1A7MA

Leukaemia inhibitory factor chimera (mh35-lif), nmr, 20 structures
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
180
structure length
180
Chain Sequence
SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRMVAYLSASLTNITRDQKVLNPSAVSLHSKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEVFQKKKLGCQLLGTYKQVISVVVQAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords LEUKEMIA INHIBITORY FACTOR
publication title Solution structure of leukemia inhibitory factor.
pubmed doi rcsb
source organism Mus musculus
total genus 60
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 1998-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01291 LIF_OSM LIF / OSM family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1250.10 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; Growth Hormone; Chain: A; 1a7mA00
2HYMB 4O9HA 1PVHB 5LQBA 1HULA 1LQSL 1Z92A 3BPOA 3G6DA 4J4LC 2O27A 1YKBA 5D72A 4NKQC 5C7XA 1Z7CA 4WRLB 3SE4B 2ILKA 1IARA 3UF2A 3QB1A 4PS4A 1J7VL 3NCBA 1IK0A 4O6KA 2D9QA 1I1RB 2B91A 1BGDA 1NBPA 1P9MB 2KZ1A 1IJZA 3D87A 4ZS7A 1BCNA 1LK3A 1HGUA 1RCBA 1BUYA 1AU1A 4YUEC 1FYHA 1F6FA 3SE3B 1EKUA 1D9CA 3PIVA 1GA3A 1EERA 3PIWA 1QVNA 5L6YC 2CYKA 1CSGA 1B5LA 1ALUA 3HMXB 3MZGA 3UX9A 3G9VB 3NCFA 1ILKA 2L3YA 2INTA 1PW6A 3B5KA 1GNCA 1AXIA 3QWRB 3QB7A 2Q7NB 3WCYI 1Y6ML 4X51A 1ITIA 4DOHA 1HUWA 3L5XA 4I77Z 5KNHI 1M4AA 2O26A 1ITMA 1EXZA 3D85C 3HHRA 1CN4C 3EJJA 3QT2C 1EMRA 3VA2A 2LAGA 1M47A 1IRLA 3LB6A 1V7NV 1HZIA 5FHXA 1EVSA 1A22A 3EW3A 1FG9A 2B8UA 1IL6A 2GMFA 3DLQI 2B8XA 1KF9A 3INKC 4CNIC 1RFBA 4NI7A 3S9DA 4Z5RD 3DUHC 1CNT1 2B5IA 1M4RA 1PGRA 1HWGA 3NCEA 4FA8E 2IL6A 3Q1SI 5FUCA 3BPLA 1INRA 3DGCL 1ETEA 4NEJA 5D28B 1LKIA 3BPNA 5D71A 1ITLA 1HWHA 2LMSA 3N06A 1F45B 1SCFA 4MHLA 4ZF7A 5D70A 1V7MV 1WU3I 3UF5A 1PY2A 1M48A 2D48A 3N0PA 3L5WI 4YPGC 2ERJD 4YQXA 1AX8A 3BESL 1RW5A 1D9GA 2B8YA 1JLIA 4NI9A 3QAZA 2B90A 4NEMA 1ITFA 1HIJA 3NPZA 4RS1A 1BGCA 1HIKA 4GRWA 1M49A 1VLKA 1RHGA 1CYLA 5E4EA 1Y6KL 1BP3A 1CD9A 2L3OA 1A7MA 1M4CA 3D48P 3NCCA 1BGEA 2H24A 2Q98A 3OQ3A 4YDYI 1N1FA 5D22A 3LB6B 2B8ZA 1BBNA 1M4BA 1Y6NL 3UEZE 2E9WC
