3L5XA

Crystal structure of the complex between il-13 and h2l6 fab
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
105
structure length
101
Chain Sequence
STALRELIEELVNITQPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human framework adaptation of a mouse anti-human IL-13 antibody.
pubmed doi rcsb
molecule keywords H2L6 LIGHT CHAIN
molecule tags Immune system
source organism Homo sapiens
total genus 26
structure length 101
sequence length 105
ec nomenclature
pdb deposition date 2009-12-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1250.10 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; Growth Hormone; Chain: A; 3l5xA00
3SE4B 2B8ZA 2KZ1A 1LKIA 1ITMA 3NCBA 3QAZA 1HUWA 3N06A 2B5IA 3DUHC 3LB6B 3EJJA 1ITLA 1LQSL 2D9QA 5D22A 2Q7NB 1GA3A 1CN4C 3PIWA 3UEZE 3HHRA 5E4EA 3DGCL 3BESL 5D70A 4I77Z 1ALUA 1KF9A 3L5WI 4NEJA 1JLIA 4X51A 4DOHA 1WU3I 5KNHI 1IJZA 1D9GA 1HULA 5FUCA 2HYMB 1IK0A 1ETEA 1Y6KL 1AXIA 3DLQI 1CSGA 3G9VB 2B8YA 1PY2A 4MHLA 3WCYI 1GNCA 4NEMA 1N1FA 1NBPA 4Z5RD 1P9MB 2IL6A 2LMSA 3BPNA 1A22A 1EERA 1IARA 1PGRA 2E9WC 3L5XA 1M48A 1HIJA 3UX9A 1ITFA 1I1RB 1M47A 3HMXB 4NI7A 1VLKA 2CYKA 4FA8E 3B5KA 3BPLA 1D9CA 2D48A 4O6KA 4YUEC 4GRWA 1RFBA 5D28B 1F6FA 1FYHA 1HGUA 3QWRB 4NKQC 1EXZA 5D72A 1BCNA 1CD9A 4J4LC 5L6YC 1ITIA 1EMRA 2B8UA 1RHGA 2INTA 3Q1SI 3D87A 1F45B 1BUYA 3MZGA 1BP3A 3S9DA 1HIKA 1PW6A 1FG9A 1Y6NL 1CNT1 1RCBA 3VA2A 1EKUA 2ILKA 5LQBA 4RS1A 2L3OA 5C7XA 2B91A 3G6DA 2B8XA 1PVHB 1Z92A 3N0PA 3NCFA 3NCEA 1HZIA 2GMFA 3QT2C 5D71A 4ZF7A 1QVNA 1INRA 2B90A 3EW3A 1Z7CA 1M4CA 1BBNA 4YPGC 1IL6A 1SCFA 2O26A 1M4RA 3NCCA 1M4BA 1B5LA 3QB1A 1CYLA 1YKBA 3SE3B 1AU1A 2O27A 1LK3A 1ILKA 3UF2A 2ERJD 1V7NV 1BGCA 3BPOA 4O9HA 1M49A 1Y6ML 4ZS7A 1BGEA 4CNIC 1HWHA 1RW5A 2LAGA 2Q98A 1HWGA 4NI9A 5FHXA 1M4AA 1A7MA 3QB7A 4YQXA 1IRLA 1V7MV 4YDYI 3LB6A 3NPZA 3OQ3A 2L3YA 3INKC 1AX8A 4PS4A 1J7VL 4WRLB 3D48P 1EVSA 2H24A 3D85C 3UF5A 3PIVA 1BGDA
chains in the Genus database with same CATH superfamily
