4GS7A

Structure of the interleukin-15 quaternary complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
114
structure length
110
Chain Sequence
b'MGNWVNVISDLIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEENIEFLQSFVHIVQMFIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-15
publication title Mechanistic and structural insight into the functional dichotomy between IL-2 and IL-15.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 36
structure length 110
sequence length 114
ec nomenclature
pdb deposition date 2012-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1250.70 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; Growth Hormone; Chain: A; 4gs7A00
2XQBA 2OQPA 2PSMA 4GS7A 3TGXB 2Z3QA 2Z3RA
chains in the Genus database with same CATH superfamily
3INKC 3LB6A 4ZWCA 3D87A 4O6KA 4TPHA 4NKQC 1Z92A 3NCFA 4IKYA 3SE3B 1Y14A 1VLKA 4NEJA 3IRHA 1M4AA 5D71A 1CYLA 4DKCA 4LDSA 5C44D 4ZF7A 5C65A 2CYKA 2B63D 1RHGA 3OG4A 3MZGA 2Q14A 2HYMB 2GMFA 1BGCA 1FYHA 3WDOA 2LMSA 1HWGA 3EJJA 2E9WC 3HOXD 4BY1D 3D48P 2CFQA 4XNJA 1ETEA 4D2DA 2B90A 1M4BA 5IYBD 3BESL 3I4MD 3DI3A 3NCCA 3OQ3A 4NN7A 4IKZA 1F6FA 1BUYA 2JA5D 4EXNA 4FA8E 1ITFA 1P9MB 1RW5A 3PO2D 3HMXB 1B5LA 2B8UA 1HIJA 5D70A 3DUHC 5D6KA 1WU3I 1BGEA 5E4EA 1INRA 2V8NA 1Z7CA 5C4XD 5D22A 4NEMA 2PSMA 4A3GD 2LAGA 4TPGA 4UVMA 3FKID 3PO3D 2O26A 4QIQA 1ALUA 4GBYA 2B91A 3WCYI 4GS7A 4U4VA 4D2CA 1PW6A 4BY7D 1HIKA 2O27A 2C35A 4U4TA 4X51A 4IKXA 3NPZA 1AX8A 1HGUA 4NN5A 5D28B 3O7PA 1V7MV 3N06A 1M4RA 5LQBA 4I77Z 1ILKA 2B8ZA 3PIVA 4OAAA 5EQIA 1CSGA 1PW4A 1KF9A 1A22A 1ITLA 5L6YC 1LK3A 2INTA 5FUCA 2L3YA 2H24A 2JA8D 2VUMD 1AU1A 3OG6A 1YKBA 1HZIA 4J05A 1CN4C 4APSA 5FLMD 1Y1WD 1EMRA 3QT2C 2XQBA 4BBRD 4CNIC 1EERA 2L3OA 3UX9A 1M4CA 2D9QA 2R7ZD 3EW3A 1AXIA 3G9VB 4ZS7A 4A3ID 4DKDA 4A93D 3VA2A 2Z3RA 5EQGA 3NCBA 3BPNA 1F45B 3NCEA 3Q1SI 1A7MA 2D48A 1Y6KL 1ITIA 1LQSL 3QAZA 2IL6A 3QWRB 1BCNA 5GXBA 1IARA 4A3FD 1LKIA 3AYHA 3UEZE 3L5XA 4A3JD 3S9DA 1WCMD 1Y1VD 4ZW9A 4IU8A 4O9HA 3HOUD 3SE4B 1GNCA 3UF5A 4IU9A 4TPJA 1CNT1 2OQPA 4W6VA 3TGXB 4GBZA 3H3VE 1Y6NL 3HOYD 1IJZA 3PIWA 4PYPA 5EQHA 4XNIA 4A3CD 4BBSD 4JA3A 3I4ND 2JA7D 5TS9A 4A3ED 2B8XA 