chains in the Genus database with same CATH superfamily
1PVHB 1LQSL 3O7QA 5D72A 4ZWBA 4WRLB 3SE4B 1IARA 3UF2A 4PS4A 4APSA 5C3ED 3I4MD 2B91A 1P9MB 2C35A 5A2OA 1FYHA 1F6FA 4TPGA 1GA3A 3HOXD 1CSGA 4JR9A 3HMXB 1Y1WD 3NCFA 4LEPA 3HHCA 3QB7A 1Y6ML 3OG4A 4X51A 2O26A 3HHRA 4A3CD 4BY7D 3QT2C 2LAGA 1M47A 2V8NA 3LB6A 3AYHA 1HZIA 1A22A 1FG9A 2O6IA 4A3ED 4NI7A 2B5IA 4DKCA 3DGCL 1ETEA 4NEJA 3HOYD 4EXPA 4ZWCA 3N06A 4PYPA 3N0PA 1PV7A 4YPGC 4W6VA 2OQPA 1JLIA 4A3BD 3QAZA 2Z3RA 4NEMA 1BGCA 3WDOA 2CFPA 2L3OA 3TGXB 4BBSD 1BGEA 2B8ZA 4A3ID 3UEZE 2R93D 5LQBA 1HULA 1Z92A 3BPOA 3O7PA 1YKBA 2JA6D 4NKQC 3QB1A 4LRLA 1NBPA 1BCNA 1AU1A 4A3JD 4GBZA 1D9CA 3PIWA 1B5LA 3MZGA 3G9VB 4IKYA 2L3YA 1PW6A 4A3LD 2JA8D 5IYCD 1AXIA 3WCYI 4Q65A 3HOZD 4I77Z 4U4VA 5KNHI 1M4AA 1EXZA 3VA2A 2CFQA 1V7NV 2B8UA 2B8XA 3INKC 4CNIC 4IU8A 4GS7A 5IP9D 4Z5RD 5A2NA 1PGRA 3Q1SI 4TPHA 3DI3A 4D2BA 5D28B 5D71A 1Y14A 4ZYRA 4ZF7A 5D70A 4IKZA 1PY2A 1AX8A 4NN6A 4J05A 3H0GD 2XQBA 1D9GA 4NI9A 2B90A 1HIJA 1PW4A 3NPZA 4OAAA 4YBQA 5IYBD 1Y6KL 2B63D 1BP3A 3D48P 3NCCA 4A93D 2Q98A 5EQIA 1N1FA 2JA5D 1M4BA 4A3GD 5D58A 3I4ND 4O9HA 3FKID 2O27A 4UVMA 1Z7CA 2Q14A 2ILKA 1J7VL 3NCBA 1IK0A 4O6KA 2KZ1A 1BGDA 4ZS7A 1LK3A 1HGUA 4YUEC 4U4TA 4IKXA 1EKUA 1EERA 5L6YC 4JA3A 1ALUA 3UX9A 1ILKA 3B5KA 2INTA 5C4XD 3QWRB 4DOHA 1HUWA 1ITMA 3D85C 1CN4C 1EMRA 3PO2D 3EW3A 4BXXD 4U4WA 3DLQI 1KF9A 1RFBA 4IKVA 3DUHC 5EQGA 1M4RA 5IYDD 1HWGA 3NCEA 4GC0A 5FUCA 3HOVD 3BPNA 4IKWA 1HWHA 4A3MD 1F45B 4MHLA 4D2DA 1V7MV 3UF5A 3L5WI 4XNIA 2ERJD 4ZW9A 3BESL 1RW5A 2B8YA 4D2CA 1ITFA 4RS1A 5C44D 1HIKA 4GRWA 1M49A 2JA7D 1RHGA 1CYLA 4XNJA 2R7ZD 5GXBA 1CD9A 2XUTA 1A7MA 5FLMD 3HOWD 1WCMD 5D59A 3OQ3A 4YDYI 3IRHA 5D22A 4DKDA 3LB6B 2Y5YA 4TPJA 3PO3D 1BBNA 1Y6NL 2VUMD 2HYMB 3H3VE 3G6DA 4J4LC 5C7XA 5C65A 1PV6A 2D9QA 1I1RB 3D87A 4GBYA 1IJZA 4NN5A 1RCBA 1BUYA 3SE3B 3PIVA 2Z3QA 1QVNA 2CYKA 3OG6A 3DI2A 1GNCA 5TS9A 2Q7NB 1ITIA 3L5XA 4LDSA 3EJJA 4DKEA 4YB9D 2PSMA 4BBRD 4QIQA 1IRLA 5IP7D 5FHXA 1EVSA 1IL6A 2GMFA 4DKFA 1Y1VD 4A3FD 5D6KA 3S9DA 1CNT1 4EXNA 5EQHA 4FA8E 2IL6A 3BPLA 1INRA 4IU9A 4A3KD 1LKIA 1ITLA 2LMSA 1SCFA 4JREA 1WU3I 4OH3A 4NN7A 1M48A 2D48A 4YQXA 4A3DD 1VLKA 3HOUD 5E4EA 2R92D 1M4CA 4BY1D 2H24A 2E9WC