2Q14A 1LKIA 3DI2A 1HUWA 1ITLA 4D2DA 1GA3A 4U4TA 3PIWA 3DGCL 3BESL 4GS7A 3TGXB 4I77Z 3AYHA 1JLIA 5FUCA 4GBZA 4ZWCA 1ETEA 1AXIA 1CSGA 2JA5D 2B8YA 1PY2A 4MHLA 3WCYI 4NEMA 3HOXD 1N1FA 2B63D 4DKFA 5C3ED 4Z5RD 2Y5YA 3IRHA 2LMSA 1A22A 1IARA 1PGRA 2OQPA 1ITFA 1HIJA 1I1RB 4NI7A 1VLKA 1Y1WD 4DKDA 4O6KA 2D48A 5D6KA 1F6FA 4A3LD 4NKQC 4A3FD 3HOZD 4J4LC 1ITIA 1Y1VD 2INTA 4W6VA 4OH3A 3MZGA 3S9DA 1Y6NL 1CNT1 1RCBA 4A3JD 5IP7D 4YB9D 5EQHA 1PVHB 3I4ND 2O6IA 4BBSD 1INRA 4A3GD 2R7ZD 3H3VE 1SCFA 3H0GD 1M4RA 5A2OA 1B5LA 3SE3B 3UF2A 2ERJD 4GBYA 4CNIC 5GXBA 3HHCA 4JREA 3QB7A 4YQXA 1IRLA 3NPZA 1J7VL 4TPHA 3UF5A 4ZYRA 2JA8D 3PIVA 1PV7A 3NCBA 3LB6B 3EJJA 2D9QA 1CN4C 3UEZE 3HHRA 4A3BD 1PV6A 3O7QA 4A3ED 1ALUA 1KF9A 3L5WI 4DOHA 1PW4A 5EQIA 4UVMA 4IKXA 1Y6KL 3HOYD 3G9VB 1GNCA 5FLMD 2IL6A 3BPNA 3L5XA 3O7PA 1M47A 4A3ID 4XNJA 3B5KA 3HOWD 4A3MD 1RFBA 2JA6D 3QWRB 1BCNA 1CD9A 5L6YC 1EMRA 4BY7D 2Z3QA 4IKWA 3Q1SI 4A3KD 4EXPA 1F45B 1BUYA 4YBQA 4ZWBA 1PW6A 1FG9A 5EQGA 3VA2A 1EKUA 5LQBA 4TPJA 5C7XA 5D71A 4ZF7A 3EW3A 1M4CA 3OG4A 1BBNA 4TPGA 1IL6A 1YKBA 1LK3A 4PYPA 4O9HA 1BGCA 1Y6ML 4EXNA 1HWHA 2Q98A 1HWGA 5FHXA 2JA7D 4D2CA 4LRLA 1A7MA 4IU8A 4U4VA 4BXXD 3LB6A 4Q65A 3I4MD 3INKC 3HOVD 3D48P 2H24A 3D85C 3SE4B 2Z3RA 3QAZA 3N06A 3FKID 1LQSL 5C4XD 5D22A 2Q7NB 5D70A 4NEJA 4X51A 1HULA 3DI3A 2C35A 2R92D 5A2NA 1P9MB 4ZS7A 1M48A 3HMXB 4FA8E 3BPLA 4GC0A 4GRWA 1FYHA 1HGUA 5D72A 4LEPA 2B8UA 4DKEA 3D87A 5IP9D 5IYBD 4OAAA 5C44D 5IYDD 2PSMA 4JA3A 2B8XA 4LDSA 1Z92A 3QT2C 3NCEA 1HZIA 2GMFA 2B90A 1Z7CA 5C65A 2R93D 3NCCA 2CFPA 1CYLA 1ILKA 1V7NV 1RW5A 2LAGA 4IU9A 5IYCD 5D59A 3OG6A 4IKYA 3PO3D 1V7MV 3OQ3A 2L3YA 1AX8A 4NN7A 4NN6A 4PS4A 2V8NA 4WRLB 1BGDA 2B8ZA 2KZ1A 1ITMA 2CFQA 2B5IA 3DUHC 4D2BA 5E4EA 5TS9A 4JR9A 1WU3I 5KNHI 3HOUD 4A3CD 1IJZA 1D9GA 4QIQA 2HYMB 1IK0A 3PO2D 3DLQI 1NBPA 4NN5A 2VUMD 1EERA 2E9WC 4A3DD 3UX9A 4APSA 2CYKA 4A93D 4J05A 1D9CA 4YUEC 5D28B 2XQBA 4IKZA 1EXZA 4U4WA 1RHGA 1BP3A 1HIKA 1WCMD 2ILKA 4RS1A 2L3OA 2B91A 3G6DA 3N0PA 3NCFA 4BBRD 4XNIA 1QVNA 4DKCA 4BY1D 4YPGC 2O26A 1M4BA 3QB1A 1AU1A 2O27A 3BPOA 1M49A 1BGEA 2XUTA 4NI9A 3WDOA 1M4AA 4IKVA 4YDYI 4ZW9A 5D58A 1Y14A 1EVSA