1QVNA 2ILKA 4A3DD 3BPLA 4JREA 4MHLA 2B8YA 1M49A 4OH3A 2O6IA 1M48A 5D58A 2R93D 1HUWA 1Y6ML 4DOHA 1IK0A 5D72A 4ZWBA 2Q7NB 4IKWA 3DI2A 1I1RB 1N1FA 4IKVA 1PVHB 4EXPA 4NI7A 2R92D 3L5WI 4Z5RD 1EXZA 3B5KA 4YBQA 3G6DA 4NI9A 1IRLA 4A3BD 1BBNA 1PV6A 1RFBA 1J7VL 3DLQI 4GRWA 4YPGC 2KZ1A 4WRLB 4YUEC 1NBPA 2B5IA 5IYDD 1BGDA 3D85C 3UF2A 4YB9D 1PV7A 5C7XA 4NN6A 4PS4A 4YQXA 1ITMA 1EVSA 1HULA 4A3MD 3HOWD 1JLIA 3N0PA 4A3LD 4RS1A 3LB6B 3DGCL 5C3ED 4A3KD 5FHXA 1V7NV 4DKFA 1PGRA 5IP7D 5A2NA 1D9CA 2Q98A 2JA6D 1PY2A 5IYCD 1EKUA 2ERJD 4Q65A 1IL6A 4ZYRA 3O7QA 1RCBA 5D59A 4YDYI 1M47A 1SCFA 2CFPA 2Y5YA 3H0GD 4U4WA 5IP9D 4LEPA 1FG9A 1D9GA 4BXXD 1HWHA 1GA3A 3HHCA 3QB7A 4LRLA 4J4LC 4JR9A 4D2BA 2Z3QA 3QB1A 2XUTA 1BP3A 1CD9A 3HHRA 3HOVD 5KNHI 5A2OA 4GC0A 3HOZD 3BPOA 4DKEA
chains in the Genus database with same CATH topology
4WRLB 3FKID 3PO3D 3QWRB 1BCNA 2O26A 1NBPA 2B5IA 4YUEC 5IYDD 3INKC 1IARA 1BGDA 3LB6A 3D87A 3D85C 3UF2A 1LKIA 1ALUA 4O6KA 4A3FD 4NKQC 3AYHA 1Z92A 5C7XA 4NN6A 4PS4A 3UEZE 2B91A 3L5XA 3NCFA 4YQXA 3WCYI 1ITMA 1EVSA 4A3JD 4GS7A 3SE3B 3S9DA 1HULA 4A3MD 3HOWD 1WCMD 1Y1VD 1JLIA 1PW6A 1VLKA 1Y14A 3N0PA 4NEJA 3IRHA 1M4AA 3HOUD 4O9HA 5D71A 4BY7D 3SE4B 1HIKA 2O27A 1CYLA 4DKCA 5C44D 4A3LD 3UF5A 1GNCA 4ZF7A 2CYKA 2B63D 1RHGA 2C35A 3LB6B 3OG4A 3DGCL 3MZGA 4RS1A 4X51A 2Q14A 3NPZA 5C3ED 1CNT1 2OQPA 4A3KD 3TGXB 3H3VE 1AX8A 1V7NV 2HYMB 2GMFA 1HGUA 5FHXA 4NN5A 4DKFA 1BGCA 1Y6NL 3HOYD 1FYHA 1PGRA 5D28B 1IJZA 1V7MV 2LMSA 3PIWA 5IP7D 3N06A 1D9CA 1M4RA 1HWGA 2Q98A 2JA6D 4A3CD 4BBSD 1PY2A 5LQBA 4I77Z 1ILKA 2B8ZA 5IYCD 3PIVA 3I4ND 1EKUA 2JA7D 5TS9A 2ERJD 4A3ED 1IL6A 1CSGA 1RCBA 3EJJA 2B8XA 1QVNA 2E9WC 2ILKA 4YDYI 3HOXD 4A3DD 1M47A 1SCFA 4BY1D 3BPLA 1KF9A 1A22A 3D48P 1ITLA 4MHLA 3H0GD 5L6YC 2B8YA 1LK3A 2INTA 5FUCA 1ETEA 1M49A 2B90A 1M4BA 2L3YA 2H24A 2O6IA 1M48A 2JA8D 5IYBD 2R93D 2VUMD 1HUWA 1AU1A 3BESL 3OG6A 5IP9D 1YKBA 1HZIA 1Y6ML 4DOHA 3I4MD 1FG9A 1CN4C 5FLMD 1Y1WD 1IK0A 5D72A 3DI3A 1D9GA 1EMRA 3NCCA 3QT2C 4A93D 1HWHA 2Q7NB 2XQBA 4BXXD 3OQ3A 4BBRD 4NN7A 4CNIC 1GA3A 1F6FA 3HHCA 1BUYA 3DI2A 1I1RB 4DKEA 1EERA 2L3OA 3QB7A 4LRLA 4J4LC 3UX9A 2JA5D 4EXNA 1N1FA 1M4CA 2D9QA 4FA8E 2R7ZD 1ITFA 1PVHB 4EXPA 