3B5KA

Crystal structure of murine interleukin-5
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
105
structure length
105
Chain Sequence
TSTVVKETLTQLSAHRALLTSNETLRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVERLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVLSTEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of murine interleukin-5
rcsb
molecule keywords Interleukin-5
molecule tags Cytokine
source organism Mus musculus
total genus 30
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02025 IL5 Interleukin 5
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1250.10 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; Growth Hormone; Chain: A; 3b5kA00
2B8UA 3NCEA 1M48A 1BGDA 3EW3A 1ALUA 1M4BA 3QB1A 3D87A 1F6FA 2GMFA 1Y6NL 4YQXA 3SE3B 3VA2A 1CNT1 2B8YA 2ERJD 3BPLA 3B5KA 2D48A 3UF2A 1WU3I 1F45B 1BCNA 3UEZE 1BGEA 3L5XA 1M4RA 3INKC 3UX9A 1HZIA 2D9QA 5L6YC 2O27A 2IL6A 1V7NV 3BESL 1HWGA 1FYHA 1RCBA 2L3OA 1Y6KL 5D22A 2B91A 1CYLA 1EERA 1NBPA 4J4LC 3WCYI 1B5LA 1PW6A 4FA8E 3MZGA 1RW5A 1FG9A 3D48P 3HHRA 4Z5RD 1HWHA 2E9WC 3DUHC 3HMXB 4WRLB 3DGCL 4NI9A 3QAZA 4NEJA 1GA3A 2B5IA 1M47A 3G9VB 4YUEC 1LQSL 5E4EA 2CYKA 1M49A 4NEMA 1I1RB 4NI7A 3S9DA 1YKBA 1IK0A 5LQBA 1HULA 4ZS7A 3UF5A 1AX8A 3BPNA 4GRWA 1SCFA 2H24A 1ILKA 2LMSA 3NCFA 1GNCA 1RFBA 4O9HA 4ZF7A 3NCBA 4PS4A 2B90A 2B8ZA 4MHLA 5D72A 1IRLA 1AU1A 5FHXA 4RS1A 1QVNA 4DOHA 1LKIA 2O26A 3NPZA 3EJJA 2L3YA 1BUYA 1INRA 4O6KA 1CSGA 1A22A 2Q7NB 1Z92A 2B8XA 1EXZA 1IL6A 5KNHI 1PY2A 1EMRA 4I77Z 1D9CA 1ITFA 3G6DA 1Y6ML 1RHGA 4YPGC 3SE4B 1ETEA 4X51A 1CN4C 1P9MB 5D70A 4YDYI 1HUWA 1ITLA 1JLIA 1J7VL 5C7XA 1ITIA 1HIKA 5FUCA 1VLKA 2Q98A 3Q1SI 1N1FA 1Z7CA 1M4CA 1CD9A 1HIJA 1ITMA 3OQ3A 3LB6B 3PIVA 5D28B 1PVHB 3NCCA 3QT2C 2HYMB 3QB7A 1BBNA 1HGUA 3N06A 3N0PA 1D9GA 1KF9A 1A7MA 1M4AA 5D71A 2INTA 1EKUA 1BP3A 1IJZA 3LB6A 3PIWA 2ILKA 1IARA 1BGCA 3QWRB 1AXIA 3BPOA 1V7MV 2LAGA 1LK3A 1PGRA 1EVSA 3DLQI 4NKQC 4CNIC 3D85C 2KZ1A 3L5WI