chains in the Genus database with same CATH topology
3SE4B 2B8ZA 2KZ1A 2Q14A 1LKIA 1ITMA 2Z3RA 3DI2A 3NCBA 3QAZA 1HUWA 3N06A 2B5IA 3DUHC 3LB6B 3EJJA 3FKID 1ITLA 1LQSL 5C4XD 2D9QA 5D22A 2Q7NB 1GA3A 1CN4C 3PIWA 3UEZE 3HHRA 5E4EA 5TS9A 3DGCL 3BESL 4A3BD 4GS7A 5D70A 3TGXB 4A3ED 4I77Z 1ALUA 1KF9A 3AYHA 3L5WI 4NEJA 1JLIA 4X51A 4DOHA 1WU3I 5KNHI 3HOUD 4A3CD 1IJZA 1D9GA 1HULA 5FUCA 2HYMB 1IK0A 1ETEA 3DI3A 1Y6KL 1AXIA 3PO2D 3HOYD 2C35A 3DLQI 1CSGA 2JA5D 3G9VB 2B8YA 1PY2A 4MHLA 3WCYI 1GNCA 4NEMA 3HOXD 1N1FA 2R92D 1NBPA 4DKFA 4NN5A 2B63D 5C3ED 2VUMD 4Z5RD 5FLMD 3IRHA 1P9MB 2IL6A 2LMSA 3BPNA 1A22A 1EERA 1IARA 1PGRA 2E9WC 2OQPA 1M48A 1HIJA 3L5XA 3UX9A 4A3DD 1ITFA 1I1RB 1M47A 3HMXB 4NI7A 1VLKA 2CYKA 4FA8E 4A3ID 4A93D 1Y1WD 3B5KA 3BPLA 3HOWD 4DKDA 1D9CA 2D48A 4O6KA 4YUEC 4A3MD 4GRWA 1RFBA 5D28B 1F6FA 4A3LD 2XQBA 1FYHA 2JA6D 1HGUA 3QWRB 4NKQC 4A3FD 1EXZA 5D72A 1BCNA 1CD9A 4J4LC 3HOZD 5L6YC 1ITIA 1EMRA 4BY7D 2Z3QA 1Y1VD 2B8UA 1RHGA 2INTA 3Q1SI 3D87A 4DKEA 5IP9D 4A3KD 4EXPA 1F45B 1BUYA 3MZGA 5IYBD 1BP3A 3S9DA 1HIKA 1PW6A 1FG9A 1Y6NL 1CNT1 5IYDD 5C44D 1RCBA 4A3JD 3VA2A 1EKUA 1WCMD 2ILKA 2PSMA 2L3OA 4RS1A 5LQBA 5IP7D 5C7XA 2B91A 3G6DA 2B8XA 1PVHB 1Z92A 3N0PA 3NCFA 3NCEA 1HZIA 2GMFA 3QT2C 5D71A 4BBRD 4ZF7A 1QVNA 2O6IA 3I4ND 4BBSD 1INRA 2B90A 3EW3A 4A3GD 1Z7CA 4DKCA 4BY1D 2R7ZD 1M4CA 3OG4A 3H3VE 1BBNA 2R93D 4YPGC 1IL6A 1SCFA 2O26A 3H0GD 1M4RA 3NCCA 1M4BA 1B5LA 3QB1A 1CYLA 1YKBA 3SE3B 1AU1A 2O27A 1LK3A 1ILKA 3UF2A 2ERJD 1V7NV 1BGCA 3BPOA 4O9HA 1M49A 1Y6ML 4ZS7A 1BGEA 4CNIC 4EXNA 1HWHA 1RW5A 2LAGA 2Q98A 1HWGA 5IYCD 5FHXA 4NI9A 1M4AA 2JA7D 4LRLA 3HHCA 3OG6A 1A7MA 3QB7A 4YQXA 1IRLA 3PO3D 1V7MV 4BXXD 4YDYI 3LB6A 3I4MD 3NPZA 3OQ3A 2L3YA 3INKC 1AX8A 4NN7A 1Y14A 4NN6A 1J7VL 4PS4A 4WRLB 3D48P 1EVSA 2H24A 3D85C 3UF5A 3HOVD 2JA8D 3PIVA 1BGDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SE4 B;  2B8Z A;  2KZ1 A;  1LKI A;  1ITM A;  3NCB A;  3QAZ A;  1HUW A;  3N06 A;  2B5I A;  3DUH C;  3LB6 B;  3EJJ A;  1ITL A;  1LQS L;  2D9Q A;  5D22 A;  2Q7N B;  1GA3 A;  1CN4 C;  3PIW A;  3UEZ E;  3HHR A;  5E4E A;  3DGC L;  3BES L;  5D70 A;  4I77 Z;  1ALU A;  1KF9 A;  3L5W I;  4NEJ A;  1JLI A;  4X51 A;  4DOH A;  1WU3 I;  5KNH I;  1IJZ A;  1D9G A;  1HUL A;  5FUC A;  2HYM B;  1IK0 A;  1ETE A;  1Y6K L;  1AXI A;  3DLQ I;  1CSG A;  3G9V B;  2B8Y A;  1PY2 A;  4MHL A;  3WCY I;  1GNC A;  4NEM A;  1N1F A;  1NBP A;  4Z5R D;  1P9M B;  2IL6 A;  2LMS A;  3BPN A;  1A22 A;  1EER A;  1IAR A;  1PGR A;  2E9W C;  3L5X A;  1M48 A;  1HIJ A;  3UX9 A;  1ITF A;  1I1R B;  1M47 A;  3HMX B;  4NI7 A;  1VLK A;  2CYK A;  4FA8 E;  3B5K A;  3BPL A;  1D9C A;  2D48 A;  4O6K A;  4YUE C;  4GRW A;  1RFB A;  5D28 B;  1F6F A;  1FYH A;  1HGU A;  3QWR B;  4NKQ C;  1EXZ A;  5D72 A;  1BCN A;  1CD9 A;  4J4L C;  5L6Y C;  1ITI A;  1EMR A;  2B8U A;  1RHG A;  2INT A;  3Q1S I;  3D87 A;  1F45 B;  1BUY A;  3MZG A;  1BP3 A;  3S9D A;  1HIK A;  1PW6 A;  1FG9 A;  1Y6N L;  1CNT 1;  1RCB A;  3VA2 A;  1EKU A;  2ILK A;  5LQB A;  4RS1 A;  2L3O A;  5C7X A;  2B91 A;  3G6D A;  2B8X A;  1PVH B;  1Z92 A;  3N0P A;  3NCF A;  3NCE A;  1HZI A;  2GMF A;  3QT2 C;  5D71 A;  4ZF7 A;  1QVN A;  1INR A;  2B90 A;  3EW3 A;  1Z7C A;  1M4C A;  1BBN A;  4YPG C;  1IL6 A;  1SCF A;  2O26 A;  1M4R A;  3NCC A;  1M4B A;  1B5L A;  3QB1 A;  1CYL A;  1YKB A;  3SE3 B;  1AU1 A;  2O27 A;  1LK3 A;  1ILK A;  3UF2 A;  2ERJ D;  1V7N V;  1BGC A;  3BPO A;  4O9H A;  1M49 A;  1Y6M L;  4ZS7 A;  1BGE A;  4CNI C;  1HWH A;  1RW5 A;  2LAG A;  2Q98 A;  1HWG A;  4NI9 A;  5FHX A;  1M4A A;  1A7M A;  3QB7 A;  4YQX A;  1IRL A;  1V7M V;  4YDY I;  3LB6 A;  3NPZ A;  3OQ3 A;  2L3Y A;  3INK C;  1AX8 A;  4PS4 A;  1J7V L;  4WRL B;  3D48 P;  1EVS A;  2H24 A;  3D85 C;  3UF5 A;  3PIV A;  1BGD A; 
#chains in the Genus database with same CATH topology
