4GC0A

The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to 6-bromo-6-deoxy-d-glucose
Total Genus 203
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
203
sequence length
475
structure length
475
Chain Sequence
YNSSYIFSITLVATLGGLLFGYDTAVISGTVESLNTVFVAPQNLSESAANSLLGFCVASALIGCIIGGALGGYCSNRFGRRDSLKIAAVLFFISGVGSAWPELGFTSINPDNTVPVYLAGYVPEFVIYRIIGGIGVGLASMLSPMYIAELAPAHIRGKLVSFNQFAIIFGQLLVYCVNYFIARSGDASWLNTDGWRYMFASECIPALLFLMLLYTVPESPRWLMSRGKQEQAEGILRKIMGNTLATQAVQEIKHSLDHGRKTGGRLLMFGVGVIVIGVMLSIFQQFVGINVVLYYAPEVFKTLGASTDIALLQTIIVGVINLTFTVLAIMTVDKFGRKPLQIIGALGMAIGMFSLGTAFYTQAPGIVALLSMLFYVAAFAMSWGPVCWVLLSEIFPNAIRGKALAIAVAAQWLANYFVSWTFPMMDKNSWLVAHFHNGFSYWIYGCMGVLAALFMWKFVPETKGKTLEELEALWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a bacterial homologue of glucose transporters GLUT1-4.
pubmed doi rcsb
molecule keywords D-xylose-proton symporter
molecule tags Transport protein
source organism Escherichia coli
total genus 203
structure length 475
sequence length 475
ec nomenclature
pdb deposition date 2012-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00083 Sugar_tr Sugar (and other) transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1250.20 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; MFS general substrate transporter like domains 4gc0A01
1.20.1250.20 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; MFS general substrate transporter like domains 4gc0A02
4D2BA 4IU8A 4IKVA 5A2NA 5A2OA 4IKZA 4XNJA 5EQIA 4JR9A 1PV7A 5EQGA 4TPHA 2XUTA 3WDOA 2V8NA 3O7QA 4J05A 4TPGA 5GXBA 1PW4A 4YBQA 4YB9D 4JREA 3O7PA 4PYPA 2CFPA 4D2CA 4ZWBA 4GBZA 4QIQA 4TPJA 4JA3A 4IU9A 5D58A 4Q65A 4IKYA 4U4VA 5D59A 5EQHA 4GC0A 4ZYRA 5D6KA 4IKWA 4U4TA 2CFQA 4XNIA 4APSA 4OH3A 1PV6A 4ZW9A 5C65A 4LDSA 4OAAA 4GBYA 4IKXA 4U4WA 4D2DA 4ZWCA 4W6VA 2Y5YA 4UVMA 4LEPA
chains in the Genus database with same CATH superfamily
4YPGC 2LAGA 2KZ1A 5C44D 2R7ZD 4NEMA 3D48P 4O6KA 1ITLA 3SE3B 2Q98A 3OQ3A 5EQHA 1P9MB 3DI2A 4NI7A 2CYKA 2L3OA 4A3DD 3H0GD 4IKVA 4IKZA 1BBNA 2R92D 2XUTA 1PGRA 5D70A 5GXBA 3OG6A 5L6YC 1HUWA 1Y6KL 1HIKA 3PIVA 3NCBA 5FLMD 2IL6A 4IKXA 5D71A 4XNJA 3MZGA 1ITIA 5IP7D 4MHLA 2L3YA 3PIWA 1INRA 4OAAA 5C7XA 4D2BA 1AU1A 4A3ID 4A3MD 2B91A 1V7MV 2JA8D 3HMXB 