chains in the Genus database with same CATH topology
2HYMB 3I4ND 4O9HA 1PVHB 5LQBA 3H3VE 1HULA 1LQSL 1Z92A 3BPOA 3FKID 3G6DA 4J4LC 2O27A 1YKBA 2JA6D 5D72A 4NKQC 5C7XA 1Z7CA 2Q14A 4WRLB 3SE4B 2ILKA 1IARA 3UF2A 3QB1A 4PS4A 1J7VL 3NCBA 5C3ED 1IK0A 4O6KA 3I4MD 2D9QA 1I1RB 2B91A 1BGDA 1NBPA 1P9MB 2C35A 1IJZA 2KZ1A 3D87A 4LRLA 1LK3A 1HGUA 1RCBA 4NN5A 4ZS7A 1BUYA 1AU1A 4YUEC 1FYHA 1F6FA 3SE3B 4A3JD 1EKUA 1D9CA 3PIVA 3HOXD 1EERA 3PIWA 2Z3QA 1GA3A 1QVNA 5L6YC 2CYKA 3OG6A 1CSGA 1B5LA 1ALUA 3HMXB 3MZGA 1Y1WD 3UX9A 3DI2A 3G9VB 1ILKA 2L3YA 2INTA 1PW6A 3B5KA 3HHCA 3NCFA 5TS9A 5IYCD 2JA8D 1AXIA 3QWRB 4A3LD 5C4XD 3QB7A 2Q7NB 3WCYI 1Y6ML 3OG4A 4X51A 1ITIA 3HOZD 4DOHA 1HUWA 3L5XA 4I77Z 5KNHI 1M4AA 2O26A 1ITMA 1EXZA 3D85C 3HHRA 1CN4C 4A3CD 3EJJA 4DKEA 4BY7D 3QT2C 2PSMA 1EMRA 3VA2A 4BBRD 3PO2D 2LAGA 1M47A 1IRLA 3LB6A 1V7NV 5IP7D 3AYHA 1HZIA 5FHXA 1EVSA 1A22A 3EW3A 4BXXD 1FG9A 2B8UA 1IL6A 2GMFA 3DLQI 2B8XA 1KF9A 3INKC 4CNIC 4GS7A 4DKFA 1Y1VD 2O6IA 4A3FD 1RFBA 4NI7A 3S9DA 4A3ED 5IP9D 4Z5RD 3DUHC 1CNT1 2B5IA 1M4RA 5IYDD 1PGRA 4EXNA 1HWGA 3NCEA 4DKCA 4FA8E 2IL6A 3Q1SI 5FUCA 3DI3A 3BPLA 1INRA 3DGCL 1ETEA 4A3KD 3HOVD 4NEJA 5D28B 1LKIA 3BPNA 5D71A 1ITLA 1HWHA 1Y14A 4A3MD 3HOYD 4EXPA 2LMSA 3N06A 1F45B 1SCFA 4MHLA 4ZF7A 5D70A 1V7MV 1WU3I 3UF5A 1PY2A 4NN7A 1M48A 2D48A 3N0PA 3L5WI 4YPGC 2ERJD 2OQPA 1AX8A 4YQXA 3BESL 1RW5A 4NN6A 3H0GD 2XQBA 1D9GA 2B8YA 1JLIA 4NI9A 4A3BD 3QAZA 2B90A 2Z3RA 4NEMA 1HIJA 3NPZA 4RS1A 1ITFA 5C44D 5IYBD 1BGCA 1HIKA 4GRWA 1M49A 4A3DD 1VLKA 2JA7D 1RHGA 1CYLA 3HOUD 5E4EA 2R92D 1Y6KL 2R7ZD 2B63D 1BP3A 1CD9A 2L3OA 1A7MA 1M4CA 5FLMD 3D48P 3TGXB 3NCCA 3HOWD 4BBSD 4A93D 4BY1D 1BGEA 1WCMD 2H24A 2Q98A 3OQ3A 4YDYI 1GNCA 3IRHA 1N1FA 5D22A 3LB6B 4DKDA 3PO3D 2B8ZA 1BBNA 1M4BA 4A3ID 2JA5D 4A3GD 1BCNA 1Y6NL 2VUMD 3UEZE 2E9WC 2R93D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HYM B;  4O9H A;  1PVH B;  5LQB A;  1HUL A;  1LQS L;  1Z92 A;  