chains in the Genus database with same CATH superfamily
1M48A 1ALUA 2VUMD 1Y6NL 4D2CA 1CNT1 3BPLA 4NN6A 1WU3I 1F45B 4Q65A 1BCNA 4PYPA 1BGEA 1M4RA 3UX9A 2D9QA 5L6YC 1V7NV 5D59A 1PV7A 4BBRD 3H3VE 4YBQA 2B91A 4IU8A 1EERA 4J4LC 3H0GD 4FA8E 5A2OA 3HHRA 4Z5RD 4DKDA 3FKID 3DGCL 1PV6A 4NEJA 3HOVD 5E4EA 1I1RB 4NI7A 5LQBA 1HULA 4IKXA 3IRHA 4ZF7A 3OG4A 4A93D 4NN5A 4RS1A 2XUTA 3PO3D 1INRA 1CSGA 5EQGA 2Q7NB 1Z92A 3DI3A 1IL6A 5GXBA 5IYCD 1CN4C 2V8NA 5D6KA 4A3MD 1Z7CA 3TGXB 4TPJA 1PVHB 3NCCA 3QT2C 3QB7A 1BBNA 4U4TA 3N06A 3N0PA 4GC0A 1BP3A 3PO2D 2O6IA 1Y1VD 2ILKA 3QWRB 4J05A 4NKQC 4GBZA 3NCEA 1M4BA 4GS7A 4YQXA 3SE3B 3VA2A 2B8YA 3B5KA 2D48A 3UF2A 4APSA 3UEZE 3INKC 4ZWCA 4BBSD 3WDOA 1PW6A 4OAAA 3O7PA 4DKCA 4BXXD 3I4MD 1HWHA 3HMXB 4A3GD 4WRLB 4A3BD 3QAZA 4YB9D 4QIQA 5A2NA 2B5IA 2CFQA 2R93D 2CYKA 4NEMA 1IK0A 1YKBA 4JREA 4A3ID 3BPNA 4GRWA 2H24A 4U4VA 2LMSA 3NCFA 5IP9D 1RFBA 4O9HA 4D2BA 4W6VA 2B90A 4LEPA 5IP7D 1LKIA 2O26A 1PW4A 4A3LD 1EXZA 5KNHI 5IYDD 2OQPA 4BY1D 4I77Z 3G6DA 4YPGC 4BY7D 4X51A 1HUWA 1JLIA 5C7XA 1ITIA 2Q98A 3I4ND 3PIVA 1CD9A 3LB6B 4A3CD 1HGUA 5D58A 1D9GA 1KF9A 1M4AA 4A3FD 1IJZA 3LB6A 4TPGA 1AXIA 1V7MV 1LK3A 4OH3A 4TPHA 3L5WI 4XNIA 1BGDA 5FLMD 2ERJD 3HOYD 4DKEA 2O27A 1HWGA 4XNJA 4JR9A 1FYHA 1RCBA 2L3OA 4ZW9A 3AYHA 2R7ZD 4IU9A 1CYLA 1NBPA 3WCYI 1B5LA 1Y14A 1FG9A 2JA5D 2E9WC 4NI9A 1M47A 3G9VB 4YUEC 4EXNA 1WCMD 4IKWA 4NN7A 2R92D 3DI2A 1GNCA 4PS4A 2B8ZA 4MHLA 1IRLA 1AU1A 5FHXA 1QVNA 3HOWD 4DOHA 3EJJA 1BUYA 3OG6A 4O6KA 5TS9A 2Q14A 2B63D 1ITFA 1RHGA 1Y6ML 1ETEA 5D70A 4YDYI 5C65A 5IYBD 3Q1SI 1M4CA 1HIJA 5C3ED 4UVMA 1A7MA 3HOUD 1EKUA 1IARA 3BPOA 2LAGA 4A3KD 1PGRA 1EVSA 2C35A 2KZ1A 2B8UA 4D2DA 2PSMA 3EW3A 3QB1A 3D87A 1F6FA 2GMFA 4JA3A 3HOXD 3L5XA 1HZIA 2IL6A 3BESL 5C44D 2Z3QA 5EQIA 1Y6KL 5D22A 4DKFA 4EXPA 3MZGA 1RW5A 3D48P 5EQHA 3DUHC 4A3JD 4IKVA 1GA3A 1LQSL 4IKYA 2XQBA 1M49A 4GBYA 3S9DA 4LRLA 4ZS7A 3UF5A 1AX8A 1SCFA 1ILKA 4A3ED 3HOZD 3NCBA 4ZWBA 5D72A 4ZYRA 3NPZA 2L3YA 1A22A 2B8XA 1Y1WD 1PY2A 1EMRA 1D9CA 3SE4B 2Z3RA 1P9MB 4A3DD 5C4XD 1ITLA 1J7VL 1HIKA 5FUCA 1VLKA 1N1FA 3HHCA 3OQ3A 1ITMA 5D28B 2CFPA 2HYMB 2Y5YA 4LDSA 4IKZA 2JA6D 5D71A 2INTA 3PIWA 4U4WA 2JA7D 2JA8D 1BGCA 3DLQI 3O7QA 4CNIC 3D85C