4DKDA 1EVSA 4IU9A 3B5KA 3BPOA 4IKWA 3LB6A 3QAZA 4OH3A 3HOUD 4YUEC 3D85C 5C3ED 2D48A 1KF9A 2INTA 1PV7A 5EQGA 3H3VE 5FUCA 4NN7A 4BY7D 2Z3QA 3UEZE 1BGCA 2HYMB 4JA3A 1GA3A 4IKYA 3SE4B 5KNHI 4XNIA 4I77Z 4IU8A 1ITMA 1PVHB 1RFBA 1WCMD 3WDOA 1BUYA 4FA8E 1CN4C 2C35A 1CNT1 3DI3A 1CSGA 1Y1WD 5C4XD 3LB6B 3BPNA 1ITFA 5D59A 4CNIC 1IJZA 4U4TA 1I1RB 3QT2C 4RS1A 3UF2A 1AXIA 2H24A 2B63D 4A3LD 1M4AA 4YBQA 3HHRA 1BP3A 4ZF7A 2CFPA 4X51A 1Z92A 4Q65A 3NPZA 4ZS7A 1Y1VD 1ETEA 1V7NV 3I4MD 5C65A 4BXXD 1AX8A 2VUMD 1IARA 2B8UA 4YQXA 4O9HA 5D22A 4A3JD 3O7PA 3Q1SI 3QWRB 3NCEA 4A3FD 2B8ZA 3HOYD 4QIQA 3HOVD 3HOXD 1CD9A 3N0PA 3OG4A 1M47A 1PV6A 5IYDD 4LRLA 1M4CA 2OQPA 1ALUA 2PSMA 1HGUA 1Y6ML 4NN6A 1M48A 5IP9D 1EERA 1YKBA 1B5LA 3UX9A 3G6DA 4TPJA 1Y6NL 2LMSA 4U4VA 2R93D 1EXZA 4A3CD 4APSA 1RHGA 4U4WA 4ZWCA 1HWHA 3AYHA 1SCFA 2Q7NB 4TPHA 3HOWD 4BBRD 3DUHC 1PW4A 4BBSD 2B8XA 4JREA 1FYHA 2B8YA 1BGDA 1PY2A 4D2CA 3HOZD 3L5XA 1NBPA 2ERJD 3L5WI 3D87A 3UF5A 3INKC 1A7MA 3QB7A 2O6IA 4NKQC 3G9VB 3TGXB 4A3GD 4DKFA 5E4EA 1M4RA 2B5IA 1HULA 1D9CA 1ILKA 4A3KD 4W6VA 3NCCA 2Q14A 1F6FA 5A2NA 5A2OA 1Z7CA 4TPGA 1QVNA 4YB9D 3BESL 4BY1D 2JA5D 2JA6D 2D9QA 4A3BD 1IRLA 1IK0A 4DKCA 4A3ED 1D9GA 3VA2A 4DOHA 4LDSA 3DGCL 4J4LC 4UVMA 1EKUA 3NCFA 1M4BA 5D28B 2O27A 4A93D 1HWGA 3EW3A 3I4ND 4GRWA 1N1FA 1CYLA 2ILKA 4GC0A 3N06A 4Z5RD 4GBYA 1PW6A 4EXPA 4YDYI 1LK3A 5EQIA 3HHCA 3PO3D 4NI9A 3O7QA 4GS7A 5D72A 4PYPA 2Z3RA 4GBZA 1JLIA 4ZYRA 1LQSL 3FKID 3S9DA 2CFQA 1GNCA 1EMRA 2O26A 4ZW9A 1M49A 5FHXA 5IYCD 3EJJA 2Y5YA 4LEPA 1VLKA 4JR9A 1LKIA 1BGEA 4J05A 1RCBA 4ZWBA 3PO2D 1HIJA 1A22A 5TS9A 1WU3I 2E9WC 3DLQI 4DKEA 4D2DA 2GMFA 1FG9A 5LQBA 1BCNA 2V8NA 4NN5A 4NEJA 1IL6A 4PS4A 3BPLA 5IYBD 4WRLB 2JA7D 1Y14A 3IRHA 1RW5A 1HZIA 5D58A 1J7VL 5D6KA 3WCYI 4EXNA 2B90A 2XQBA 1F45B 3QB1A
chains in the Genus database with same CATH topology
4D2BA 4IU8A 4IKVA 5A2NA 5A2OA 4IKZA 4XNJA 5EQIA 4JR9A 1PV7A 5EQGA 4TPHA 2XUTA 3WDOA 2V8NA 3O7QA 4J05A 4TPGA 5GXBA 1PW4A 4YBQA 4YB9D 4JREA 3O7PA 4PYPA 2CFPA 4D2CA 4ZWBA 4GBZA 4QIQA 4TPJA 4JA3A 4IU9A 5D58A 4Q65A 4IKYA 4U4VA 5D59A 5EQHA 4GC0A 4ZYRA 5D6KA 4IKWA 4U4TA 2CFQA 4XNIA 4APSA 4OH3A 1PV6A 4ZW9A 5C65A 4LDSA 4OAAA 4GBYA 4IKXA 4U4WA 4D2DA 4ZWCA 4W6VA 2Y5YA 4UVMA 4LEPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D2B