1BUYA

Human erythropoietin, nmr minimized average structure
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
166
structure length
166
Chain Sequence
b'APPRLICDSRVLERYLLEAKEAEKITTGCAEHCSLNEKITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVKSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (ERYTHROPOIETIN)
publication title NMR structure of human erythropoietin and a comparison with its receptor bound conformation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 37
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 1998-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00758 EPO_TPO Erythropoietin/thrombopoietin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1250.10 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; Growth Hormone; Chain: A; 1buyA00
2GMFA 1ALUA 1M4AA 1IL6A 4ZF7A 4X51A 1F45B 3MZGA 1HIJA 1RCBA 3G6DA 1D9GA 4MHLA 4FA8E 4I77Z 1M4BA 3G9VB 2Q98A 1P9MB 1EERA 3SE3B 1EKUA 1BGCA 4NKQC 3HHRA 1A22A 2CYKA 1INRA 1ITIA 1M49A 1HUWA 5D22A 5D71A 1HGUA 2HYMB 3BPOA 2LMSA 1FYHA 3Q1SI 5E4EA 3WCYI 2KZ1A 5FUCA 3EJJA 1F6FA 1EMRA 4NI7A 1ETEA 4DOHA 3NCBA 1GA3A 4NEJA 3DUHC 1IJZA 2LAGA 1BCNA 2H24A 1BP3A 1JLIA 2E9WC 1FG9A 3D48P 1M48A 2B8ZA 2L3YA 3LB6A 1LK3A 3VA2A 3QB1A 5FHXA 1Z7CA 2D48A 3N06A 1WU3I 4NEMA 1V7MV 1AXIA 1Y6NL 3D85C 1J7VL 1CSGA 1EXZA 3OQ3A 1M4CA 2B8UA 3BPLA 4GRWA 4RS1A 1AX8A 2O26A 1RFBA 1YKBA 2B90A 2ILKA 2B5IA 1KF9A 1HIKA 2IL6A 5LQBA 4J4LC 3SE4B 3UX9A 1I1RB 1Z92A 3BESL 5D72A 3NCFA 1HWGA 3NCEA 2INTA 3NPZA 3UF2A 1EVSA 1PY2A 2L3OA 1N1FA 1RW5A 1CN4C 3QT2C 3EW3A 1A7MA 2ERJD 3UEZE 1GNCA 4O9HA 3BPNA 4YUEC 1SCFA 1BUYA 2Q7NB 3HMXB 3INKC 1M47A 3PIWA 4YDYI 2O27A 1M4RA 3B5KA 1D9CA 1QVNA 1AU1A 3QWRB 4YPGC 3L5XA 3PIVA 3N0PA 4PS4A 1LQSL 3QAZA 4WRLB 1HULA 1LKIA 1ITFA 1PVHB 1ILKA 1ITLA 1VLKA 1BGDA 3D87A 3NCCA 1Y6ML 5KNHI 1CNT1 1CYLA 3L5WI 1V7NV 1CD9A 3DGCL 3LB6B 1NBPA 5D70A 4Z5RD 4CNIC 2B91A 1HWHA 2B8YA 1ITMA 3QB7A 3UF5A 1PGRA 1Y6KL 3DLQI 5D28B 5L6YC 2D9QA 1IARA 1BBNA 1B5LA 1IK0A 2B8XA 4ZS7A 1PW6A 5C7XA 1BGEA 1HZIA 1RHGA 4O6KA 4YQXA 4NI9A 1IRLA 3S9DA