3BPO A;  3G6D A;  4J4L C;  2O27 A;  1YKB A;  5D72 A;  4NKQ C;  5C7X A;  1Z7C A;  4WRL B;  3SE4 B;  2ILK A;  1IAR A;  3UF2 A;  3QB1 A;  4PS4 A;  1J7V L;  3NCB A;  1IK0 A;  4O6K A;  2D9Q A;  1I1R B;  2B91 A;  1BGD A;  1NBP A;  1P9M B;  2KZ1 A;  1IJZ A;  3D87 A;  4ZS7 A;  1BCN A;  1LK3 A;  1HGU A;  1RCB A;  1BUY A;  1AU1 A;  4YUE C;  1FYH A;  1F6F A;  3SE3 B;  1EKU A;  1D9C A;  3PIV A;  1GA3 A;  1EER A;  3PIW A;  1QVN A;  5L6Y C;  2CYK A;  1CSG A;  1B5L A;  1ALU A;  3HMX B;  3MZG A;  3UX9 A;  3G9V B;  3NCF A;  1ILK A;  2L3Y A;  2INT A;  1PW6 A;  3B5K A;  1GNC A;  1AXI A;  3QWR B;  3QB7 A;  2Q7N B;  3WCY I;  1Y6M L;  4X51 A;  1ITI A;  4DOH A;  1HUW A;  3L5X A;  4I77 Z;  5KNH I;  1M4A A;  2O26 A;  1ITM A;  1EXZ A;  3D85 C;  3HHR A;  1CN4 C;  3EJJ A;  3QT2 C;  1EMR A;  3VA2 A;  2LAG A;  1M47 A;  1IRL A;  3LB6 A;  1V7N V;  1HZI A;  5FHX A;  1EVS A;  1A22 A;  3EW3 A;  1FG9 A;  2B8U A;  1IL6 A;  2GMF A;  3DLQ I;  2B8X A;  1KF9 A;  3INK C;  4CNI C;  1RFB A;  4NI7 A;  3S9D A;  4Z5R D;  3DUH C;  1CNT 1;  2B5I A;  1M4R A;  1PGR A;  1HWG A;  3NCE A;  4FA8 E;  2IL6 A;  3Q1S I;  5FUC A;  3BPL A;  1INR A;  3DGC L;  1ETE A;  4NEJ A;  5D28 B;  1LKI A;  3BPN A;  5D71 A;  1ITL A;  1HWH A;  2LMS A;  3N06 A;  1F45 B;  1SCF A;  4MHL A;  4ZF7 A;  5D70 A;  1V7M V;  1WU3 I;  3UF5 A;  1PY2 A;  1M48 A;  2D48 A;  3N0P A;  3L5W I;  4YPG C;  2ERJ D;  4YQX A;  1AX8 A;  3BES L;  1RW5 A;  1D9G A;  2B8Y A;  1JLI A;  4NI9 A;  3QAZ A;  2B90 A;  4NEM A;  1ITF A;  1HIJ A;  3NPZ A;  4RS1 A;  1BGC A;  1HIK A;  4GRW A;  1M49 A;  1VLK A;  1RHG A;  1CYL A;  5E4E A;  1Y6K L;  1BP3 A;  1CD9 A;  2L3O A;  1A7M A;  1M4C A;  3D48 P;  3NCC A;  1BGE A;  2H24 A;  2Q98 A;  3OQ3 A;  4YDY I;  1N1F A;  5D22 A;  3LB6 B;  2B8Z A;  1BBN A;  1M4B A;  1Y6N L;  3UEZ E;  2E9W C; 
#chains in the Genus database with same CATH topology