A;  4IU8 A;  4IKV A;  5A2N A;  5A2O A;  4IKZ A;  4XNJ A;  5EQI A;  4JR9 A;  1PV7 A;  5EQG A;  4TPH A;  2XUT A;  3WDO A;  2V8N A;  3O7Q A;  4J05 A;  4TPG A;  5GXB A;  1PW4 A;  4YBQ A;  4YB9 D;  4JRE A;  3O7P A;  4PYP A;  2CFP A;  4D2C A;  4ZWB A;  4GBZ A;  4QIQ A;  4TPJ A;  4JA3 A;  4IU9 A;  5D58 A;  4Q65 A;  4IKY A;  4U4V A;  5D59 A;  5EQH A;  4GC0 A;  4ZYR A;  5D6K A;  4IKW A;  4U4T A;  2CFQ A;  4XNI A;  4APS A;  4OH3 A;  1PV6 A;  4ZW9 A;  5C65 A;  4LDS A;  4OAA A;  4GBY A;  4IKX A;  4U4W A;  4D2D A;  4ZWC A;  4W6V A;  2Y5Y A;  4UVM A;  4LEP A; 
#chains in the Genus database with same CATH topology
 4YPG C;  2LAG A;  2KZ1 A;  5C44 D;  2R7Z D;  4NEM A;  3D48 P;  4O6K A;  1ITL A;  3SE3 B;  2Q98 A;  3OQ3 A;  5EQH A;  1P9M B;  3DI2 A;  4NI7 A;  2CYK A;  2L3O A;  4A3D D;  3H0G D;  4IKV A;  4IKZ A;  1BBN A;  2R92 D;  2XUT A;  1PGR A;  5D70 A;  5GXB A;  3OG6 A;  5L6Y C;  1HUW A;  1Y6K L;  1HIK A;  3PIV A;  3NCB A;  5FLM D;  2IL6 A;  4IKX A;  5D71 A;  4XNJ A;  3MZG A;  1ITI A;  5IP7 D;  4MHL A;  2L3Y A;  3PIW A;  1INR A;  4OAA A;  5C7X A;  4D2B A;  1AU1 A;  4A3I D;  4A3M D;  2B91 A;  1V7M V;  2JA8 D;  3HMX B;  4DKD A;  1EVS A;  4IU9 A;  3B5K A;  3BPO A;  4IKW A;  3LB6 A;  3QAZ A;  4OH3 A;  3HOU D;  4YUE C;  3D85 C;  5C3E D;  2D48 A;  1KF9 A;  2INT A;  1PV7 A;  5EQG A;  3H3V E;  5FUC A;  4NN7 A;  4BY7 D;  2Z3Q A;  3UEZ E;  1BGC A;  2HYM B;  4JA3 A;  1GA3 A;  4IKY A;  3SE4 B;  5KNH I;  4XNI A;  4I77 Z;  4IU8 A;  1ITM A;  1PVH B;  1RFB A;  1WCM D;  3WDO A;  1BUY A;  4FA8 E;  1CN4 C;  2C35 A;  1CNT 1;  3DI3 A;  1CSG A;  1Y1W D;  5C4X D;  3LB6 B;  3BPN A;  1ITF A;  5D59 A;  4CNI C;  1IJZ A;  4U4T A;  1I1R B;  3QT2 C;  4RS1 A;  3UF2 A;  1AXI A;  2H24 A;  2B63 D;  4A3L D;  1M4A A;  4YBQ A;  3HHR A;  1BP3 A;  4ZF7 A;  2CFP A;  4X51 A;  1Z92 A;  4Q65 A;  3NPZ A;  4ZS7 A;  1Y1V D;  1ETE A;  1V7N V;  3I4M D;  5C65 A;  4BXX D;  1AX8 A;  2VUM D;  1IAR A;  2B8U A;  4YQX A;  4O9H A;  5D22 A;  4A3J D;  3O7P A;  3Q1S I;  3QWR B;  3NCE A;  4A3F D;  2B8Z A;  3HOY D;  4QIQ A;  3HOV D;  3HOX D;  1CD9 A;  3N0P A;  3OG4 A;  1M47 A;  1PV6 A;  5IYD D;  4LRL A;  1M4C A;  2OQP A;  1ALU A;  2PSM A;  1HGU A;  1Y6M L;  4NN6 A;  1M48 A;  5IP9 D;  1EER A;  1YKB A;  1B5L A;  