chains in the Genus database with same CATH superfamily
1ALUA 4ZF7A 1F45B 1RCBA 4DKEA 2O6IA 3DI3A 2Q98A 3OG4A 3H0GD 1P9MB 3SE3B 4IKWA 3HHRA 4BY1D 1A22A 4JREA 4IKYA 5EQHA 1FYHA 5A2OA 3EJJA 4BBRD 1PW4A 1ETEA 2Z3QA 2E9WC 5C44D 1M48A 2VUMD 3QB1A 5FHXA 1AXIA 1Y6NL 5IP9D 3D85C 1J7VL 1CSGA 3BPLA 1AX8A 2O26A 1RFBA 1YKBA 3DI2A 2PSMA 4GBYA 4BXXD 2IL6A 3PO3D 3NCFA 1PY2A 3I4ND 3EW3A 5IP7D 1PV6A 3HOYD 2Q14A 3HOZD 4LDSA 4U4TA 3I4MD 3QWRB 4YPGC 3N0PA 4PS4A 1LQSL 2R93D 4IKZA 4YB9D 1BGDA 1CYLA 1V7NV 3LB6B 3QB7A 3HOUD 5D28B 1BBNA 4DKFA 4YBQA 3FKID 4O6KA 5IYBD 3O7PA 3MZGA 1HIJA 1D9GA 4Q65A 1M4BA 3G9VB 2CFPA 4NKQC 2C35A 3IRHA 1INRA 1M49A 4IU8A 5D71A 4A3MD 2HYMB 3Q1SI 5E4EA 5FUCA 1F6FA 1EMRA 4DOHA 1FG9A 2L3YA 1LK3A 5FLMD 1Y14A 3WDOA 4NEMA 1V7MV 1EXZA 3OQ3A 5C3ED 4TPGA 5C65A 4JA3A 2V8NA 5LQBA 2OQPA 2JA6D 1Z92A 3BESL 5D72A 2XQBA 3QT2C 3PO2D 2R7ZD 4O9HA 1BUYA 4A3JD 3INKC 3PIWA 1M47A 4A3GD 2O27A 1D9CA 3AYHA 5D6KA 1QVNA 4ZW9A 3L5XA 3PIVA 4WRLB 1HULA 1PVHB 3D87A 3NCCA 5IYDD 1Y6ML 3HOWD 4A3DD 4LRLA 4Z5RD 4U4WA 1HWHA 1ITMA 3UF5A 2B8XA 5TS9A 1PW6A 5C7XA 1BGEA 1RHGA 4NI9A 3S9DA 2GMFA 1IL6A 2JA7D 4FA8E 4D2BA 5GXBA 5D22A 1HGUA 3BPOA 4OAAA 2CFQA 3NCBA 1GA3A 4GBZA 1IJZA 4OH3A 1PV7A 2B8ZA 3LB6A 3VA2A 1Z7CA 4A3FD 3HOVD 4A3CD 4GC0A 1M4CA 2B8UA 2B90A 5A2NA 1KF9A 1HIKA 3UX9A 1I1RB 4TPHA 4U4VA 3NCEA 3NPZA 4DKCA 3H3VE 1EVSA 2L3OA 1N1FA 1CN4C 4TPJA 4EXNA 2ERJD 3UEZE 3BPNA 4XNIA 1SCFA 4YUEC 2Q7NB 2Z3RA 3HMXB 1Y1VD 4LEPA 4JR9A 5C4XD 3B5KA 2B63D 1AU1A 5EQGA 4NN5A 4BBSD 4NN7A 1ITFA 4ZYRA 1ITLA 1VLKA 2XUTA 4A3BD 3TGXB 1NBPA 4IU9A 5D70A 2B91A 4EXPA 2B8YA 1Y6KL 3DLQI 2JA8D 4DKDA 1IARA 1IK0A 4ZS7A 1HZIA 1IRLA 1M4AA 4X51A 3G6DA 4MHLA 4IKXA 2R92D 4I77Z 1EERA 1EKUA 4GS7A 1BGCA 4PYPA 3HHCA 2CYKA 1ITIA 1HUWA 2LMSA 4NN6A 3WCYI 2KZ1A 4D2CA 4NI7A 4NEJA 3DUHC 2LAGA 1BCNA 2H24A 1BP3A 1JLIA 5D59A 3D48P 2D48A 3N06A 1WU3I 1Y1WD 5D58A 5IYCD 4GRWA 4RS1A 4XNJA 2ILKA 4A93D 3HOXD 2B5IA 4J4LC 4W6VA 3SE4B 3OG6A 1HWGA 3O7QA 2INTA 3UF2A 2JA5D 1RW5A 1A7MA 1GNCA 4YDYI 1M4RA 4A3ID 4BY7D 5EQIA 4UVMA 4ZWBA 4A3LD 4J05A 4ZWCA 3QAZA 1LKIA 1ILKA 4IKVA 4APSA 2Y5YA 5KNHI 1CNT1 1WCMD 4QIQA 3L5WI 1CD9A 3DGCL 4A3KD 4CNIC 1PGRA 5L6YC 2D9QA 4A3ED 1B5LA 4D2DA 4YQXA
