1CD9A

2:2 complex of g-csf with its receptor
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
171
structure length
171
Chain Sequence
GPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic structure of the GCSF-receptor complex showing a new cytokine-receptor recognition scheme.
pubmed doi rcsb
molecule keywords PROTEIN (GRANULOCYTE COLONY-STIMULATING FACTOR)
molecule tags Cytokine
source organism Homo sapiens
total genus 57
structure length 171
sequence length 171
chains with identical sequence C
ec nomenclature
pdb deposition date 1999-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16647 GCSF Granulocyte colony-stimulating factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1250.10 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; Growth Hormone; Chain: A; 1cd9A00
2E9WC 1P9MB 4ZS7A 1Z7CA 3UEZE 1CN4C 4WRLB 1BBNA 1RHGA 3HMXB 4NEJA 1JLIA 1A7MA 2IL6A 2B8ZA 3BPLA 4I77Z 1HWHA 1M4CA 1J7VL 3D87A 1VLKA 4O6KA 3LB6A 1RFBA 3DGCL 4NI7A 1ITFA 1GNCA 4ZF7A 1CSGA 2CYKA 3DLQI 1M4AA 1A22A 1LK3A 1M48A 3WCYI 5FHXA 1ITLA 1D9GA 1BGEA 2Q98A 1HIJA 2L3YA 5D22A 1FYHA 3QAZA 1AXIA 3SE4B 3Q1SI 4NEMA 1Z92A 3QWRB 2Q7NB 2L3OA 2LMSA 4MHLA 3UF2A 3D85C 3G6DA 1PW6A 5L6YC 3G9VB 2O27A 3QB7A 1BGCA 3VA2A 2B8YA 3DUHC 3S9DA 3OQ3A 1CNT1 1IARA 2LAGA 3N06A 1BGDA 2ILKA 1I1RB 1Y6ML 1EVSA 1ITIA 3MZGA 3NPZA 3BPOA 1Y6KL 1FG9A 3EJJA 1WU3I 1N1FA 1ETEA 1M4BA 1HGUA 1CYLA 1HWGA 2B8UA 1V7MV 3UX9A 1YKBA 4J4LC 4YQXA 1GA3A 1CD9A 3NCEA 1LQSL 3NCCA 4CNIC 4YDYI 4X51A 1HULA 2INTA 5D70A 5D28B 2D9QA 1IRLA 3SE3B 3N0PA 1PY2A 2B90A 1RCBA 3INKC 5LQBA 1EERA 1EMRA 1NBPA 1BP3A 4GRWA 1HZIA 3B5KA 4Z5RD 4DOHA 3QB1A 5D72A 2H24A 1BCNA 1HUWA 1EXZA 2ERJD 3UF5A 1AU1A 1KF9A 3EW3A 2D48A 1BUYA 1ALUA 1F45B 3NCBA 2B5IA 3NCFA 3D48P 1M4RA 1SCFA 3PIVA 5FUCA 1B5LA 1IK0A 1IL6A 2B8XA 3BESL 2GMFA 3PIWA 4O9HA 1PVHB 1RW5A 1HIKA 4YUEC 1INRA 1PGRA 4NKQC 1F6FA 4PS4A 1EKUA 4FA8E 3BPNA 2KZ1A 3L5WI 4YPGC 4NI9A 2HYMB 1LKIA 5C7XA 4RS1A 3HHRA 5E4EA 1D9CA 1QVNA 1ITMA 1Y6NL 3QT2C 1ILKA 1V7NV 3LB6B 1IJZA 2O26A 5D71A 1AX8A 5KNHI 1M49A 2B91A 3L5XA 1M47A
