  4APS A;  3I4M D;  4WRL B;  1FYH A;  4A3B D;  5E4E A;  2ILK A;  2D9Q A;  3PIV A;  1IK0 A;  2JA6 D;  1Y6M L;  1Z7C A;  2CFP A;  1CD9 A;  2O27 A;  3FKI D;  1JLI A;  3N0P A;  2KZ1 A;  1BCN A;  1IL6 A;  3QT2 C;  4ZW9 A;  5D6K A;  4A3G D;  1D9G A;  3NCC A;  5LQB A;  5FLM D;  4BBS D;  2V8N A;  1HWG A;  4XNI A;  3BPO A;  3UEZ E;  3O7P A;  3H3V E;  4GS7 A;  4BBR D;  4A3I D;  4O9H A;  2B8Y A;  1VLK A;  2E9W C;  1PGR A;  4A93 D;  5EQH A;  4OAA A;  4U4T A;  5C65 A;  3DI3 A;  2Z3Q A;  5C44 D;  1HIK A;  4IKY A;  4J05 A;  1GNC A;  4O6K A;  2HYM B;  4EXP A;  1CYL A;  4A3M D;  1RHG A;  3D85 C;  4JRE A;  5KNH I;  1RCB A;  3N06 A;  1LKI A;  4YPG C;  1BP3 A;  1CNT 1;  4Q65 A;  4I77 Z;  4GC0 A;  1RW5 A;  1RFB A;  3UF5 A;  1Y1V D;  3HHR A;  3HMX B;  3DGC L;  5FHX A;  2JA5 D;  4A3E D;  5C7X A;  4A3J D;  1BGD A;  4U4V A;  4ZWB A;  5D72 A;  3L5X A;  4DKD A;  1ILK A;  4LRL A;  5IYC D;  1V7N V;  1AXI A;  3H0G D;  2B8Z A;  3QWR B;  2R7Z D;  5IYB D;  1IJZ A;  3G6D A;  1LK3 A;  2OQP A;  3DLQ I;  1BUY A;  4X51 A;  3HOZ D;  5EQI A;  1HGU A;  4D2D A;  2B91 A;  4YQX A;  4PS4 A;  1D9C A;  5IP9 D;  1M4R A;  2PSM A;  5D58 A;  1N1F A;  3NCF A;  2O26 A;  2R92 D;  3OQ3 A;  4IKV A;  1ITF A;  1V7M V;  2L3Y A;  3L5W I;  4FA8 E;  2R93 D;  5C4X D;  2IL6 A;  1SCF A;  4YUE C;  1IAR A;  3QB1 A;  1GA3 A;  3VA2 A;  1F6F A;  3OG6 A;  1HWH A;  3EJJ A;  3PO3 D;  4YB9 D;  3DUH C;  2B5I A;  4ZYR A;  1A7M A;  5C3E D;  4NN6 A;  2JA7 D;  1AU1 A;  3WDO A;  2XQB A;  3NCE A;  3PO2 D;  5FUC A;  4RS1 A;  1Z92 A;  1BGC A;  2Z3R A;  4D2B A;  1PW6 A;  4IKW A;  1CSG A;  3AYH A;  4MHL A;  2XUT A;  5D22 A;  4W6V A;  1Y1W D;  1NBP A;  3BPN A;  5D28 B;  1ITI A;  1FG9 A;  4BY1 D;  2L3O A;  4Z5R D;  1LQS L;  1INR A;  2H24 A;  5GXB A;  4JA3 A;  1M49 A;  4TPJ A;  3HOW D;  3D48 P;  2ERJ D;  4TPG A;  3UF2 A;  5L6Y C;  2LMS A;  4UVM A;  2Q98 A;  1B5L A;  4ZS7 A;  4ZF7 A;  3NCB A;  3Q1S I;  4GRW A;  4QIQ A;  5EQG A;  3INK C;  1KF9 A;  3TGX B;  4A3F D;  1WCM D;  4GBY A;  1M47 A;  2JA8 D;  1PVH B;  2VUM D;  1ETE A;  1M4C A;  3I4N D;  4NI7 A;  2D48 A;  1IRL A;  3EW3 A;  3SE3 B;  4NI9 A;  3OG4 A;  2C35 A;  4OH3 A;  4TPH A;  5TS9 A;  1HUL A;  4U4W A;  4JR9 A;  1Y14 A;  1ITL A;  4NEM A;  4D2C A;  4NN5 A;  1P9M B;  4YBQ A;  4LDS A;  4A3K D;  3MZG A;  1HUW A;  1ITM A;  4A3C D;  4DKF A;  4NKQ C;  1EKU A;  1PV6 A;  1A22 A;  4YDY I;  1EMR A;  4GBZ A;  4NEJ A;  3DI2 A;  3NPZ A;  1BGE A;  1AX8 A;  2B63 D;  3BES L;  1ALU A;  4DKE A;  3BPL A;  4DOH A;  4CNI C;  1HZI A;  2CYK A;  1YKB A;  3SE4 B;  3HOV D;  4ZWC A;  1M48 A;  2B8X A;  5A2O A;  4A3L D;  1Y6N L;  5A2N A;  4A3D D;  1BBN A;  3B5K A;  2GMF A;  4J4L C;  2Y5Y A;  1EVS A;  1J7V L;  3LB6 B;  3LB6 A;  2B8U A;  3HHC A;  1CN4 C;  2CFQ A;  4XNJ A;  2INT A;  3HOX D;  5D70 A;  2Q7N B;  3O7Q A;  1I1R B;  1EXZ A;  2O6I A;  4DKC A;  1QVN A;  4LEP A;  1Y6K L;  3UX9 A;  3D87 A;  3G9V B;  1HIJ A;  1M4B A;  3S9D A;  3WCY I;  1EER A;  5IYD D;  3QAZ A;  4NN7 A;  5D71 A;  4EXN A;  4PYP A;  1M4A A;  5IP7 D;  2LAG A;  4BY7 D;  2B90 A;  1WU3 I;  1F45 B;  3PIW A;  1PV7 A;  5D59 A; 
