4TPJA

Selectivity mechanism of a bacterial homologue of the human drug peptide transporters pept1 and pept2
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
485
structure length
445
Chain Sequence
b'VSKTHSFMTVSLIELWERFGYYGMQALIVYFMVQRLGFDDSRANLVWSACAALIYVSPAIGGWVGDKILGTKRTMLLGAGILSVGYALMTVPTENTWFMFSALGVIVVGNGLFKPNAGNLVRKIYESKIDSAFTIYYMAVNVGSTFSMLLTPWIKDYVNAQYGNEFGWHAAFAVCCVGILVGLGNYALMHKSLANYGSEPDTRPVNKKSLAIVLALAALSVVASAIILEYEDVARVFVYAAGVAVLGIIAALILTVQTVFFFIFYQQMSTSLALFALRNVDWDFQVFGTHLWTWSPAQFQALNPIWIMVLSPVLAWIAAKFALGFAVVAIGFFIYGFAGQFAVNGKTSSWVMIWGYASYSLGELLVSGLGLAMIARYMMGAYFVASGISQYLGGVVANFASVPQDLVDPLQTLPVYTNLFNKLGVAAVVCTIIALAVLPLMRRLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton:oligopeptide symporter POT family
publication title Selectivity mechanism of a bacterial homolog of the human drug-peptide transporters PepT1 and PepT2.
pubmed doi rcsb
source organism Shewanella oneidensis
molecule tags Membrane protein
total genus 167
structure length 445
sequence length 485
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00854 PTR2 POT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1250.20 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; MFS general substrate transporter like domains 4tpjA00
3WDOA 4LDSA 3O7QA 2CFPA 4GBZA 5EQGA 4ZYRA 4IKYA 5A2OA 1PV6A 4IKVA 4U4WA 4PYPA 4Q65A 4IU8A 5D59A 2V8NA 4TPGA 4D2BA 4YB9D 4IKZA 5EQIA 1PW4A 4UVMA 3O7PA 4GBYA 4J05A 4OH3A 4XNJA 4JREA 4LEPA 4D2CA 4GC0A 1PV7A 5EQHA 4YBQA 4TPHA 4TPJA 2CFQA 4IU9A 5D6KA 2XUTA 4IKWA 4JA3A 4U4VA 4ZW9A 4D2DA 5C65A 4U4TA 4W6VA 5D58A 4ZWBA 2Y5YA 4XNIA 4OAAA 4QIQA 4APSA 5GXBA 4IKXA 4JR9A 4ZWCA 5A2NA
chains in the Genus database with same CATH superfamily
3WDOA 3O7QA 1PGRA 4ZS7A 4IU8A 3D85C 3HHRA 4A3ID 4UVMA 2O6IA 5EQHA 1PY2A 4NI9A 4CNIC 4IU9A 2GMFA 2XQBA 2JA5D 1ILKA 4U4TA 4NN5A 1IK0A 4J4LC 4A3FD 5GXBA 1F6FA 1BGDA 5IP9D 1EVSA 1QVNA 4Z5RD 2R92D 4GC0A 3L5WI 2HYMB 3L5XA 1KF9A 3PO3D 5D58A 1M47A 2INTA 4APSA 2L3OA 1AU1A 4IKXA 4NN6A 2R93D 1EKUA 2O27A 4I77Z 3DLQI 5D6KA 4IKWA 3NCEA 4W6VA 2Y5YA 3NPZA 3QAZA 4OAAA 1NBPA 3SE3B 5C7XA 1RHGA 3D87A 3INKC 5A2OA 3QT2C 4D2BA 3WCYI 3IRHA 4TPHA 4JREA 4U4VA 4A3KD 3H3VE 1BGEA 2B5IA 5C65A 1BBNA 