chains in the Genus database with same CATH topology
5IYBD 2GMFA 1ALUA 1M4AA 1IL6A 4ZF7A 4X51A 1F45B 2JA7D 3MZGA 1HIJA 1RCBA 3G6DA 1D9GA 4MHLA 4DKEA 4FA8E 2R92D 2O6IA 3DI3A 1M4BA 4I77Z 3G9VB 2Q98A 3OG4A 3H0GD 1P9MB 1EERA 3SE3B 1EKUA 4GS7A 1BGCA 4NKQC 3HHRA 2C35A 3IRHA 3HHCA 1A22A 2CYKA 1INRA 4BY1D 1ITIA 1M49A 1HUWA 5D22A 5D71A 4A3MD 1HGUA 2HYMB 3BPOA 2LMSA 1FYHA 4NN6A 3Q1SI 5E4EA 3WCYI 2KZ1A 5FUCA 3EJJA 1F6FA 4BBRD 1EMRA 4NI7A 1ETEA 4DOHA 2Z3QA 3NCBA 1GA3A 4NEJA 3DUHC 1IJZA 2LAGA 1BCNA 2H24A 1BP3A 1JLIA 2E9WC 1FG9A 3D48P 5C44D 1M48A 2B8ZA 2L3YA 3LB6A 1LK3A 2VUMD 3VA2A 3QB1A 5FLMD 1Y14A 5FHXA 1Z7CA 2D48A 3N06A 1WU3I 4NEMA 4A3FD 1Y1WD 3HOVD 5IYCD 1V7MV 1AXIA 1Y6NL 5IP9D 3D85C 1J7VL 4A3CD 1CSGA 1EXZA 3OQ3A 1M4CA 2B8UA 3BPLA 4GRWA 4RS1A 1AX8A 2O26A 5C3ED 1RFBA 1YKBA 2B90A 2ILKA 2PSMA 3DI2A 3HOXD 4A93D 2B5IA 4BXXD 1KF9A 1HIKA 2IL6A 5LQBA 4J4LC 3SE4B 3UX9A 2OQPA 2JA6D 1I1RB 1Z92A 3BESL 3PO3D 5D72A 3NCFA 3OG6A 1HWGA 3NCEA 2INTA 3NPZA 3UF2A 4DKCA 1EVSA 1PY2A 2L3OA 1N1FA 1RW5A 1CN4C 2XQBA 3QT2C 3I4ND 3EW3A 5IP7D 3PO2D 1A7MA 3HOYD 2R7ZD 4EXNA 2ERJD 3UEZE 1GNCA 4O9HA 2Q14A 3BPNA 4YUEC 1SCFA 1BUYA 2Q7NB 2Z3RA 4A3JD 3HOZD 3HMXB 1Y1VD 1M47A 3INKC 3PIWA 3I4MD 4A3GD 4YDYI 2O27A 5C4XD 1M4RA 3B5KA 4A3ID 1D9CA 4BY7D 3AYHA 2B63D 1QVNA 1AU1A 3QWRB 4YPGC 3L5XA 3PIVA 4A3LD 3N0PA 4NN5A 4PS4A 1LQSL 4BBSD 3QAZA 4WRLB 4NN7A 1HULA 1LKIA 1ITFA 2R93D 1PVHB 1ILKA 1ITLA 1VLKA 1BGDA 3D87A 3H3VE 3NCCA 4A3BD 5IYDD 1Y6ML 2JA5D 5KNHI 1CNT1 1WCMD 3HOWD 3L5WI 4A3DD 1V7NV 1CYLA 1CD9A 3DGCL 4LRLA 3LB6B 3TGXB 1NBPA 4A3KD 5D70A 4Z5RD 4CNIC 2B91A 1HWHA 4EXPA 2B8YA 1ITMA 3QB7A 3UF5A 3HOUD 1PGRA 1Y6KL 3DLQI 5D28B 2JA8D 4DKDA 5L6YC 2D9QA 1IARA 4A3ED 1BBNA 4DKFA 1B5LA 1IK0A 3FKID 2B8XA 