2Z3QA 3EW3A 3L5WI 3QB1A 4NI7A 1AXIA 1P9MB 2R92D 1RW5A 3PO2D 3HMXB 1B5LA 2B8UA 1EXZA 3G9VB 4Z5RD 1HIJA 5D70A 3B5KA 3DUHC 1WU3I 1BGEA 1BP3A 5E4EA 1INRA 3G6DA 4ZS7A 4DKDA 1IRLA 1CD9A 4A3ID 4NI9A 1Z7CA 3HHRA 3HOVD 3VA2A 5C4XD 2Z3RA 5D22A 3NCBA 4NEMA 4A3BD 2PSMA 3BPNA 4A3GD 1BBNA 1F45B 2LAGA 5KNHI 3NCEA 3Q1SI 1A7MA 3HOZD 2D48A 3BPOA 1RFBA 1Y6KL 1J7VL 3DLQI 1ITIA 1LQSL 3QAZA 2IL6A 4GRWA 4YPGC 2KZ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XQB A;  2OQP A;  2PSM A;  4GS7 A;  3TGX B;  2Z3Q A;  2Z3R A; 
#chains in the Genus database with same CATH topology
 3INK C;  3LB6 A;  4ZWC A;  3D87 A;  4O6K A;  4TPH A;  4NKQ C;  1Z92 A;  3NCF A;  4IKY A;  3SE3 B;  1Y14 A;  1VLK A;  4NEJ A;  3IRH A;  1M4A A;  5D71 A;  1CYL A;  4DKC A;  4LDS A;  5C44 D;  4ZF7 A;  5C65 A;  2CYK A;  2B63 D;  1RHG A;  3OG4 A;  3MZG A;  2Q14 A;  2HYM B;  2GMF A;  1BGC A;  1FYH A;  3WDO A;  2LMS A;  1HWG A;  3EJJ A;  2E9W C;  3HOX D;  4BY1 D;  3D48 P;  2CFQ A;  4XNJ A;  1ETE A;  4D2D A;  2B90 A;  1M4B A;  5IYB D;  3BES L;  3I4M D;  3DI3 A;  3NCC A;  3OQ3 A;  4NN7 A;  4IKZ A;  1F6F A;  1BUY A;  2JA5 D;  4EXN A;  4FA8 E;  1ITF A;  1P9M B;  1RW5 A;  3PO2 D;  3HMX B;  1B5L A;  2B8U A;  1HIJ A;  5D70 A;  3DUH C;  5D6K A;  1WU3 I;  1BGE A;  5E4E A;  1INR A;  2V8N A;  1Z7C A;  5C4X D;  5D22 A;  4NEM A;  2PSM A;  4A3G D;  2LAG A;  4TPG A;  4UVM A;  3FKI D;  3PO3 D;  2O26 A;  4QIQ A;  1ALU A;  4GBY A;  2B91 A;  3WCY I;  4GS7 A;  4U4V A;  4D2C A;  1PW6 A;  4BY7 D;  1HIK A;  2O27 A;  2C35 A;  4U4T A;  4X51 A;  4IKX A;  3NPZ A;  1AX8 A;  1HGU A;  4NN5 A;  5D28 B;  3O7P A;  1V7M V;  3N06 A;  1M4R A;  5LQB A;  4I77 Z;  1ILK A;  2B8Z A;  3PIV A;  4OAA A;  5EQI A;  1CSG A;  1PW4 A;  1KF9 A;  1A22 A;  1ITL A;  5L6Y C;  1LK3 A;  2INT A;  5FUC A;  2L3Y A;  2H24 A;  2JA8 D;  2VUM D;  1AU1 A;  3OG6 A;  1YKB A;  1HZI A;  4J05 A;  1CN4 C;  4APS A;  5FLM D;  1Y1W D;  1EMR A;  3QT2 C;  2XQB A;  4BBR D;  4CNI C;  1EER A;  2L3O A;  3UX9 A;  1M4C A;  2D9Q A;  2R7Z D;  3EW3 A;  1AXI A;  3G9V B;  4ZS7 A;  4A3I D;  4DKD A;  4A93 D;  3VA2 A;  2Z3R A;  5EQG A;  3NCB A;  3BPN A;  1F45 B;  3NCE A;  3Q1S I;  1A7M A;  2D48 A;  1Y6K