5E4EA 1Y14A 1HGUA 4WRLB 4YUEC 3UF5A 4MHLA 3BESL 3PIWA 4LDSA 4YPGC 1FG9A 4YQXA 1CD9A 4Q65A 1F45B 4O6KA 1CSGA 2B8XA 1ETEA 1ITFA 1LK3A 1ITLA 3HOZD 5LQBA 1M4RA 4PS4A 5TS9A 4BXXD 1J7VL 4JR9A 4A3GD 4ZWCA 1A22A 1V7MV 3UEZE 1BGCA 1M48A 2L3YA 4A3BD 2LMSA 3NCCA 3O7PA 4XNJA 4TPJA 2VUMD 4BY7D 4ZW9A 5IYBD 1JLIA 4A3DD 3N06A 2B8UA 1HWGA 1CN4C 1INRA 1PV6A 1PW6A 1M4BA 1RW5A 4DKDA 3HOXD 4D2CA 3HOYD 3G6DA 4A3MD 1M4AA 3G9VB 3QWRB 4EXNA 2PSMA 3MZGA 5IP7D 3QB7A 1LQSL 4RS1A 5FUCA 4BBRD 5EQGA 3UF2A 3AYHA 1GNCA 2B91A 5A2NA 2D48A 1AXIA 3Q1SI 3DI3A 3I4ND 3BPLA 3HHCA 1GA3A 1V7NV 3OG6A 2Q7NB 1BP3A 3H0GD 3FKID 5D70A 1ITMA 3HOWD 4U4WA 1HZIA 4X51A 1AX8A 3OG4A 5C44D 5D22A 5EQIA 4BY1D 1PV7A 3HOVD 2CYKA 4JA3A 3TGXB 3EW3A 2B8ZA 4DKCA 4NEMA 5D59A 4YB9D 1M4CA 3NCBA 4LRLA 1D9GA 4A3CD 5C4XD 2XUTA 1FYHA 1Y1VD 1EMRA 4A3ED 1IRLA 4NEJA 1SCFA 1D9CA 5FLMD 3QB1A 1HUWA 4PYPA 1PW4A 4J05A 4LEPA 5IYDD 2LAGA 3BPOA 4EXPA 1ITIA 5IYCD 3B5KA 3PO2D 2IL6A 2KZ1A 3NCFA 4QIQA 3N0PA 4YDYI 2Z3RA 1Z7CA 2OQPA 1IJZA 2CFPA 1Y1WD 3EJJA 2C35A 3BPNA 4IKZA 2JA7D 1CYLA 1WU3I 4DKEA 4GBYA 4OH3A 3HMXB 1RCBA 4ZWBA 4A93D 1LKIA 2B90A 1BUYA 1RFBA 4IKVA 4ZF7A 2B63D 2V8NA 4TPGA 1EXZA 2ERJD 1N1FA 2R7ZD 3DI2A 1P9MB 1WCMD 5D72A 3S9DA 1Z92A 5D71A 3DGCL 1M49A 4GS7A 1YKBA 1ALUA 5KNHI 3I4MD 4IKYA 4GRWA 1B5LA 4NN7A 1BCNA 4DOHA 4YBQA 2CFQA 4DKFA 1Y6KL 1I1RB 3HOUD 2D9QA 5FHXA 1HIJA 4NI7A 3OQ3A 2ILKA 4GBZA 1IL6A 2JA8D 3VA2A 2E9WC 2O26A 5C3ED 2Z3QA 1Y6ML 3UX9A 5D28B 3LB6A 4NKQC 3LB6B 2Q98A 1CNT1 1Y6NL 1HIKA 4XNIA 1PVHB 4O9HA 4ZYRA 4A3JD 4BBSD 3DUHC 3PIVA 1HWHA 4A3LD 1HULA 1A7MA 1VLKA 1EERA 3D48P 4D2DA 2Q14A 2JA6D 1IARA 3SE4B 4FA8E 5L6YC 2B8YA 2H24A
chains in the Genus database with same CATH topology
3WDOA 4LDSA 3O7QA 2CFPA 4GBZA 5EQGA 4ZYRA 4IKYA 5A2OA 1PV6A 4IKVA 4U4WA 4PYPA 4Q65A 4IU8A 5D59A 2V8NA 4TPGA 4D2BA 4YB9D 4IKZA 5EQIA 1PW4A 4UVMA 3O7PA 4GBYA 4J05A 4OH3A 4XNJA 4JREA 4LEPA 4D2CA 4GC0A 1PV7A 5EQHA 4YBQA 4TPHA 4TPJA 2CFQA 4IU9A 5D6KA 2XUTA 4IKWA 4JA3A 4U4VA 4ZW9A 4D2DA 5C65A 4U4TA 4W6VA 5D58A 4ZWBA 2Y5YA 4XNIA 4OAAA 4QIQA 4APSA 5GXBA 4IKXA 4JR9A 4ZWCA 5A2NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WDO A;  4LDS A;  3O7Q A;  2CFP A;  4GBZ A;  5EQG A;  4ZYR A;  4IKY A;  5A2O A;  