5TS9A 1PW6A 4ZS7A 5C7XA 1BGEA 1HZIA 1RHGA 4O6KA 4YQXA 4NI9A 1IRLA 3S9DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GMF A;  1ALU A;  1M4A A;  1IL6 A;  4ZF7 A;  4X51 A;  1F45 B;  3MZG A;  1HIJ A;  1RCB A;  3G6D A;  1D9G A;  4MHL A;  4FA8 E;  4I77 Z;  1M4B A;  3G9V B;  2Q98 A;  1P9M B;  1EER A;  3SE3 B;  1EKU A;  1BGC A;  4NKQ C;  3HHR A;  1A22 A;  2CYK A;  1INR A;  1ITI A;  1M49 A;  1HUW A;  5D22 A;  5D71 A;  1HGU A;  2HYM B;  3BPO A;  2LMS A;  1FYH A;  3Q1S I;  5E4E A;  3WCY I;  2KZ1 A;  5FUC A;  3EJJ A;  1F6F A;  1EMR A;  4NI7 A;  1ETE A;  4DOH A;  3NCB A;  1GA3 A;  4NEJ A;  3DUH C;  1IJZ A;  2LAG A;  1BCN A;  2H24 A;  1BP3 A;  1JLI A;  2E9W C;  1FG9 A;  3D48 P;  1M48 A;  2B8Z A;  2L3Y A;  3LB6 A;  1LK3 A;  3VA2 A;  3QB1 A;  5FHX A;  1Z7C A;  2D48 A;  3N06 A;  1WU3 I;  4NEM A;  1V7M V;  1AXI A;  1Y6N L;  3D85 C;  1J7V L;  1CSG A;  1EXZ A;  3OQ3 A;  1M4C A;  2B8U A;  3BPL A;  4GRW A;  4RS1 A;  1AX8 A;  2O26 A;  1RFB A;  1YKB A;  2B90 A;  2ILK A;  2B5I A;  1KF9 A;  1HIK A;  2IL6 A;  5LQB A;  4J4L C;  3SE4 B;  3UX9 A;  1I1R B;  1Z92 A;  3BES L;  5D72 A;  3NCF A;  1HWG A;  3NCE A;  2INT A;  3NPZ A;  3UF2 A;  1EVS A;  1PY2 A;  2L3O A;  1N1F A;  1RW5 A;  1CN4 C;  3QT2 C;  3EW3 A;  1A7M A;  2ERJ D;  3UEZ E;  1GNC A;  4O9H A;  3BPN A;  4YUE C;  1SCF A;  1BUY A;  2Q7N B;  3HMX B;  3INK C;  1M47 A;  3PIW A;  4YDY I;  2O27 A;  1M4R A;  3B5K A;  1D9C A;  1QVN A;  1AU1 A;  3QWR B;  4YPG C;  3L5X A;  3PIV A;  3N0P A;  4PS4 A;  1LQS L;  3QAZ A;  4WRL B;  1HUL A;  1LKI A;  1ITF A;  1PVH B;  1ILK A;  1ITL A;  1VLK A;  1BGD A;  3D87 A;  3NCC A;  1Y6M L;  5KNH I;  1CNT 1;  1CYL A;  3L5W I;  1V7N V;  1CD9 A;  3DGC L;  3LB6 B;  1NBP A;  5D70 A;  4Z5R D;  4CNI C;  2B91 A;  1HWH A;  2B8Y A;  1ITM A;  3QB7 A;  3UF5 A;  1PGR A;  1Y6K L;  3DLQ I;  5D28 B;  5L6Y C;  2D9Q A;  1IAR A;  1BBN A;  1B5L A;  1IK0 A;  2B8X A;  4ZS7 A;  1PW6 A;  5C7X A;  1BGE A;  1HZI A;  1RHG A;  4O6K A;  4YQX A;  4NI9 A;  1IRL A;  3S9D A; 