L;  1ITI A;  1LQS L;  3QAZ A;  2IL6 A;  3QWR B;  1BCN A;  5GXB A;  1IAR A;  4A3F D;  1LKI A;  3AYH A;  3UEZ E;  3L5X A;  4A3J D;  3S9D A;  1WCM D;  1Y1V D;  4ZW9 A;  4IU8 A;  4O9H A;  3HOU D;  3SE4 B;  1GNC A;  3UF5 A;  4IU9 A;  4TPJ A;  1CNT 1;  2OQP A;  4W6V A;  3TGX B;  4GBZ A;  3H3V E;  1Y6N L;  3HOY D;  1IJZ A;  3PIW A;  4PYP A;  5EQH A;  4XNI A;  4A3C D;  4BBS D;  4JA3 A;  3I4N D;  2JA7 D;  5TS9 A;  4A3E D;  2B8X A;  1QVN A;  2ILK A;  4A3D D;  3BPL A;  4JRE A;  4MHL A;  2B8Y A;  1M49 A;  4OH3 A;  2O6I A;  1M48 A;  5D58 A;  2R93 D;  1HUW A;  1Y6M L;  4DOH A;  1IK0 A;  5D72 A;  4ZWB A;  2Q7N B;  4IKW A;  3DI2 A;  1I1R B;  1N1F A;  4IKV A;  1PVH B;  4EXP A;  4NI7 A;  2R92 D;  3L5W I;  4Z5R D;  1EXZ A;  3B5K A;  4YBQ A;  3G6D A;  4NI9 A;  1IRL A;  4A3B D;  1BBN A;  1PV6 A;  1RFB A;  1J7V L;  3DLQ I;  4GRW A;  4YPG C;  2KZ1 A;  4WRL B;  4YUE C;  1NBP A;  2B5I A;  5IYD D;  1BGD A;  3D85 C;  3UF2 A;  4YB9 D;  1PV7 A;  5C7X A;  4NN6 A;  4PS4 A;  4YQX A;  1ITM A;  1EVS A;  1HUL A;  4A3M D;  3HOW D;  1JLI A;  3N0P A;  4A3L D;  4RS1 A;  3LB6 B;  3DGC L;  5C3E D;  4A3K D;  5FHX A;  1V7N V;  4DKF A;  1PGR A;  5IP7 D;  5A2N A;  1D9C A;  2Q98 A;  2JA6 D;  1PY2 A;  5IYC D;  1EKU A;  2ERJ D;  4Q65 A;  1IL6 A;  4ZYR A;  3O7Q A;  1RCB A;  5D59 A;  4YDY I;  1M47 A;  1SCF A;  2CFP A;  2Y5Y A;  3H0G D;  4U4W A;  5IP9 D;  4LEP A;  1FG9 A;  1D9G A;  4BXX D;  1HWH A;  1GA3 A;  3HHC A;  3QB7 A;  4LRL A;  4J4L C;  4JR9 A;  4D2B A;  2Z3Q A;  3QB1 A;  2XUT A;  1BP3 A;  1CD9 A;  3HHR A;  3HOV D;  5KNH I;  5A2O A;  4GC0 A;  3HOZ D;  3BPO A;  4DKE A; 
#chains in the Genus database with same CATH homology
 4WRL B;  3FKI D;  3PO3 D;  3QWR B;  1BCN A;  2O26 A;  1NBP A;  2B5I A;  4YUE C;  5IYD D;  3INK C;  1IAR A;  1BGD A;  3LB6 A;  3D87 A;  3D85 C;  3UF2 A;  1LKI A;  1ALU A;  4O6K A;  4A3F D;  4NKQ C;  3AYH A;  1Z92 A;  5C7X A;  4NN6 A;  4PS4 A;  3UEZ E;  2B91 A;  3L5X A;  3NCF A;  4YQX A;  3WCY I;  1ITM A;  1EVS A;  4A3J D;  4GS7 A;  3SE3 B;  3S9D A;  1HUL A;  4A3M D;  3HOW D;  1WCM D;  1Y1V D;  1JLI A;  1PW6 A;  1VLK A;  1Y14 A;  3N0P A;  4NEJ A;  3IRH A;  1M4A A;  3HOU D;  4O9H A;  