chains in the Genus database with same CATH superfamily
1Z7CA 4WRLB 1BBNA 4NI7A 4U4VA 4ZF7A 4A3JD 3DLQI 4A3LD 3AYHA 3WCYI 2JA8D 5FHXA 1ITLA 1D9GA 4GBYA 1WCMD 2L3YA 1FYHA 3QAZA 1AXIA 3Q1SI 4NEMA 3UF2A 3OQ3A 1IARA 1BGDA 4D2DA 5C3ED 3TGXB 3BPOA 1WU3I 4ZWCA 4W6VA 2B8UA 4YQXA 1CD9A 3NCEA 4CNIC 5EQGA 1HULA 2INTA 4GS7A 5D70A 4XNIA 1EMRA 4BY7D 1BP3A 4OH3A 5D72A 4IKVA 1HUWA 3O7PA 1KF9A 1PV7A 3EW3A 1BUYA 1F45B 1SCFA 3H0GD 1IK0A 2B8XA 4DKFA 1RW5A 3PO2D 4YUEC 1PGRA 1F6FA 1EKUA 3OG6A 4BBSD 4NN7A 1LKIA 4PYPA 1Y6NL 1V7NV 1M49A 4Q65A 5TS9A 1M47A 2E9WC 1CN4C 3HOWD 1RHGA 4IU8A 4NEJA 1JLIA 1HWHA 1M4CA 4O6KA 4BBRD 3O7QA 4DKEA 2Q98A 4TPJA 4A3DD 4LRLA 1Z92A 2LMSA 5A2NA 1PW6A 5L6YC 3G9VB 2O27A 2B8YA 5FLMD 2VUMD 1CNT1 2LAGA 3HOVD 2ILKA 1EVSA 3HOZD 4YB9D 3HOXD 4D2CA 1ETEA 2XQBA 5C4XD 1YKBA 3PO3D 3NCCA 2CFQA 3I4MD 3SE3B 1PY2A 4QIQA 1NBPA 4GRWA 1HZIA 4Z5RD 4DOHA 4NN6A 5D58A 3HHCA 2H24A 1BCNA 2ERJD 5C44D 4LDSA 1AU1A 2D48A 3H3VE 3NCFA 3DI3A 4DKCA 1IL6A 4O9HA 3PIWA 2JA7D 2Z3RA 4BXXD 2Y5YA 4A3ED 2KZ1A 4ZWBA 5C7XA 3HHRA 4IKZA 1ITMA 2B63D 4A3ID 2Q14A 5KNHI 4U4TA 4GC0A 1P9MB 4ZS7A 3UEZE 5IYCD 1A7MA 3BPLA 4IKYA 1J7VL 1VLKA 1GNCA 1RFBA 3DGCL 1CSGA 2CYKA 1A22A 1M48A 2Z3QA 4IKXA 5D22A 2V8NA 2Q7NB 4XNJA 3D85C 3G6DA 3QB7A 1BGCA 3DUHC 5D6KA 4A3KD 5IYBD 4A3BD 2R93D 4UVMA 1Y6ML 1ITIA 5IP7D 3MZGA 2OQPA 1FG9A 4OAAA 5D59A 1N1FA 1HGUA 1CYLA 1HWGA 1Y1VD 2JA6D 4YDYI 2D9QA 2B90A 5A2OA 1RCBA 5LQBA 1EERA 1PV6A 3QB1A 4IU9A 1EXZA 4A93D 5EQHA 3UF5A 1ALUA 3NCBA 2B5IA 5FUCA 1PVHB 1INRA 4NKQC 3BPNA 3L5WI 2PSMA 3HOUD 3QT2C 1ILKA 4DKDA 4A3FD 4A3CD 2B91A 3HMXB 2IL6A 2B8ZA 2XUTA 4I77Z 4TPHA 3D87A 2JA5D 3LB6A 1ITFA 2O6IA 1M4AA 1LK3A 1BGEA 1HIJA 3SE4B 5EQIA 3QWRB 2L3OA 1PW4A 4MHLA 5C65A 5IP9D 4YBQA 5IYDD 3VA2A 2CFPA 3IRHA 4EXPA 3S9DA 3N06A 1I1RB 4JREA 5GXBA 3I4ND 3NPZA 1Y6KL 4A3GD 3EJJA 1Y14A 4ZW9A 1M4BA 3OG4A 3FKID 4D2BA 1V7MV 4A3MD 1Y1WD 3UX9A 4J4LC 1GA3A 4BY1D 1LQSL 4X51A 5D28B 1IRLA 3N0PA 3WDOA 3INKC 3B5KA 2R92D 2C35A 4GBZA 3D48P 1M4RA 3PIVA 1B5LA 4TPGA 4APSA 3BESL 2GMFA 1HIKA 4PS4A 4FA8E 4ZYRA 2R7ZD 4EXNA 3DI2A 4YPGC 4NI9A 2HYMB 4RS1A 5E4EA 1D9CA 1QVNA 4NN5A 4LEPA 3LB6B 3HOYD 1IJZA 2O26A 4U4WA 4JR9A 5D71A 1AX8A 3L5XA 4IKWA 4JA3A 4J05A