#chains in the Genus database with same CATH topology
 1ALU A;  4ZF7 A;  1F45 B;  1RCB A;  4DKE A;  2O6I A;  3DI3 A;  2Q98 A;  3OG4 A;  3H0G D;  1P9M B;  3SE3 B;  4IKW A;  3HHR A;  4BY1 D;  1A22 A;  4JRE A;  4IKY A;  5EQH A;  1FYH A;  5A2O A;  3EJJ A;  4BBR D;  1PW4 A;  1ETE A;  2Z3Q A;  2E9W C;  5C44 D;  1M48 A;  2VUM D;  3QB1 A;  5FHX A;  1AXI A;  1Y6N L;  5IP9 D;  3D85 C;  1J7V L;  1CSG A;  3BPL A;  1AX8 A;  2O26 A;  1RFB A;  1YKB A;  3DI2 A;  2PSM A;  4GBY A;  4BXX D;  2IL6 A;  3PO3 D;  3NCF A;  1PY2 A;  3I4N D;  3EW3 A;  5IP7 D;  1PV6 A;  3HOY D;  2Q14 A;  3HOZ D;  4LDS A;  4U4T A;  3I4M D;  3QWR B;  4YPG C;  3N0P A;  4PS4 A;  1LQS L;  2R93 D;  4IKZ A;  4YB9 D;  1BGD A;  1CYL A;  1V7N V;  3LB6 B;  3QB7 A;  3HOU D;  5D28 B;  1BBN A;  4DKF A;  4YBQ A;  3FKI D;  4O6K A;  5IYB D;  3O7P A;  3MZG A;  1HIJ A;  1D9G A;  4Q65 A;  1M4B A;  3G9V B;  2CFP A;  4NKQ C;  2C35 A;  3IRH A;  1INR A;  1M49 A;  4IU8 A;  5D71 A;  4A3M D;  2HYM B;  3Q1S I;  5E4E A;  5FUC A;  1F6F A;  1EMR A;  4DOH A;  1FG9 A;  2L3Y A;  1LK3 A;  5FLM D;  1Y14 A;  3WDO A;  4NEM A;  1V7M V;  1EXZ A;  3OQ3 A;  5C3E D;  4TPG A;  5C65 A;  4JA3 A;  2V8N A;  5LQB A;  2OQP A;  2JA6 D;  1Z92 A;  3BES L;  5D72 A;  2XQB A;  3QT2 C;  3PO2 D;  2R7Z D;  4O9H A;  1BUY A;  4A3J D;  3INK C;  3PIW A;  1M47 A;  4A3G D;  2O27 A;  1D9C A;  3AYH A;  5D6K A;  1QVN A;  4ZW9 A;  3L5X A;  3PIV A;  4WRL B;  1HUL A;  1PVH B;  3D87 A;  3NCC A;  5IYD D;  1Y6M L;  3HOW D;  4A3D D;  4LRL A;  4Z5R D;  4U4W A;  1HWH A;  1ITM A;  3UF5 A;  2B8X A;  5TS9 A;  1PW6 A;  5C7X A;  1BGE A;  1RHG A;  4NI9 A;  3S9D A;  2GMF A;  1IL6 A;  2JA7 D;  4FA8 E;  4D2B A;  5GXB A;  5D22 A;  1HGU A;  3BPO A;  4OAA A;  2CFQ A;  3NCB A;  1GA3 A;  4GBZ A;  1IJZ A;  4OH3 A;  1PV7 A;  2B8Z A;  3LB6 A;  3VA2 A;  1Z7C A;  4A3F D;  3HOV D;  4A3C D;  4GC0 A;  1M4C A;  2B8U A;  2B90 A;  5A2N A;  1KF9 A;  1HIK A;  3UX9 A;  1I1R B;  4TPH A;  4U4V A;  3NCE A;  3NPZ A;  4DKC A;  3H3V E;  1EVS