 1PVH B;  1LQS L;  3O7Q A;  5D72 A;  4ZWB A;  4WRL B;  3SE4 B;  1IAR A;  3UF2 A;  4PS4 A;  4APS A;  5C3E D;  3I4M D;  2B91 A;  1P9M B;  2C35 A;  5A2O A;  1FYH A;  1F6F A;  4TPG A;  1GA3 A;  3HOX D;  1CSG A;  4JR9 A;  3HMX B;  1Y1W D;  3NCF A;  4LEP A;  3HHC A;  3QB7 A;  1Y6M L;  3OG4 A;  4X51 A;  2O26 A;  3HHR A;  4A3C D;  4BY7 D;  3QT2 C;  2LAG A;  1M47 A;  2V8N A;  3LB6 A;  3AYH A;  1HZI A;  1A22 A;  1FG9 A;  2O6I A;  4A3E D;  4NI7 A;  2B5I A;  4DKC A;  3DGC L;  1ETE A;  4NEJ A;  3HOY D;  4EXP A;  4ZWC A;  3N06 A;  4PYP A;  3N0P A;  1PV7 A;  4YPG C;  4W6V A;  2OQP A;  1JLI A;  4A3B D;  3QAZ A;  2Z3R A;  4NEM A;  1BGC A;  3WDO A;  2CFP A;  2L3O A;  3TGX B;  4BBS D;  1BGE A;  2B8Z A;  4A3I D;  3UEZ E;  2R93 D;  5LQB A;  1HUL A;  1Z92 A;  3BPO A;  3O7P A;  1YKB A;  2JA6 D;  4NKQ C;  3QB1 A;  4LRL A;  1NBP A;  1BCN A;  1AU1 A;  4A3J D;  4GBZ A;  1D9C A;  3PIW A;  1B5L A;  3MZG A;  3G9V B;  4IKY A;  2L3Y A;  1PW6 A;  4A3L D;  2JA8 D;  5IYC D;  1AXI A;  3WCY I;  4Q65 A;  3HOZ D;  4I77 Z;  4U4V A;  5KNH I;  1M4A A;  1EXZ A;  3VA2 A;  2CFQ A;  1V7N V;  2B8U A;  2B8X A;  3INK C;  4CNI C;  4IU8 A;  4GS7 A;  5IP9 D;  4Z5R D;  5A2N A;  1PGR A;  3Q1S I;  4TPH A;  3DI3 A;  4D2B A;  5D28 B;  5D71 A;  1Y14 A;  4ZYR A;  4ZF7 A;  5D70 A;  4IKZ A;  1PY2 A;  1AX8 A;  4NN6 A;  4J05 A;  3H0G D;  2XQB A;  1D9G A;  4NI9 A;  2B90 A;  1HIJ A;  1PW4 A;  3NPZ A;  4OAA A;  4YBQ A;  5IYB D;  1Y6K L;  2B63 D;  1BP3 A;  3D48 P;  3NCC A;  4A93 D;  2Q98 A;  5EQI A;  1N1F A;  2JA5 D;  1M4B A;  4A3G D;  5D58 A;  3I4N D;  4O9H A;  3FKI D;  2O27 A;  4UVM A;  1Z7C A;  2Q14 A;  2ILK A;  1J7V L;  3NCB A;  1IK0 A;  4O6K A;  2KZ1 A;  1BGD A;  4ZS7 A;  1LK3 A;  1HGU A;  4YUE C;  4U4T A;  4IKX A;  1EKU A;  1EER A;  5L6Y C;  4JA3 A;  1ALU A;  3UX9 A;  1ILK A;  3B5K A;  2INT A;  5C4X D;  3QWR B;  4DOH A;  1HUW A;  1ITM A;  3D85 C;  1CN4 C;  1EMR A;  3PO2 D;  3EW3 A;  4BXX D;  4U4W A;  3DLQ I;  1KF9 A;  1RFB A;  4IKV A;  3DUH C;  5EQG A;  1M4R A;  5IYD D;  1HWG A;  3NCE A;  4GC0 A;  5FUC A;  3HOV D;  3BPN A;  4IKW A;  1HWH A;  4A3M D;  1F45 B;  4MHL A;  4D2D A;  1V7M V;  3UF5 A;  3L5W I;  4XNI A;  2ERJ D;  4ZW9 A;  3BES L;  1RW5 A;  2B8Y A;  4D2C A;  1ITF A;  4RS1 A;  5C44 D;  1HIK A;  4GRW A;  1M49 A;  2JA7 