chains in the Genus database with same CATH topology
2E9WC 1P9MB 4ZS7A 1Z7CA 3UEZE 1CN4C 4WRLB 1BBNA 1RHGA 3HMXB 4NEJA 5IYCD 1JLIA 3HOWD 2IL6A 1A7MA 2B8ZA 3BPLA 4I77Z 1HWHA 1M4CA 1J7VL 3D87A 1VLKA 4O6KA 3LB6A 1RFBA 3DGCL 4NI7A 2JA5D 1ITFA 1GNCA 4ZF7A 1CSGA 4A3JD 4BBRD 2CYKA 3DLQI 2O6IA 4A3LD 2JA8D 3AYHA 1M4AA 1A22A 1LK3A 1M48A 2Z3QA 3WCYI 5FHXA 1ITLA 1D9GA 4DKEA 1BGEA 2Q98A 1HIJA 1WCMD 2L3YA 5D22A 4A3DD 1FYHA 3QAZA 1AXIA 4LRLA 3SE4B 3Q1SI 4NEMA 1Z92A 3QWRB 2Q7NB 2L3OA 2LMSA 4MHLA 3UF2A 3D85C 3G6DA 5IP9D 1PW6A 5L6YC 3G9VB 5IYDD 2O27A 3QB7A 1BGCA 3VA2A 2B8YA 3DUHC 3IRHA 4EXPA 3S9DA 5FLMD 4A3KD 2VUMD 3OQ3A 5IYBD 1CNT1 1IARA 2LAGA 3N06A 3HOVD 1BGDA 2ILKA 4A3BD 2R93D 1I1RB 1Y6ML 1EVSA 3HOZD 1ITIA 5IP7D 5C3ED 3I4ND 3MZGA 3HOXD 3NPZA 3TGXB 2OQPA 3BPOA 1Y6KL 1FG9A 4A3GD 3EJJA 1WU3I 1N1FA 1ETEA 1M4BA 1Y14A 1HGUA 1CYLA 3OG4A 3FKID 1HWGA 2XQBA 2B8UA 5C4XD 1V7MV 4A3MD 1Y1WD 1Y1VD 1YKBA 4J4LC 4YQXA 3UX9A 1CD9A 4BY1D 3PO3D 1GA3A 3NCEA 1LQSL 3NCCA 4CNIC 2JA6D 4YDYI 4X51A 1HULA 2INTA 4GS7A 5D28B 2D9QA 5D70A 3I4MD 1IRLA 3SE3B 3N0PA 1PY2A 2B90A 1RCBA 3INKC 5LQBA 1EERA 1EMRA 4BY7D 1NBPA 1BP3A 4GRWA 1HZIA 3B5KA 2R92D 4Z5RD 4DOHA 4NN6A 3QB1A 5D72A 2C35A 3HHCA 2H24A 1BCNA 1HUWA 1EXZA 2ERJD 5C44D 4A93D 3UF5A 1AU1A 1KF9A 3EW3A 2D48A 3H3VE 1BUYA 1ALUA 1F45B 3NCBA 2B5IA 3NCFA 3D48P 1M4RA 1SCFA 3DI3A 3PIVA 5FUCA 1B5LA 3H0GD 4DKCA 1IK0A 1IL6A 2B8XA 3BESL 2GMFA 3PIWA 4O9HA 1PVHB 1RW5A 4DKFA 2JA7D 3PO2D 1HIKA 4YUEC 1INRA 1PGRA 2Z3RA 1F6FA 4NKQC 4PS4A 1EKUA 4FA8E 3OG6A 4BXXD 3BPNA 4A3ED 2R7ZD 2KZ1A 3L5WI 4BBSD 4EXNA 3DI2A 4NN7A 2PSMA 4YPGC 4NI9A 3HOUD 2HYMB 1LKIA 5C7XA 4RS1A 3HHRA 5E4EA 1D9CA 1QVNA 1ITMA 1Y6NL 4NN5A 3QT2C 1ILKA 4DKDA 4A3FD 1V7NV 4A3ID 2B63D 4A3CD 