 2Q14 A;  1LKI A;  3DI2 A;  1HUW A;  1ITL A;  4D2D A;  1GA3 A;  4U4T A;  3PIW A;  3DGC L;  3BES L;  4GS7 A;  3TGX B;  4I77 Z;  3AYH A;  1JLI A;  5FUC A;  4GBZ A;  4ZWC A;  1ETE A;  1AXI A;  1CSG A;  2JA5 D;  2B8Y A;  1PY2 A;  4MHL A;  3WCY I;  4NEM A;  3HOX D;  1N1F A;  2B63 D;  4DKF A;  5C3E D;  4Z5R D;  2Y5Y A;  3IRH A;  2LMS A;  1A22 A;  1IAR A;  1PGR A;  2OQP A;  1ITF A;  1HIJ A;  1I1R B;  4NI7 A;  1VLK A;  1Y1W D;  4DKD A;  4O6K A;  2D48 A;  5D6K A;  1F6F A;  4A3L D;  4NKQ C;  4A3F D;  3HOZ D;  4J4L C;  1ITI A;  1Y1V D;  2INT A;  4W6V A;  4OH3 A;  3MZG A;  3S9D A;  1Y6N L;  1CNT 1;  1RCB A;  4A3J D;  5IP7 D;  4YB9 D;  5EQH A;  1PVH B;  3I4N D;  2O6I A;  4BBS D;  1INR A;  4A3G D;  2R7Z D;  3H3V E;  1SCF A;  3H0G D;  1M4R A;  5A2O A;  1B5L A;  3SE3 B;  3UF2 A;  2ERJ D;  4GBY A;  4CNI C;  5GXB A;  3HHC A;  4JRE A;  3QB7 A;  4YQX A;  1IRL A;  3NPZ A;  1J7V L;  4TPH A;  3UF5 A;  4ZYR A;  2JA8 D;  3PIV A;  1PV7 A;  3NCB A;  3LB6 B;  3EJJ A;  2D9Q A;  1CN4 C;  3UEZ E;  3HHR A;  4A3B D;  1PV6 A;  3O7Q A;  4A3E D;  1ALU A;  1KF9 A;  3L5W I;  4DOH A;  1PW4 A;  5EQI A;  4UVM A;  4IKX A;  1Y6K L;  3HOY D;  3G9V B;  1GNC A;  5FLM D;  2IL6 A;  3BPN A;  3L5X A;  3O7P A;  1M47 A;  4A3I D;  4XNJ A;  3B5K A;  3HOW D;  4A3M D;  1RFB A;  2JA6 D;  3QWR B;  1BCN A;  1CD9 A;  5L6Y C;  1EMR A;  4BY7 D;  2Z3Q A;  4IKW A;  3Q1S I;  4A3K D;  4EXP A;  1F45 B;  1BUY A;  4YBQ A;  4ZWB A;  1PW6 A;  1FG9 A;  5EQG A;  3VA2 A;  1EKU A;  5LQB A;  4TPJ A;  5C7X A;  5D71 A;  4ZF7 A;  3EW3 A;  1M4C A;  3OG4 A;  1BBN A;  4TPG A;  1IL6 A;  1YKB A;  1LK3 A;  4PYP A;  4O9H A;  1BGC A;  1Y6M L;  4EXN A;  1HWH A;  2Q98 A;  1HWG A;  5FHX A;  2JA7 D;  4D2C A;  4LRL A;  1A7M A;  4IU8 A;  4U4V A;  4BXX D;  3LB6 A;  4Q65 A;  3I4M D;  3INK C;  3HOV D;  3D48 P;  2H24 A;  3D85 C;  3SE4 B;  2Z3R A;  3QAZ A;  3N06 A;  3FKI D;  1LQS L;  5C4X D;  5D22 A;  2Q7N B;  5D70 A;  4NEJ A;  4X51 A;  1HUL A;  3DI3 A;  2C35 A;  2R92 D;  