1PV6 A;  4IKV A;  4U4W A;  4PYP A;  4Q65 A;  4IU8 A;  5D59 A;  2V8N A;  4TPG A;  4D2B A;  4YB9 D;  4IKZ A;  5EQI A;  1PW4 A;  4UVM A;  3O7P A;  4GBY A;  4J05 A;  4OH3 A;  4XNJ A;  4JRE A;  4LEP A;  4D2C A;  4GC0 A;  1PV7 A;  5EQH A;  4YBQ A;  4TPH A;  4TPJ A;  2CFQ A;  4IU9 A;  5D6K A;  2XUT A;  4IKW A;  4JA3 A;  4U4V A;  4ZW9 A;  4D2D A;  5C65 A;  4U4T A;  4W6V A;  5D58 A;  4ZWB A;  2Y5Y A;  4XNI A;  4OAA A;  4QIQ A;  4APS A;  5GXB A;  4IKX A;  4JR9 A;  4ZWC A;  5A2N A; 
#chains in the Genus database with same CATH topology
 3WDO A;  3O7Q A;  1PGR A;  4ZS7 A;  4IU8 A;  3D85 C;  3HHR A;  4A3I D;  4UVM A;  2O6I A;  5EQH A;  1PY2 A;  4NI9 A;  4CNI C;  4IU9 A;  2GMF A;  2XQB A;  2JA5 D;  1ILK A;  4U4T A;  4NN5 A;  1IK0 A;  4J4L C;  4A3F D;  5GXB A;  1F6F A;  1BGD A;  5IP9 D;  1EVS A;  1QVN A;  4Z5R D;  2R92 D;  4GC0 A;  3L5W I;  2HYM B;  3L5X A;  1KF9 A;  3PO3 D;  5D58 A;  1M47 A;  2INT A;  4APS A;  2L3O A;  1AU1 A;  4IKX A;  4NN6 A;  2R93 D;  1EKU A;  2O27 A;  4I77 Z;  3DLQ I;  5D6K A;  4IKW A;  3NCE A;  4W6V A;  2Y5Y A;  3NPZ A;  3QAZ A;  4OAA A;  1NBP A;  3SE3 B;  5C7X A;  1RHG A;  3D87 A;  3INK C;  5A2O A;  3QT2 C;  4D2B A;  3WCY I;  3IRH A;  4TPH A;  4JRE A;  4U4V A;  4A3K D;  3H3V E;  1BGE A;  2B5I A;  5C65 A;  1BBN A;  5E4E A;  1Y14 A;  1HGU A;  4WRL B;  4YUE C;  3UF5 A;  4MHL A;  3BES L;  3PIW A;  4LDS A;  4YPG C;  1FG9 A;  4YQX A;  1CD9 A;  4Q65 A;  1F45 B;  4O6K A;  1CSG A;  2B8X A;  1ETE A;  1ITF A;  1LK3 A;  1ITL A;  3HOZ D;  5LQB A;  1M4R A;  4PS4 A;  5TS9 A;  4BXX D;  1J7V L;  4JR9 A;  4A3G D;  4ZWC A;  1A22 A;  1V7M V;  3UEZ E;  1BGC A;  1M48 A;  2L3Y A;  4A3B D;  2LMS A;  3NCC A;  3O7P A;  4XNJ A;  4TPJ A;  2VUM D;  4BY7 D;  4ZW9 A;  5IYB D;  1JLI A;  4A3D D;  3N06 A;  2B8U A;  1HWG A;  1CN4 C;  1INR A;  1PV6 A;  1PW6 A;  1M4B A;  1RW5 A;  4DKD A;  3HOX D;  4D2C A;  3HOY D;  3G6D A;  4A3M D;  1M4A A;  3G9V B;  3QWR B;  4EXN A;  2PSM A;  3MZG A;  5IP7 D;  3QB7 A;  1LQS L;  4RS1 A;  5FUC A;  4BBR D;  5EQG A;  3UF2 A;  3AYH A;  1GNC A;  2B91 A;  5A2N A;  2D48 A;  1AXI A;  3Q1S I;  3DI3 A;  3I4N D;  3BPL A;  3HHC A;  1GA3 A;  1V7N V;  3OG6 A;  2Q7N B;  1BP3 A;  3H0G D;  3FKI D;  5D70 A;  1ITM A;  