chains in the Genus database with same CATH topology
2B8UA 3NCEA 1M48A 2PSMA 1BGDA 3EW3A 1ALUA 1M4BA 3QB1A 4GS7A 2VUMD 3D87A 5FLMD 1F6FA 2GMFA 1Y6NL 4YQXA 3SE3B 3VA2A 1CNT1 2B8YA 2ERJD 3BPLA 3B5KA 4NN6A 2D48A 3UF2A 3HOYD 1WU3I 1IK0A 1F45B 1BCNA 3UEZE 3HOXD 1BGEA 3L5XA 1M4RA 4DKEA 3INKC 3UX9A 1HZIA 2D9QA 5L6YC 2O27A 2IL6A 1V7NV 3BESL 1HWGA 5C44D 2Z3QA 1FYHA 1RCBA 2L3OA 4BBRD 3H3VE 3AYHA 2R7ZD 1Y6KL 5D22A 2B91A 1CYLA 1EERA 1NBPA 4J4LC 3WCYI 1B5LA 4BBSD 4DKFA 3H0GD 1PW6A 4FA8E 4EXPA 1Y14A 3MZGA 1RW5A 4DKCA 1FG9A 3D48P 4BXXD 3HHRA 4Z5RD 4DKDA 2JA5D 3I4MD 1HWHA 2E9WC 3DUHC 3HMXB 4A3GD 4WRLB 3FKID 3DGCL 4A3BD 4NI9A 3QAZA 4A3JD 4NEJA 1GA3A 2B5IA 1M47A 3G9VB 4YUEC 1LQSL 4EXNA 2XQBA 1WCMD 5E4EA 2CYKA 3HOVD 1M49A 4NEMA 2R93D 1I1RB 4NI7A 3S9DA 1YKBA 4LRLA 4NN7A 5LQBA 1HULA 4ZS7A 2R92D 3UF5A 4A3ID 1AX8A 3D85C 3BPNA 3DI2A 3IRHA 4GRWA 1SCFA 2H24A 1ILKA 2LMSA 3NCFA 5IP9D 4A3ED 1RFBA 1GNCA 4O9HA 3HOZD 4ZF7A 3NCBA 4PS4A 2B90A 2B8ZA 4MHLA 3OG4A 5D72A 1IRLA 1AU1A 5FHXA 5IP7D 4A93D 4NN5A 4RS1A 1QVNA 3HOWD 4DOHA 1LKIA 3PO3D 2O26A 3NPZA 3EJJA 2L3YA 1BUYA 1INRA 3OG6A 1CSGA 4O6KA 1A22A 2Q7NB 4A3LD 1Z92A 5TS9A 2B8XA 1EXZA 2Q14A 3DI3A 1IL6A 5KNHI 5IYDD 2OQPA 1Y1WD 1PY2A 1EMRA 4I77Z 4BY1D 5IYCD 1D9CA 2B63D 1ITFA 3G6DA 1RHGA 1Y6ML 4YPGC 3SE4B 2Z3RA 1ETEA 4X51A 1CN4C 1P9MB 5D70A 4YDYI 4A3DD 4BY7D 5C4XD 1HUWA 1ITLA 1JLIA 1J7VL 5C7XA 4A3MD 5IYBD 1ITIA 1HIKA 5FUCA 1VLKA 2Q98A 3Q1SI 1N1FA 1Z7CA 3HHCA 3I4ND 1M4CA 1CD9A 1HIJA 1ITMA 3OQ3A 3LB6B 3PIVA 3TGXB 5D28B 1PVHB 5C3ED 3NCCA 3QT2C 2HYMB 4A3CD 3QB7A 1BBNA 1HGUA 3N06A 3N0PA 1D9GA 2JA6D 1KF9A 1A7MA 1M4AA 5D71A 4A3FD 2INTA 3HOUD 1EKUA 3PO2D 1BP3A 2O6IA 1IJZA 3LB6A 3PIWA 1Y1VD 2ILKA 2JA7D 1IARA 2JA8D 1BGCA 3QWRB 1AXIA 3BPOA 1V7MV 2LAGA 4A3KD 1LK3A 1PGRA 1EVSA 3DLQI 4NKQC 4CNIC 2C35A 