#chains in the Genus database with same CATH homology
 3DUH C;  4EXP A;  2B5I A;  1A7M A;  1CYL A;  3IRH A;  4NEM A;  4NN6 A;  4NN5 A;  5C3E D;  2JA7 D;  1AU1 A;  1P9M B;  4A3M D;  4BXX D;  1RHG A;  3D85 C;  2Q14 A;  4A3K D;  1PY2 A;  3HOY D;  3MZG A;  5KNH I;  1HUW A;  3HOU D;  1RCB A;  3QB7 A;  1ITM A;  3N06 A;  2XQB A;  3NCE A;  1LKI A;  4A3C D;  4YPG C;  4DKF A;  3PO2 D;  3I4M D;  5FUC A;  2VUM D;  4WRL B;  1BP3 A;  4NKQ C;  1CNT 1;  1FYH A;  1EKU A;  4A3B D;  4I77 Z;  4RS1 A;  1Z92 A;  5E4E A;  1A22 A;  1BGC A;  4YDY I;  2ILK A;  1RW5 A;  2Z3R A;  1RFB A;  2D9Q A;  1PW6 A;  1EMR A;  4NEJ A;  3PIV A;  1CSG A;  1IK0 A;  3UF5 A;  1Y1V D;  3AYH A;  2JA6 D;  3HHR A;  3DI2 A;  1Y6M L;  3HMX B;  3NPZ A;  1Z7C A;  2O27 A;  1CD9 A;  3DGC L;  3FKI D;  1JLI A;  4MHL A;  5FHX A;  3N0P A;  2KZ1 A;  1BGE A;  5D22 A;  1Y1W D;  1AX8 A;  1BCN A;  2B63 D;  2JA5 D;  4A3E D;  3BES L;  1IL6 A;  1ALU A;  1NBP A;  4DKE A;  5C7X A;  3BPN A;  5D28 B;  4A3J D;  3BPL A;  3QT2 C;  4A3G D;  4DOH A;  1D9G A;  3NCC A;  1BGD A;  5LQB A;  5FLM D;  4CNI C;  4BBS D;  1HZI A;  1ITI A;  2CYK A;  1FG9 A;  4BY1 D;  2L3O A;  1HWG A;  1YKB A;  3L5X A;  5D72 A;  4Z5R D;  1LQS L;  1INR A;  3SE4 B;  3HOV D;  2H24 A;  1ILK A;  4DKD A;  4LRL A;  1M48 A;  5IYC D;  2B8X A;  3EJJ A;  1V7N V;  1Y6N L;  4A3L D;  1AXI A;  3H0G D;  2B8Z A;  3BPO A;  2JA8 D;  4A3D D;  1BBN A;  3B5K A;  2GMF A;  3QWR B;  3UEZ E;  1M49 A;  4J4L C;  2R7Z D;  1EVS A;  3H3V E;  5IYB D;  1J7V L;  1IJZ A;  3LB6 B;  3G6D A;  3HOW D;  1LK3 A;  2OQP A;  3D48 P;  2ERJ D;  3LB6 A;  3DLQ I;  2B8U A;  3UF2 A;  1BUY A;  2LMS A;  3HHC A;  1CN4 C;  4X51 A;  5L6Y C;  2Q98 A;  1B5L A;  4ZS7 A;  3HOZ D;  4A93 D;  2INT A;  3HOX D;  5D70 A;  4GS7 A;  1HGU A;  2Q7N B;  4BBR D;  2B91 A;  4YQX A;  4A3I D;  4ZF7 A;  3NCB A;  1I1R B;  1D9C A;  1EXZ A;  4PS4 A;  2O6I A;  4DKC A;  5IP9 D;  1QVN A;  4O9H A;  3Q1S I;  4GRW A;  1M4R A;  2PSM A;  3INK C;  1ITF A;  1Y6K L;  1KF9 A;  3TGX B;  1N1F A;  2B8Y A;  3UX9 A;  3NCF A;  3D87 A;  3G9V B;  4A3F D;  1HIJ A;  1WCM D;  2O26 A;  1M47 A;  1VLK A;  2R92 D;  1M4B A;  2E9W C;  3OQ3 A;  1PGR A;  1EER A;  3QAZ A;  1PVH B;  3WCY I;  3S9D A;  5IYD D;  4NN7 A;  1ETE A;  1V7M V;  2L3Y A;  1M4C A;  3L5W I;  5D71 A;  4EXN A;  4FA8 E;  2R93 D;  3I4N D;  5C4X D;  4NI7 A;  2D48 A;  1IRL A;  3EW3 A;  3SE3 B;  2IL6 A;  4NI9 A;  1SCF A;  1M4A A;  5IP7 D;  3OG4 A;  2C35 A;  4YUE C;  1IAR A;  3QB1 A;  2LAG A;  3DI3 A;  2Z3Q A;  4BY7 D;  5C44 D;  1GA3 A;  2B90 A;  3VA2 A;  1HIK A;  1WU3 I;  1F6F A;  5TS9 A;  1F45 B;  1HUL A;  3PIW A;  3OG6 A;  1HWH A;  1GNC A;  4O6K A;  2HYM B;  1Y14 A;  3PO3 D;  1ITL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...