3HOW D;  4U4W A;  1HZI A;  4X51 A;  1AX8 A;  3OG4 A;  5C44 D;  5D22 A;  5EQI A;  4BY1 D;  1PV7 A;  3HOV D;  2CYK A;  4JA3 A;  3TGX B;  3EW3 A;  2B8Z A;  4DKC A;  4NEM A;  5D59 A;  4YB9 D;  1M4C A;  3NCB A;  4LRL A;  1D9G A;  4A3C D;  5C4X D;  2XUT A;  1FYH A;  1Y1V D;  1EMR A;  4A3E D;  1IRL A;  4NEJ A;  1SCF A;  1D9C A;  5FLM D;  3QB1 A;  1HUW A;  4PYP A;  1PW4 A;  4J05 A;  4LEP A;  5IYD D;  2LAG A;  3BPO A;  4EXP A;  1ITI A;  5IYC D;  3B5K A;  3PO2 D;  2IL6 A;  2KZ1 A;  3NCF A;  4QIQ A;  3N0P A;  4YDY I;  2Z3R A;  1Z7C A;  2OQP A;  1IJZ A;  2CFP A;  1Y1W D;  3EJJ A;  2C35 A;  3BPN A;  4IKZ A;  2JA7 D;  1CYL A;  1WU3 I;  4DKE A;  4GBY A;  4OH3 A;  3HMX B;  1RCB A;  4ZWB A;  4A93 D;  1LKI A;  2B90 A;  1BUY A;  1RFB A;  4IKV A;  4ZF7 A;  2B63 D;  2V8N A;  4TPG A;  1EXZ A;  2ERJ D;  1N1F A;  2R7Z D;  3DI2 A;  1P9M B;  1WCM D;  5D72 A;  3S9D A;  1Z92 A;  5D71 A;  3DGC L;  1M49 A;  4GS7 A;  1YKB A;  1ALU A;  5KNH I;  3I4M D;  4IKY A;  4GRW A;  1B5L A;  4NN7 A;  1BCN A;  4DOH A;  4YBQ A;  2CFQ A;  4DKF A;  1Y6K L;  1I1R B;  3HOU D;  2D9Q A;  5FHX A;  1HIJ A;  4NI7 A;  3OQ3 A;  2ILK A;  4GBZ A;  1IL6 A;  2JA8 D;  3VA2 A;  2E9W C;  2O26 A;  5C3E D;  2Z3Q A;  1Y6M L;  3UX9 A;  5D28 B;  3LB6 A;  4NKQ C;  3LB6 B;  2Q98 A;  1CNT 1;  1Y6N L;  1HIK A;  4XNI A;  1PVH B;  4O9H A;  4ZYR A;  4A3J D;  4BBS D;  3DUH C;  3PIV A;  1HWH A;  4A3L D;  1HUL A;  1A7M A;  1VLK A;  1EER A;  3D48 P;  4D2D A;  2Q14 A;  2JA6 D;  1IAR A;  3SE4 B;  4FA8 E;  5L6Y C;  2B8Y A;  2H24 A; 
#chains in the Genus database with same CATH homology
 3WDO A;  4LDS A;  3O7Q A;  2CFP A;  4GBZ A;  5EQG A;  4ZYR A;  4IKY A;  5A2O A;  1PV6 A;  4IKV A;  4U4W A;  4PYP A;  4Q65 A;  4IU8 A;  5D59 A;  2V8N A;  4TPG A;  4D2B A;  4YB9 D;  4IKZ A;  5EQI A;  1PW4 A;  4UVM A;  3O7P A;  4GBY A;  4J05 A;  4OH3 A;  4XNJ A;  4JRE A;  4LEP A;  4D2C A;  4GC0 A;  1PV7 A;  5EQH A;  4YBQ A;  4TPH A;  4TPJ A;  2CFQ A;  4IU9 A;  5D6K A;  2XUT A;  4IKW A;  4JA3 A;  4U4V A;  4ZW9 A;  4D2D A;  5C65 A;  4U4T A;  4W6V A;  5D58 A;  4ZWB A;  2Y5Y A;  4XNI A;  4OAA A;  4QIQ A;  4APS A;  5GXB A;  4IKX A;  4JR9 A;  4ZWC A;  5A2N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...