2KZ1A 3L5WI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B8U A;  3NCE A;  1M48 A;  1BGD A;  3EW3 A;  1ALU A;  1M4B A;  3QB1 A;  3D87 A;  1F6F A;  2GMF A;  1Y6N L;  4YQX A;  3SE3 B;  3VA2 A;  1CNT 1;  2B8Y A;  2ERJ D;  3BPL A;  3B5K A;  2D48 A;  3UF2 A;  1WU3 I;  1F45 B;  1BCN A;  3UEZ E;  1BGE A;  3L5X A;  1M4R A;  3INK C;  3UX9 A;  1HZI A;  2D9Q A;  5L6Y C;  2O27 A;  2IL6 A;  1V7N V;  3BES L;  1HWG A;  1FYH A;  1RCB A;  2L3O A;  1Y6K L;  5D22 A;  2B91 A;  1CYL A;  1EER A;  1NBP A;  4J4L C;  3WCY I;  1B5L A;  1PW6 A;  4FA8 E;  3MZG A;  1RW5 A;  1FG9 A;  3D48 P;  3HHR A;  4Z5R D;  1HWH A;  2E9W C;  3DUH C;  3HMX B;  4WRL B;  3DGC L;  4NI9 A;  3QAZ A;  4NEJ A;  1GA3 A;  2B5I A;  1M47 A;  3G9V B;  4YUE C;  1LQS L;  5E4E A;  2CYK A;  1M49 A;  4NEM A;  1I1R B;  4NI7 A;  3S9D A;  1YKB A;  1IK0 A;  5LQB A;  1HUL A;  4ZS7 A;  3UF5 A;  1AX8 A;  3BPN A;  4GRW A;  1SCF A;  2H24 A;  1ILK A;  2LMS A;  3NCF A;  1GNC A;  1RFB A;  4O9H A;  4ZF7 A;  3NCB A;  4PS4 A;  2B90 A;  2B8Z A;  4MHL A;  5D72 A;  1IRL A;  1AU1 A;  5FHX A;  4RS1 A;  1QVN A;  4DOH A;  1LKI A;  2O26 A;  3NPZ A;  3EJJ A;  2L3Y A;  1BUY A;  1INR A;  4O6K A;  1CSG A;  1A22 A;  2Q7N B;  1Z92 A;  2B8X A;  1EXZ A;  1IL6 A;  5KNH I;  1PY2 A;  1EMR A;  4I77 Z;  1D9C A;  1ITF A;  3G6D A;  1Y6M L;  1RHG A;  4YPG C;  3SE4 B;  1ETE A;  4X51 A;  1CN4 C;  1P9M B;  5D70 A;  4YDY I;  1HUW A;  1ITL A;  1JLI A;  1J7V L;  5C7X A;  1ITI A;  1HIK A;  5FUC A;  1VLK A;  2Q98 A;  3Q1S I;  1N1F A;  1Z7C A;  1M4C A;  1CD9 A;  1HIJ A;  1ITM A;  3OQ3 A;  3LB6 B;  3PIV A;  5D28 B;  1PVH B;  3NCC A;  3QT2 C;  2HYM B;  3QB7 A;  1BBN A;  1HGU A;  3N06 A;  3N0P A;  1D9G A;  1KF9 A;  1A7M A;  1M4A A;  5D71 A;  2INT A;  1EKU A;  1BP3 A;  1IJZ A;  3LB6 A;  3PIW A;  2ILK A;  1IAR A;  1BGC A;  3QWR B;  1AXI A;  3BPO A;  1V7M V;  2LAG A;  1LK3 A;  1PGR A;  1EVS A;  3DLQ I;  4NKQ C;  4CNI C;  3D85 C;  2KZ1 A;  3L5W I; 
#chains in the Genus database with same CATH topology