5A2N A;  1P9M B;  4ZS7 A;  1M48 A;  3HMX B;  4FA8 E;  3BPL A;  4GC0 A;  4GRW A;  1FYH A;  1HGU A;  5D72 A;  4LEP A;  2B8U A;  4DKE A;  3D87 A;  5IP9 D;  5IYB D;  4OAA A;  5C44 D;  5IYD D;  2PSM A;  4JA3 A;  2B8X A;  4LDS A;  1Z92 A;  3QT2 C;  3NCE A;  1HZI A;  2GMF A;  2B90 A;  1Z7C A;  5C65 A;  2R93 D;  3NCC A;  2CFP A;  1CYL A;  1ILK A;  1V7N V;  1RW5 A;  2LAG A;  4IU9 A;  5IYC D;  5D59 A;  3OG6 A;  4IKY A;  3PO3 D;  1V7M V;  3OQ3 A;  2L3Y A;  1AX8 A;  4NN7 A;  4NN6 A;  4PS4 A;  2V8N A;  4WRL B;  1BGD A;  2B8Z A;  2KZ1 A;  1ITM A;  2CFQ A;  2B5I A;  3DUH C;  4D2B A;  5E4E A;  5TS9 A;  4JR9 A;  1WU3 I;  5KNH I;  3HOU D;  4A3C D;  1IJZ A;  1D9G A;  4QIQ A;  2HYM B;  1IK0 A;  3PO2 D;  3DLQ I;  1NBP A;  4NN5 A;  2VUM D;  1EER A;  2E9W C;  4A3D D;  3UX9 A;  4APS A;  2CYK A;  4A93 D;  4J05 A;  1D9C A;  4YUE C;  5D28 B;  2XQB A;  4IKZ A;  1EXZ A;  4U4W A;  1RHG A;  1BP3 A;  1HIK A;  1WCM D;  2ILK A;  4RS1 A;  2L3O A;  2B91 A;  3G6D A;  3N0P A;  3NCF A;  4BBR D;  4XNI A;  1QVN A;  4DKC A;  4BY1 D;  4YPG C;  2O26 A;  1M4B A;  3QB1 A;  1AU1 A;  2O27 A;  3BPO A;  1M49 A;  1BGE A;  2XUT A;  4NI9 A;  3WDO A;  1M4A A;  4IKV A;  4YDY I;  4ZW9 A;  5D58 A;  1Y14 A;  1EVS A; 
#chains in the Genus database with same CATH homology
 3SE4 B;  2B8Z A;  2KZ1 A;  2Q14 A;  1LKI A;  1ITM A;  2Z3R A;  3DI2 A;  3NCB A;  3QAZ A;  1HUW A;  3N06 A;  2B5I A;  3DUH C;  3LB6 B;  3EJJ A;  3FKI D;  1ITL A;  1LQS L;  5C4X D;  2D9Q A;  5D22 A;  2Q7N B;  1GA3 A;  1CN4 C;  3PIW A;  3UEZ E;  3HHR A;  5E4E A;  5TS9 A;  3DGC L;  3BES L;  4A3B D;  4GS7 A;  5D70 A;  3TGX B;  4A3E D;  4I77 Z;  1ALU A;  1KF9 A;  3AYH A;  3L5W I;  4NEJ A;  1JLI A;  4X51 A;  4DOH A;  1WU3 I;  5KNH I;  3HOU D;  4A3C D;  1IJZ A;  1D9G A;  1HUL A;  5FUC A;  2HYM B;  1IK0 A;  1ETE A;  3DI3 A;  1Y6K L;  1AXI A;  3PO2 D;  3HOY D;  2C35 A;  3DLQ I;  1CSG A;  2JA5 D;  3G9V B;  2B8Y A;  1PY2 A;  4MHL A;  3WCY I;  1GNC A;  4NEM A;  3HOX D;  1N1F