A;  2L3O A;  1N1F A;  1CN4 C;  4TPJ A;  4EXN A;  2ERJ D;  3UEZ E;  3BPN A;  4XNI A;  1SCF A;  4YUE C;  2Q7N B;  2Z3R A;  3HMX B;  1Y1V D;  4LEP A;  4JR9 A;  5C4X D;  3B5K A;  2B63 D;  1AU1 A;  5EQG A;  4NN5 A;  4BBS D;  4NN7 A;  1ITF A;  4ZYR A;  1ITL A;  1VLK A;  2XUT A;  4A3B D;  3TGX B;  1NBP A;  4IU9 A;  5D70 A;  2B91 A;  4EXP A;  2B8Y A;  1Y6K L;  3DLQ I;  2JA8 D;  4DKD A;  1IAR A;  1IK0 A;  4ZS7 A;  1HZI A;  1IRL A;  1M4A A;  4X51 A;  3G6D A;  4MHL A;  4IKX A;  2R92 D;  4I77 Z;  1EER A;  1EKU A;  4GS7 A;  1BGC A;  4PYP A;  3HHC A;  2CYK A;  1ITI A;  1HUW A;  2LMS A;  4NN6 A;  3WCY I;  2KZ1 A;  4D2C A;  4NI7 A;  4NEJ A;  3DUH C;  2LAG A;  1BCN A;  2H24 A;  1BP3 A;  1JLI A;  5D59 A;  3D48 P;  2D48 A;  3N06 A;  1WU3 I;  1Y1W D;  5D58 A;  5IYC D;  4GRW A;  4RS1 A;  4XNJ A;  2ILK A;  4A93 D;  3HOX D;  2B5I A;  4J4L C;  4W6V A;  3SE4 B;  3OG6 A;  1HWG A;  3O7Q A;  2INT A;  3UF2 A;  2JA5 D;  1RW5 A;  1A7M A;  1GNC A;  4YDY I;  1M4R A;  4A3I D;  4BY7 D;  5EQI A;  4UVM A;  4ZWB A;  4A3L D;  4J05 A;  4ZWC A;  3QAZ A;  1LKI A;  1ILK A;  4IKV A;  4APS A;  2Y5Y A;  5KNH I;  1CNT 1;  1WCM D;  4QIQ A;  3L5W I;  1CD9 A;  3DGC L;  4A3K D;  4CNI C;  1PGR A;  5L6Y C;  2D9Q A;  4A3E D;  1B5L A;  4D2D A;  4YQX A; 
#chains in the Genus database with same CATH homology
 5IYB D;  2GMF A;  1ALU A;  1M4A A;  1IL6 A;  4ZF7 A;  4X51 A;  1F45 B;  2JA7 D;  3MZG A;  1HIJ A;  1RCB A;  3G6D A;  1D9G A;  4MHL A;  4DKE A;  4FA8 E;  2R92 D;  2O6I A;  3DI3 A;  1M4B A;  4I77 Z;  3G9V B;  2Q98 A;  3OG4 A;  3H0G D;  1P9M B;  1EER A;  3SE3 B;  1EKU A;  4GS7 A;  1BGC A;  4NKQ C;  3HHR A;  2C35 A;  3IRH A;  3HHC A;  1A22 A;  2CYK A;  1INR A;  4BY1 D;  1ITI A;  1M49 A;  1HUW A;  5D22 A;  5D71 A;  4A3M D;  1HGU A;  2HYM B;  3BPO A;  2LMS A;  1FYH A;  4NN6 A;  3Q1S I;  5E4E A;  3WCY I;  2KZ1 A;  5FUC A;  3EJJ A;  1F6F A;  4BBR D;  1EMR A;  4NI7 A;  1ETE A;  4DOH A;  2Z3Q A;  3NCB A;  1GA3 A;  4NEJ A;  3DUH C;  1IJZ A;  2LAG A;  1BCN