 1M48 A;  1ALU A;  2VUM D;  1Y6N L;  4D2C A;  1CNT 1;  3BPL A;  4NN6 A;  1WU3 I;  1F45 B;  4Q65 A;  1BCN A;  4PYP A;  1BGE A;  1M4R A;  3UX9 A;  2D9Q A;  5L6Y C;  1V7N V;  5D59 A;  1PV7 A;  4BBR D;  3H3V E;  4YBQ A;  2B91 A;  4IU8 A;  1EER A;  4J4L C;  3H0G D;  4FA8 E;  5A2O A;  3HHR A;  4Z5R D;  4DKD A;  3FKI D;  3DGC L;  1PV6 A;  4NEJ A;  3HOV D;  5E4E A;  1I1R B;  4NI7 A;  5LQB A;  1HUL A;  4IKX A;  3IRH A;  4ZF7 A;  3OG4 A;  4A93 D;  4NN5 A;  4RS1 A;  2XUT A;  3PO3 D;  1INR A;  1CSG A;  5EQG A;  2Q7N B;  1Z92 A;  3DI3 A;  1IL6 A;  5GXB A;  5IYC D;  1CN4 C;  2V8N A;  5D6K A;  4A3M D;  1Z7C A;  3TGX B;  4TPJ A;  1PVH B;  3NCC A;  3QT2 C;  3QB7 A;  1BBN A;  4U4T A;  3N06 A;  3N0P A;  4GC0 A;  1BP3 A;  3PO2 D;  2O6I A;  1Y1V D;  2ILK A;  3QWR B;  4J05 A;  4NKQ C;  4GBZ A;  3NCE A;  1M4B A;  4GS7 A;  4YQX A;  3SE3 B;  3VA2 A;  2B8Y A;  3B5K A;  2D48 A;  3UF2 A;  4APS A;  3UEZ E;  3INK C;  4ZWC A;  4BBS D;  3WDO A;  1PW6 A;  4OAA A;  3O7P A;  4DKC A;  4BXX D;  3I4M D;  1HWH A;  3HMX B;  4A3G D;  4WRL B;  4A3B D;  3QAZ A;  4YB9 D;  4QIQ A;  5A2N A;  2B5I A;  2CFQ A;  2R93 D;  2CYK A;  4NEM A;  1IK0 A;  1YKB A;  4JRE A;  4A3I D;  3BPN A;  4GRW A;  2H24 A;  4U4V A;  2LMS A;  3NCF A;  5IP9 D;  1RFB A;  4O9H A;  4D2B A;  4W6V A;  2B90 A;  4LEP A;  5IP7 D;  1LKI A;  2O26 A;  1PW4 A;  4A3L D;  1EXZ A;  5KNH I;  5IYD D;  2OQP A;  4BY1 D;  4I77 Z;  3G6D A;  4YPG C;  4BY7 D;  4X51 A;  1HUW A;  1JLI A;  5C7X A;  1ITI A;  2Q98 A;  3I4N D;  3PIV A;  1CD9 A;  3LB6 B;  4A3C D;  1HGU A;  5D58 A;  1D9G A;  1KF9 A;  1M4A A;  4A3F D;  1IJZ A;  3LB6 A;  4TPG A;  1AXI A;  1V7M V;  1LK3 A;  4OH3 A;  4TPH A;  3L5W I;  4XNI A;  1BGD A;  5FLM D;  2ERJ D;  3HOY D;  4DKE A;  2O27 A;  1HWG A;  4XNJ A;  4JR9 A;  1FYH A;  1RCB A;  2L3O A;  4ZW9 A;  3AYH A;  2R7Z D;  4IU9 A;  1CYL A;  1NBP A;  3WCY I;  1B5L A;  1Y14 A;  1FG9 A;  2JA5 D;  2E9W C;  4NI9 A;  1M47 A;  3G9V B;  4YUE C;  4EXN A;  1WCM D;  