3LB6B 2Q14A 3HOYD 1IJZA 2O26A 5D71A 1AX8A 5KNHI 1M49A 2B91A 3L5XA 5TS9A 1M47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E9W C;  1P9M B;  4ZS7 A;  1Z7C A;  3UEZ E;  1CN4 C;  4WRL B;  1BBN A;  1RHG A;  3HMX B;  4NEJ A;  1JLI A;  1A7M A;  2IL6 A;  2B8Z A;  3BPL A;  4I77 Z;  1HWH A;  1M4C A;  1J7V L;  3D87 A;  1VLK A;  4O6K A;  3LB6 A;  1RFB A;  3DGC L;  4NI7 A;  1ITF A;  1GNC A;  4ZF7 A;  1CSG A;  2CYK A;  3DLQ I;  1M4A A;  1A22 A;  1LK3 A;  1M48 A;  3WCY I;  5FHX A;  1ITL A;  1D9G A;  1BGE A;  2Q98 A;  1HIJ A;  2L3Y A;  5D22 A;  1FYH A;  3QAZ A;  1AXI A;  3SE4 B;  3Q1S I;  4NEM A;  1Z92 A;  3QWR B;  2Q7N B;  2L3O A;  2LMS A;  4MHL A;  3UF2 A;  3D85 C;  3G6D A;  1PW6 A;  5L6Y C;  3G9V B;  2O27 A;  3QB7 A;  1BGC A;  3VA2 A;  2B8Y A;  3DUH C;  3S9D A;  3OQ3 A;  1CNT 1;  1IAR A;  2LAG A;  3N06 A;  1BGD A;  2ILK A;  1I1R B;  1Y6M L;  1EVS A;  1ITI A;  3MZG A;  3NPZ A;  3BPO A;  1Y6K L;  1FG9 A;  3EJJ A;  1WU3 I;  1N1F A;  1ETE A;  1M4B A;  1HGU A;  1CYL A;  1HWG A;  2B8U A;  1V7M V;  3UX9 A;  1YKB A;  4J4L C;  4YQX A;  1GA3 A;  1CD9 A;  3NCE A;  1LQS L;  3NCC A;  4CNI C;  4YDY I;  4X51 A;  1HUL A;  2INT A;  5D70 A;  5D28 B;  2D9Q A;  1IRL A;  3SE3 B;  3N0P A;  1PY2 A;  2B90 A;  1RCB A;  3INK C;  5LQB A;  1EER A;  1EMR A;  1NBP A;  1BP3 A;  4GRW A;  1HZI A;  3B5K A;  4Z5R D;  4DOH A;  3QB1 A;  5D72 A;  2H24 A;  1BCN A;  1HUW A;  1EXZ A;  2ERJ D;  3UF5 A;  1AU1 A;  1KF9 A;  3EW3 A;  2D48 A;  1BUY A;  1ALU A;  1F45 B;  3NCB A;  2B5I A;  3NCF A;  3D48 P;  1M4R A;  1SCF A;  3PIV A;  5FUC A;  1B5L A;  1IK0 A;  1IL6 A;  2B8X A;  3BES L;  2GMF A;  3PIW A;  4O9H A;  1PVH B;  1RW5 A;  1HIK A;  4YUE C;  1INR A;  1PGR A;  4NKQ C;  1F6F A;  4PS4 A;  1EKU A;  4FA8 E;  3BPN A;  2KZ1 A;  3L5W I;  4YPG C;  4NI9 A;  2HYM B;  1LKI A;  5C7X A;  4RS1 A;  3HHR A;  5E4E A;  1D9C A;  1QVN A;  1ITM A;  1Y6N L;  3QT2 C;  1ILK A;  1V7N V;  3LB6 B;  1IJZ A;  2O26 A;  5D71 A;  1AX8 A;  5KNH I;  1M49 A;  2B91 A;  3L5X A;  1M47 A; 