A;  2H24 A;  1BP3 A;  1JLI A;  2E9W C;  1FG9 A;  3D48 P;  5C44 D;  1M48 A;  2B8Z A;  2L3Y A;  3LB6 A;  1LK3 A;  2VUM D;  3VA2 A;  3QB1 A;  5FLM D;  1Y14 A;  5FHX A;  1Z7C A;  2D48 A;  3N06 A;  1WU3 I;  4NEM A;  4A3F D;  1Y1W D;  3HOV D;  5IYC D;  1V7M V;  1AXI A;  1Y6N L;  5IP9 D;  3D85 C;  1J7V L;  4A3C D;  1CSG A;  1EXZ A;  3OQ3 A;  1M4C A;  2B8U A;  3BPL A;  4GRW A;  4RS1 A;  1AX8 A;  2O26 A;  5C3E D;  1RFB A;  1YKB A;  2B90 A;  2ILK A;  2PSM A;  3DI2 A;  3HOX D;  4A93 D;  2B5I A;  4BXX D;  1KF9 A;  1HIK A;  2IL6 A;  5LQB A;  4J4L C;  3SE4 B;  3UX9 A;  2OQP A;  2JA6 D;  1I1R B;  1Z92 A;  3BES L;  3PO3 D;  5D72 A;  3NCF A;  3OG6 A;  1HWG A;  3NCE A;  2INT A;  3NPZ A;  3UF2 A;  4DKC A;  1EVS A;  1PY2 A;  2L3O A;  1N1F A;  1RW5 A;  1CN4 C;  2XQB A;  3QT2 C;  3I4N D;  3EW3 A;  5IP7 D;  3PO2 D;  1A7M A;  3HOY D;  2R7Z D;  4EXN A;  2ERJ D;  3UEZ E;  1GNC A;  4O9H A;  2Q14 A;  3BPN A;  4YUE C;  1SCF A;  1BUY A;  2Q7N B;  2Z3R A;  4A3J D;  3HOZ D;  3HMX B;  1Y1V D;  1M47 A;  3INK C;  3PIW A;  3I4M D;  4A3G D;  4YDY I;  2O27 A;  5C4X D;  1M4R A;  3B5K A;  4A3I D;  1D9C A;  4BY7 D;  3AYH A;  2B63 D;  1QVN A;  1AU1 A;  3QWR B;  4YPG C;  3L5X A;  3PIV A;  4A3L D;  3N0P A;  4NN5 A;  4PS4 A;  1LQS L;  4BBS D;  3QAZ A;  4WRL B;  4NN7 A;  1HUL A;  1LKI A;  1ITF A;  2R93 D;  1PVH B;  1ILK A;  1ITL A;  1VLK A;  1BGD A;  3D87 A;  3H3V E;  3NCC A;  4A3B D;  5IYD D;  1Y6M L;  2JA5 D;  5KNH I;  1CNT 1;  1WCM D;  3HOW D;  3L5W I;  4A3D D;  1V7N V;  1CYL A;  1CD9 A;  3DGC L;  4LRL A;  3LB6 B;  3TGX B;  1NBP A;  4A3K D;  5D70 A;  4Z5R D;  4CNI C;  2B91 A;  1HWH A;  4EXP A;  2B8Y A;  1ITM A;  3QB7 A;  3UF5 A;  3HOU D;  1PGR A;  1Y6K L;  3DLQ I;  5D28 B;  2JA8 D;  4DKD A;  5L6Y C;  2D9Q A;  1IAR A;  4A3E D;  1BBN A;  4DKF A;  1B5L A;  1IK0 A;  3FKI D;  2B8X A;  5TS9 A;  1PW6 A;  4ZS7 A;  5C7X A;  1BGE A;  1HZI A;  1RHG A;  4O6K A;  4YQX A;  4NI9 A;  1IRL A;  3S9D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...