5D71 A;  4BY7 D;  3SE4 B;  1HIK A;  2O27 A;  1CYL A;  4DKC A;  5C44 D;  4A3L D;  3UF5 A;  1GNC A;  4ZF7 A;  2CYK A;  2B63 D;  1RHG A;  2C35 A;  3LB6 B;  3OG4 A;  3DGC L;  3MZG A;  4RS1 A;  4X51 A;  2Q14 A;  3NPZ A;  5C3E D;  1CNT 1;  2OQP A;  4A3K D;  3TGX B;  3H3V E;  1AX8 A;  1V7N V;  2HYM B;  2GMF A;  1HGU A;  5FHX A;  4NN5 A;  4DKF A;  1BGC A;  1Y6N L;  3HOY D;  1FYH A;  1PGR A;  5D28 B;  1IJZ A;  1V7M V;  2LMS A;  3PIW A;  5IP7 D;  3N06 A;  1D9C A;  1M4R A;  1HWG A;  2Q98 A;  2JA6 D;  4A3C D;  4BBS D;  1PY2 A;  5LQB A;  4I77 Z;  1ILK A;  2B8Z A;  5IYC D;  3PIV A;  3I4N D;  1EKU A;  2JA7 D;  5TS9 A;  2ERJ D;  4A3E D;  1IL6 A;  1CSG A;  1RCB A;  3EJJ A;  2B8X A;  1QVN A;  2E9W C;  2ILK A;  4YDY I;  3HOX D;  4A3D D;  1M47 A;  1SCF A;  4BY1 D;  3BPL A;  1KF9 A;  1A22 A;  3D48 P;  1ITL A;  4MHL A;  3H0G D;  5L6Y C;  2B8Y A;  1LK3 A;  2INT A;  5FUC A;  1ETE A;  1M49 A;  2B90 A;  1M4B A;  2L3Y A;  2H24 A;  2O6I A;  1M48 A;  2JA8 D;  5IYB D;  2R93 D;  2VUM D;  1HUW A;  1AU1 A;  3BES L;  3OG6 A;  5IP9 D;  1YKB A;  1HZI A;  1Y6M L;  4DOH A;  3I4M D;  1FG9 A;  1CN4 C;  5FLM D;  1Y1W D;  1IK0 A;  5D72 A;  3DI3 A;  1D9G A;  1EMR A;  3NCC A;  3QT2 C;  4A93 D;  1HWH A;  2Q7N B;  2XQB A;  4BXX D;  3OQ3 A;  4BBR D;  4NN7 A;  4CNI C;  1GA3 A;  1F6F A;  3HHC A;  1BUY A;  3DI2 A;  1I1R B;  4DKE A;  1EER A;  2L3O A;  3QB7 A;  4LRL A;  4J4L C;  3UX9 A;  2JA5 D;  4EXN A;  1N1F A;  1M4C A;  2D9Q A;  4FA8 E;  2R7Z D;  1ITF A;  1PVH B;  4EXP A;  2Z3Q A;  3EW3 A;  3L5W I;  3QB1 A;  4NI7 A;  1AXI A;  1P9M B;  2R92 D;  1RW5 A;  3PO2 D;  3HMX B;  1B5L A;  2B8U A;  1EXZ A;  3G9V B;  4Z5R D;  1HIJ A;  5D70 A;  3B5K A;  3DUH C;  1WU3 I;  1BGE A;  1BP3 A;  5E4E A;  1INR A;  3G6D A;  4ZS7 A;  4DKD A;  1IRL A;  1CD9 A;  4A3I D;  4NI9 A;  1Z7C A;  3HHR A;  3HOV D;  3VA2 A;  5C4X D;  2Z3R A;  5D22 A;  3NCB A;  4NEM A;  4A3B D;  2PSM A;  3BPN A;  4A3G D;  1BBN A;  1F45 B;  2LAG A;  5KNH I;  3NCE A;  3Q1S I;  1A7M A;  3HOZ D;  2D48 A;  3BPO A;  1RFB A;  1Y6K L;  1J7V L;  3DLQ I;  1ITI A;  1LQS L;  3QAZ A;  2IL6 A;  4GRW A;  4YPG C;  2KZ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...