#chains in the Genus database with same CATH topology
 1Z7C A;  4WRL B;  1BBN A;  4NI7 A;  4U4V A;  4ZF7 A;  4A3J D;  3DLQ I;  4A3L D;  3AYH A;  3WCY I;  2JA8 D;  5FHX A;  1ITL A;  1D9G A;  4GBY A;  1WCM D;  2L3Y A;  1FYH A;  3QAZ A;  1AXI A;  3Q1S I;  4NEM A;  3UF2 A;  3OQ3 A;  1IAR A;  1BGD A;  4D2D A;  5C3E D;  3TGX B;  3BPO A;  1WU3 I;  4ZWC A;  4W6V A;  2B8U A;  4YQX A;  1CD9 A;  3NCE A;  4CNI C;  5EQG A;  1HUL A;  2INT A;  4GS7 A;  5D70 A;  4XNI A;  1EMR A;  4BY7 D;  1BP3 A;  4OH3 A;  5D72 A;  4IKV A;  1HUW A;  3O7P A;  1KF9 A;  1PV7 A;  3EW3 A;  1BUY A;  1F45 B;  1SCF A;  3H0G D;  1IK0 A;  2B8X A;  4DKF A;  1RW5 A;  3PO2 D;  4YUE C;  1PGR A;  1F6F A;  1EKU A;  3OG6 A;  4BBS D;  4NN7 A;  1LKI A;  4PYP A;  1Y6N L;  1V7N V;  1M49 A;  4Q65 A;  5TS9 A;  1M47 A;  2E9W C;  1CN4 C;  3HOW D;  1RHG A;  4IU8 A;  4NEJ A;  1JLI A;  1HWH A;  1M4C A;  4O6K A;  4BBR D;  3O7Q A;  4DKE A;  2Q98 A;  4TPJ A;  4A3D D;  4LRL A;  1Z92 A;  2LMS A;  5A2N A;  1PW6 A;  5L6Y C;  3G9V B;  2O27 A;  2B8Y A;  5FLM D;  2VUM D;  1CNT 1;  2LAG A;  3HOV D;  2ILK A;  1EVS A;  3HOZ D;  4YB9 D;  3HOX D;  4D2C A;  1ETE A;  2XQB A;  5C4X D;  1YKB A;  3PO3 D;  3NCC A;  2CFQ A;  3I4M D;  3SE3 B;  1PY2 A;  4QIQ A;  1NBP A;  4GRW A;  1HZI A;  4Z5R D;  4DOH A;  4NN6 A;  5D58 A;  3HHC A;  2H24 A;  1BCN A;  2ERJ D;  5C44 D;  4LDS A;  1AU1 A;  2D48 A;  3H3V E;  3NCF A;  3DI3 A;  4DKC A;  1IL6 A;  4O9H A;  3PIW A;  2JA7 D;  2Z3R A;  4BXX D;  2Y5Y A;  4A3E D;  2KZ1 A;  4ZWB A;  5C7X A;  3HHR A;  4IKZ A;  1ITM A;  2B63 D;  4A3I D;  2Q14 A;  5KNH I;  4U4T A;  4GC0 A;  1P9M B;  4ZS7 A;  3UEZ E;  5IYC D;  1A7M A;  3BPL A;  4IKY A;  1J7V L;  1VLK A;  1GNC A;  1RFB A;  3DGC L;  1CSG A;  2CYK A;  1A22 A;  1M48 A;  2Z3Q A;  4IKX A;  5D22 A;  2V8N A;  2Q7N B;  4XNJ A;  3D85 C;  3G6D A;  3QB7 A;  1BGC A;  3DUH C;  5D6K A;  4A3K D;  5IYB D;  4A3B D;  2R93 D;  4UVM A;  1Y6M L;  1ITI A;  5IP7 D;  3MZG A;  2OQP A;  1FG9 A;  4OAA A;  5D59 A;  1N1F