3UX9 A;  3G6D A;  4TPJ A;  1Y6N L;  2LMS A;  4U4V A;  2R93 D;  1EXZ A;  4A3C D;  4APS A;  1RHG A;  4U4W A;  4ZWC A;  1HWH A;  3AYH A;  1SCF A;  2Q7N B;  4TPH A;  3HOW D;  4BBR D;  3DUH C;  1PW4 A;  4BBS D;  2B8X A;  4JRE A;  1FYH A;  2B8Y A;  1BGD A;  1PY2 A;  4D2C A;  3HOZ D;  3L5X A;  1NBP A;  2ERJ D;  3L5W I;  3D87 A;  3UF5 A;  3INK C;  1A7M A;  3QB7 A;  2O6I A;  4NKQ C;  3G9V B;  3TGX B;  4A3G D;  4DKF A;  5E4E A;  1M4R A;  2B5I A;  1HUL A;  1D9C A;  1ILK A;  4A3K D;  4W6V A;  3NCC A;  2Q14 A;  1F6F A;  5A2N A;  5A2O A;  1Z7C A;  4TPG A;  1QVN A;  4YB9 D;  3BES L;  4BY1 D;  2JA5 D;  2JA6 D;  2D9Q A;  4A3B D;  1IRL A;  1IK0 A;  4DKC A;  4A3E D;  1D9G A;  3VA2 A;  4DOH A;  4LDS A;  3DGC L;  4J4L C;  4UVM A;  1EKU A;  3NCF A;  1M4B A;  5D28 B;  2O27 A;  4A93 D;  1HWG A;  3EW3 A;  3I4N D;  4GRW A;  1N1F A;  1CYL A;  2ILK A;  4GC0 A;  3N06 A;  4Z5R D;  4GBY A;  1PW6 A;  4EXP A;  4YDY I;  1LK3 A;  5EQI A;  3HHC A;  3PO3 D;  4NI9 A;  3O7Q A;  4GS7 A;  5D72 A;  4PYP A;  2Z3R A;  4GBZ A;  1JLI A;  4ZYR A;  1LQS L;  3FKI D;  3S9D A;  2CFQ A;  1GNC A;  1EMR A;  2O26 A;  4ZW9 A;  1M49 A;  5FHX A;  5IYC D;  3EJJ A;  2Y5Y A;  4LEP A;  1VLK A;  4JR9 A;  1LKI A;  1BGE A;  4J05 A;  1RCB A;  4ZWB A;  3PO2 D;  1HIJ A;  1A22 A;  5TS9 A;  1WU3 I;  2E9W C;  3DLQ I;  4DKE A;  4D2D A;  2GMF A;  1FG9 A;  5LQB A;  1BCN A;  2V8N A;  4NN5 A;  4NEJ A;  1IL6 A;  4PS4 A;  3BPL A;  5IYB D;  4WRL B;  2JA7 D;  1Y14 A;  3IRH A;  1RW5 A;  1HZI A;  5D58 A;  1J7V L;  5D6K A;  3WCY I;  4EXN A;  2B90 A;  2XQB A;  1F45 B;  3QB1 A; 
#chains in the Genus database with same CATH homology
 4D2B A;  4IU8 A;  4IKV A;  5A2N A;  5A2O A;  4IKZ A;  4XNJ A;  5EQI A;  4JR9 A;  1PV7 A;  5EQG A;  4TPH A;  2XUT A;  3WDO A;  2V8N A;  3O7Q A;  4J05 A;  4TPG A;  5GXB A;  1PW4 A;  4YBQ A;  4YB9 D;  4JRE A;  3O7P A;  4PYP A;  2CFP A;  4D2C A;  4ZWB A;  4GBZ A;  4QIQ A;  4TPJ A;  4JA3 A;  4IU9 A;  5D58 A;  4Q65 A;  4IKY A;  4U4V A;  5D59 A;  5EQH A;  4GC0 A;  4ZYR A;  5D6K A;  4IKW A;  4U4T A;  2CFQ A;  4XNI A;  4APS A;  4OH3 A;  1PV6 A;  4ZW9 A;  5C65 A;  4LDS A;  4OAA A;  4GBY A;  4IKX A;  4U4W A;  4D2D A;  4ZWC A;  4W6V A;  2Y5Y A;  4UVM A;  4LEP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...