4IKW A;  4NN7 A;  2R92 D;  3DI2 A;  1GNC A;  4PS4 A;  2B8Z A;  4MHL A;  1IRL A;  1AU1 A;  5FHX A;  1QVN A;  3HOW D;  4DOH A;  3EJJ A;  1BUY A;  3OG6 A;  4O6K A;  5TS9 A;  2Q14 A;  2B63 D;  1ITF A;  1RHG A;  1Y6M L;  1ETE A;  5D70 A;  4YDY I;  5C65 A;  5IYB D;  3Q1S I;  1M4C A;  1HIJ A;  5C3E D;  4UVM A;  1A7M A;  3HOU D;  1EKU A;  1IAR A;  3BPO A;  2LAG A;  4A3K D;  1PGR A;  1EVS A;  2C35 A;  2KZ1 A;  2B8U A;  4D2D A;  2PSM A;  3EW3 A;  3QB1 A;  3D87 A;  1F6F A;  2GMF A;  4JA3 A;  3HOX D;  3L5X A;  1HZI A;  2IL6 A;  3BES L;  5C44 D;  2Z3Q A;  5EQI A;  1Y6K L;  5D22 A;  4DKF A;  4EXP A;  3MZG A;  1RW5 A;  3D48 P;  5EQH A;  3DUH C;  4A3J D;  4IKV A;  1GA3 A;  1LQS L;  4IKY A;  2XQB A;  1M49 A;  4GBY A;  3S9D A;  4LRL A;  4ZS7 A;  3UF5 A;  1AX8 A;  1SCF A;  1ILK A;  4A3E D;  3HOZ D;  3NCB A;  4ZWB A;  5D72 A;  4ZYR A;  3NPZ A;  2L3Y A;  1A22 A;  2B8X A;  1Y1W D;  1PY2 A;  1EMR A;  1D9C A;  3SE4 B;  2Z3R A;  1P9M B;  4A3D D;  5C4X D;  1ITL A;  1J7V L;  1HIK A;  5FUC A;  1VLK A;  1N1F A;  3HHC A;  3OQ3 A;  1ITM A;  5D28 B;  2CFP A;  2HYM B;  2Y5Y A;  4LDS A;  4IKZ A;  2JA6 D;  5D71 A;  2INT A;  3PIW A;  4U4W A;  2JA7 D;  2JA8 D;  1BGC A;  3DLQ I;  3O7Q A;  4CNI C;  3D85 C; 
#chains in the Genus database with same CATH homology
 2B8U A;  3NCE A;  1M48 A;  2PSM A;  1BGD A;  3EW3 A;  1ALU A;  1M4B A;  3QB1 A;  4GS7 A;  2VUM D;  3D87 A;  5FLM D;  1F6F A;  2GMF A;  1Y6N L;  4YQX A;  3SE3 B;  3VA2 A;  1CNT 1;  2B8Y A;  2ERJ D;  3BPL A;  3B5K A;  4NN6 A;  2D48 A;  3UF2 A;  3HOY D;  1WU3 I;  1IK0 A;  1F45 B;  1BCN A;  3UEZ E;  3HOX D;  1BGE A;  3L5X A;  1M4R A;  4DKE A;  3INK C;  3UX9 A;  1HZI A;  2D9Q A;  5L6Y C;  2O27 A;  2IL6 A;  1V7N V;  3BES L;  1HWG A;  5C44 D;  2Z3Q A;  1FYH A;  1RCB A;  2L3O A;  4BBR D;  3H3V E;  3AYH A;  2R7Z D;  1Y6K L;  5D22 A;  2B91 A;  1CYL A;  1EER A;  1NBP A;  4J4L C;  3WCY I;  1B5L A;  4BBS D;  4DKF A;  3H0G D;  1PW6 A;  4FA8 E;  4EXP A;  1Y14 A;  3MZG A;  1RW5 