A;  2R92 D;  1NBP A;  4DKF A;  4NN5 A;  2B63 D;  5C3E D;  2VUM D;  4Z5R D;  5FLM D;  3IRH A;  1P9M B;  2IL6 A;  2LMS A;  3BPN A;  1A22 A;  1EER A;  1IAR A;  1PGR A;  2E9W C;  2OQP A;  1M48 A;  1HIJ A;  3L5X A;  3UX9 A;  4A3D D;  1ITF A;  1I1R B;  1M47 A;  3HMX B;  4NI7 A;  1VLK A;  2CYK A;  4FA8 E;  4A3I D;  4A93 D;  1Y1W D;  3B5K A;  3BPL A;  3HOW D;  4DKD A;  1D9C A;  2D48 A;  4O6K A;  4YUE C;  4A3M D;  4GRW A;  1RFB A;  5D28 B;  1F6F A;  4A3L D;  2XQB A;  1FYH A;  2JA6 D;  1HGU A;  3QWR B;  4NKQ C;  4A3F D;  1EXZ A;  5D72 A;  1BCN A;  1CD9 A;  4J4L C;  3HOZ D;  5L6Y C;  1ITI A;  1EMR A;  4BY7 D;  2Z3Q A;  1Y1V D;  2B8U A;  1RHG A;  2INT A;  3Q1S I;  3D87 A;  4DKE A;  5IP9 D;  4A3K D;  4EXP A;  1F45 B;  1BUY A;  3MZG A;  5IYB D;  1BP3 A;  3S9D A;  1HIK A;  1PW6 A;  1FG9 A;  1Y6N L;  1CNT 1;  5IYD D;  5C44 D;  1RCB A;  4A3J D;  3VA2 A;  1EKU A;  1WCM D;  2ILK A;  2PSM A;  2L3O A;  4RS1 A;  5LQB A;  5IP7 D;  5C7X A;  2B91 A;  3G6D A;  2B8X A;  1PVH B;  1Z92 A;  3N0P A;  3NCF A;  3NCE A;  1HZI A;  2GMF A;  3QT2 C;  5D71 A;  4BBR D;  4ZF7 A;  1QVN A;  2O6I A;  3I4N D;  4BBS D;  1INR A;  2B90 A;  3EW3 A;  4A3G D;  1Z7C A;  4DKC A;  4BY1 D;  2R7Z D;  1M4C A;  3OG4 A;  3H3V E;  1BBN A;  2R93 D;  4YPG C;  1IL6 A;  1SCF A;  2O26 A;  3H0G D;  1M4R A;  3NCC A;  1M4B A;  1B5L A;  3QB1 A;  1CYL A;  1YKB A;  3SE3 B;  1AU1 A;  2O27 A;  1LK3 A;  1ILK A;  3UF2 A;  2ERJ D;  1V7N V;  1BGC A;  3BPO A;  4O9H A;  1M49 A;  1Y6M L;  4ZS7 A;  1BGE A;  4CNI C;  4EXN A;  1HWH A;  1RW5 A;  2LAG A;  2Q98 A;  1HWG A;  5IYC D;  5FHX A;  4NI9 A;  1M4A A;  2JA7 D;  4LRL A;  3HHC A;  3OG6 A;  1A7M A;  3QB7 A;  4YQX A;  1IRL A;  3PO3 D;  1V7M V;  4BXX D;  4YDY I;  3LB6 A;  3I4M D;  3NPZ A;  3OQ3 A;  2L3Y A;  3INK C;  1AX8 A;  4NN7 A;  1Y14 A;  4NN6 A;  1J7V L;  4PS4 A;  4WRL B;  3D48 P;  1EVS A;  2H24 A;  3D85 C;  3UF5 A;  3HOV D;  2JA8 D;  3PIV A;  1BGD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...