A;  1HGU A;  1CYL A;  1HWG A;  1Y1V D;  2JA6 D;  4YDY I;  2D9Q A;  2B90 A;  5A2O A;  1RCB A;  5LQB A;  1EER A;  1PV6 A;  3QB1 A;  4IU9 A;  1EXZ A;  4A93 D;  5EQH A;  3UF5 A;  1ALU A;  3NCB A;  2B5I A;  5FUC A;  1PVH B;  1INR A;  4NKQ C;  3BPN A;  3L5W I;  2PSM A;  3HOU D;  3QT2 C;  1ILK A;  4DKD A;  4A3F D;  4A3C D;  2B91 A;  3HMX B;  2IL6 A;  2B8Z A;  2XUT A;  4I77 Z;  4TPH A;  3D87 A;  2JA5 D;  3LB6 A;  1ITF A;  2O6I A;  1M4A A;  1LK3 A;  1BGE A;  1HIJ A;  3SE4 B;  5EQI A;  3QWR B;  2L3O A;  1PW4 A;  4MHL A;  5C65 A;  5IP9 D;  4YBQ A;  5IYD D;  3VA2 A;  2CFP A;  3IRH A;  4EXP A;  3S9D A;  3N06 A;  1I1R B;  4JRE A;  5GXB A;  3I4N D;  3NPZ A;  1Y6K L;  4A3G D;  3EJJ A;  1Y14 A;  4ZW9 A;  1M4B A;  3OG4 A;  3FKI D;  4D2B A;  1V7M V;  4A3M D;  1Y1W D;  3UX9 A;  4J4L C;  1GA3 A;  4BY1 D;  1LQS L;  4X51 A;  5D28 B;  1IRL A;  3N0P A;  3WDO A;  3INK C;  3B5K A;  2R92 D;  2C35 A;  4GBZ A;  3D48 P;  1M4R A;  3PIV A;  1B5L A;  4TPG A;  4APS A;  3BES L;  2GMF A;  1HIK A;  4PS4 A;  4FA8 E;  4ZYR A;  2R7Z D;  4EXN A;  3DI2 A;  4YPG C;  4NI9 A;  2HYM B;  4RS1 A;  5E4E A;  1D9C A;  1QVN A;  4NN5 A;  4LEP A;  3LB6 B;  3HOY D;  1IJZ A;  2O26 A;  4U4W A;  4JR9 A;  5D71 A;  1AX8 A;  3L5X A;  4IKW A;  4JA3 A;  4J05 A; 
#chains in the Genus database with same CATH homology
 2E9W C;  1P9M B;  4ZS7 A;  1Z7C A;  3UEZ E;  1CN4 C;  4WRL B;  1BBN A;  1RHG A;  3HMX B;  4NEJ A;  5IYC D;  1JLI A;  3HOW D;  2IL6 A;  1A7M A;  2B8Z A;  3BPL A;  4I77 Z;  1HWH A;  1M4C A;  1J7V L;  3D87 A;  1VLK A;  4O6K A;  3LB6 A;  1RFB A;  3DGC L;  4NI7 A;  2JA5 D;  1ITF A;  1GNC A;  4ZF7 A;  1CSG A;  4A3J D;  4BBR D;  2CYK A;  3DLQ I;  2O6I A;  4A3L D;  2JA8 D;  3AYH A;  1M4A A;  1A22 A;  1LK3 A;  1M48 A;  2Z3Q A;  3WCY I;  5FHX A;  1ITL A;  1D9G A;  4DKE A;  1BGE A;  2Q98 A;  1HIJ A;  1WCM D;  2L3Y A;  5D22 A;  4A3D D;  1FYH A;  3QAZ A;  1AXI A;  4LRL A;  3SE4 B;  3Q1S I;  4NEM A;  1Z92 A;  3QWR B;  2Q7N B;  2L3O A;  2LMS A;  4MHL A;  3UF2 