A;  4DKC A;  1FG9 A;  3D48 P;  4BXX D;  3HHR A;  4Z5R D;  4DKD A;  2JA5 D;  3I4M D;  1HWH A;  2E9W C;  3DUH C;  3HMX B;  4A3G D;  4WRL B;  3FKI D;  3DGC L;  4A3B D;  4NI9 A;  3QAZ A;  4A3J D;  4NEJ A;  1GA3 A;  2B5I A;  1M47 A;  3G9V B;  4YUE C;  1LQS L;  4EXN A;  2XQB A;  1WCM D;  5E4E A;  2CYK A;  3HOV D;  1M49 A;  4NEM A;  2R93 D;  1I1R B;  4NI7 A;  3S9D A;  1YKB A;  4LRL A;  4NN7 A;  5LQB A;  1HUL A;  4ZS7 A;  2R92 D;  3UF5 A;  4A3I D;  1AX8 A;  3D85 C;  3BPN A;  3DI2 A;  3IRH A;  4GRW A;  1SCF A;  2H24 A;  1ILK A;  2LMS A;  3NCF A;  5IP9 D;  4A3E D;  1RFB A;  1GNC A;  4O9H A;  3HOZ D;  4ZF7 A;  3NCB A;  4PS4 A;  2B90 A;  2B8Z A;  4MHL A;  3OG4 A;  5D72 A;  1IRL A;  1AU1 A;  5FHX A;  5IP7 D;  4A93 D;  4NN5 A;  4RS1 A;  1QVN A;  3HOW D;  4DOH A;  1LKI A;  3PO3 D;  2O26 A;  3NPZ A;  3EJJ A;  2L3Y A;  1BUY A;  1INR A;  3OG6 A;  1CSG A;  4O6K A;  1A22 A;  2Q7N B;  4A3L D;  1Z92 A;  5TS9 A;  2B8X A;  1EXZ A;  2Q14 A;  3DI3 A;  1IL6 A;  5KNH I;  5IYD D;  2OQP A;  1Y1W D;  1PY2 A;  1EMR A;  4I77 Z;  4BY1 D;  5IYC D;  1D9C A;  2B63 D;  1ITF A;  3G6D A;  1RHG A;  1Y6M L;  4YPG C;  3SE4 B;  2Z3R A;  1ETE A;  4X51 A;  1CN4 C;  1P9M B;  5D70 A;  4YDY I;  4A3D D;  4BY7 D;  5C4X D;  1HUW A;  1ITL A;  1JLI A;  1J7V L;  5C7X A;  4A3M D;  5IYB D;  1ITI A;  1HIK A;  5FUC A;  1VLK A;  2Q98 A;  3Q1S I;  1N1F A;  1Z7C A;  3HHC A;  3I4N D;  1M4C A;  1CD9 A;  1HIJ A;  1ITM A;  3OQ3 A;  3LB6 B;  3PIV A;  3TGX B;  5D28 B;  1PVH B;  5C3E D;  3NCC A;  3QT2 C;  2HYM B;  4A3C D;  3QB7 A;  1BBN A;  1HGU A;  3N06 A;  3N0P A;  1D9G A;  2JA6 D;  1KF9 A;  1A7M A;  1M4A A;  5D71 A;  4A3F D;  2INT A;  3HOU D;  1EKU A;  3PO2 D;  1BP3 A;  2O6I A;  1IJZ A;  3LB6 A;  3PIW A;  1Y1V D;  2ILK A;  2JA7 D;  1IAR A;  2JA8 D;  1BGC A;  3QWR B;  1AXI A;  3BPO A;  1V7M V;  2LAG A;  4A3K D;  1LK3 A;  1PGR A;  1EVS A;  3DLQ I;  4NKQ C;  4CNI C;  2C35 A;  2KZ1 A;  3L5W I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...