A;  3D85 C;  3G6D A;  5IP9 D;  1PW6 A;  5L6Y C;  3G9V B;  5IYD D;  2O27 A;  3QB7 A;  1BGC A;  3VA2 A;  2B8Y A;  3DUH C;  3IRH A;  4EXP A;  3S9D A;  5FLM D;  4A3K D;  2VUM D;  3OQ3 A;  5IYB D;  1CNT 1;  1IAR A;  2LAG A;  3N06 A;  3HOV D;  1BGD A;  2ILK A;  4A3B D;  2R93 D;  1I1R B;  1Y6M L;  1EVS A;  3HOZ D;  1ITI A;  5IP7 D;  5C3E D;  3I4N D;  3MZG A;  3HOX D;  3NPZ A;  3TGX B;  2OQP A;  3BPO A;  1Y6K L;  1FG9 A;  4A3G D;  3EJJ A;  1WU3 I;  1N1F A;  1ETE A;  1M4B A;  1Y14 A;  1HGU A;  1CYL A;  3OG4 A;  3FKI D;  1HWG A;  2XQB A;  2B8U A;  5C4X D;  1V7M V;  4A3M D;  1Y1W D;  1Y1V D;  1YKB A;  4J4L C;  4YQX A;  3UX9 A;  1CD9 A;  4BY1 D;  3PO3 D;  1GA3 A;  3NCE A;  1LQS L;  3NCC A;  4CNI C;  2JA6 D;  4YDY I;  4X51 A;  1HUL A;  2INT A;  4GS7 A;  5D28 B;  2D9Q A;  5D70 A;  3I4M D;  1IRL A;  3SE3 B;  3N0P A;  1PY2 A;  2B90 A;  1RCB A;  3INK C;  5LQB A;  1EER A;  1EMR A;  4BY7 D;  1NBP A;  1BP3 A;  4GRW A;  1HZI A;  3B5K A;  2R92 D;  4Z5R D;  4DOH A;  4NN6 A;  3QB1 A;  5D72 A;  2C35 A;  3HHC A;  2H24 A;  1BCN A;  1HUW A;  1EXZ A;  2ERJ D;  5C44 D;  4A93 D;  3UF5 A;  1AU1 A;  1KF9 A;  3EW3 A;  2D48 A;  3H3V E;  1BUY A;  1ALU A;  1F45 B;  3NCB A;  2B5I A;  3NCF A;  3D48 P;  1M4R A;  1SCF A;  3DI3 A;  3PIV A;  5FUC A;  1B5L A;  3H0G D;  4DKC A;  1IK0 A;  1IL6 A;  2B8X A;  3BES L;  2GMF A;  3PIW A;  4O9H A;  1PVH B;  1RW5 A;  4DKF A;  2JA7 D;  3PO2 D;  1HIK A;  4YUE C;  1INR A;  1PGR A;  2Z3R A;  1F6F A;  4NKQ C;  4PS4 A;  1EKU A;  4FA8 E;  3OG6 A;  4BXX D;  3BPN A;  4A3E D;  2R7Z D;  2KZ1 A;  3L5W I;  4BBS D;  4EXN A;  3DI2 A;  4NN7 A;  2PSM A;  4YPG C;  4NI9 A;  3HOU D;  2HYM B;  1LKI A;  5C7X A;  4RS1 A;  3HHR A;  5E4E A;  1D9C A;  1QVN A;  1ITM A;  1Y6N L;  4NN5 A;  3QT2 C;  1ILK A;  4DKD A;  4A3F D;  1V7N V;  4A3I D;  2B63 D;  4A3C D;  3LB6 B;  2Q14 A;  3HOY D;  1IJZ A;  2O26 A;  5D71 A;  1AX8 A;  5KNH I;  1M49 A;  2B91 A;  3L5X A;  5TS9 A;  1M47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...