D;  1RHG A;  1CYL A;  4XNJ A;  2R7Z D;  5GXB A;  1CD9 A;  2XUT A;  1A7M A;  5FLM D;  3HOW D;  1WCM D;  5D59 A;  3OQ3 A;  4YDY I;  3IRH A;  5D22 A;  4DKD A;  3LB6 B;  2Y5Y A;  4TPJ A;  3PO3 D;  1BBN A;  1Y6N L;  2VUM D;  2HYM B;  3H3V E;  3G6D A;  4J4L C;  5C7X A;  5C65 A;  1PV6 A;  2D9Q A;  1I1R B;  3D87 A;  4GBY A;  1IJZ A;  4NN5 A;  1RCB A;  1BUY A;  3SE3 B;  3PIV A;  2Z3Q A;  1QVN A;  2CYK A;  3OG6 A;  3DI2 A;  1GNC A;  5TS9 A;  2Q7N B;  1ITI A;  3L5X A;  4LDS A;  3EJJ A;  4DKE A;  4YB9 D;  2PSM A;  4BBR D;  4QIQ A;  1IRL A;  5IP7 D;  5FHX A;  1EVS A;  1IL6 A;  2GMF A;  4DKF A;  1Y1V D;  4A3F D;  5D6K A;  3S9D A;  1CNT 1;  4EXN A;  5EQH A;  4FA8 E;  2IL6 A;  3BPL A;  1INR A;  4IU9 A;  4A3K D;  1LKI A;  1ITL A;  2LMS A;  1SCF A;  4JRE A;  1WU3 I;  4OH3 A;  4NN7 A;  1M48 A;  2D48 A;  4YQX A;  4A3D D;  1VLK A;  3HOU D;  5E4E A;  2R92 D;  1M4C A;  4BY1 D;  2H24 A;  2E9W C; 
#chains in the Genus database with same CATH homology
 2HYM B;  3I4N D;  4O9H A;  1PVH B;  5LQB A;  3H3V E;  1HUL A;  1LQS L;  1Z92 A;  3BPO A;  3FKI D;  3G6D A;  4J4L C;  2O27 A;  1YKB A;  2JA6 D;  5D72 A;  4NKQ C;  5C7X A;  1Z7C A;  2Q14 A;  4WRL B;  3SE4 B;  2ILK A;  1IAR A;  3UF2 A;  3QB1 A;  4PS4 A;  1J7V L;  3NCB A;  5C3E D;  1IK0 A;  4O6K A;  3I4M D;  2D9Q A;  1I1R B;  2B91 A;  1BGD A;  1NBP A;  1P9M B;  2C35 A;  1IJZ A;  2KZ1 A;  3D87 A;  4LRL A;  1LK3 A;  1HGU A;  1RCB A;  4NN5 A;  4ZS7 A;  1BUY A;  1AU1 A;  4YUE C;  1FYH A;  1F6F A;  3SE3 B;  4A3J D;  1EKU A;  1D9C A;  3PIV A;  3HOX D;  1EER A;  3PIW A;  2Z3Q A;  1GA3 A;  1QVN A;  5L6Y C;  2CYK A;  3OG6 A;  1CSG A;  1B5L A;  1ALU A;  3HMX B;  3MZG A;  1Y1W D;  3UX9 A;  3DI2 A;  3G9V B;  1ILK A;  2L3Y A;  2INT A;  1PW6 A;  3B5K A;  3HHC A;  3NCF A;  5TS9 A;  5IYC D;  2JA8 D;  1AXI A;  3QWR B;  4A3L D;  5C4X D;  3QB7 A;  2Q7N B;  3WCY I;  1Y6M L;  3OG4 A;  4X51 A;  1ITI A;  3HOZ D;  4DOH A;  1HUW A;  3L5X A;  4I77 Z;  5KNH I;  1M4A A;  2O26 A;  1ITM A;  1EXZ A;  3D85 C;  3HHR A;  1CN4 C;  4A3C D;  3EJJ A;  4DKE A;  4BY7 D;  3QT2 C;  2PSM A;  1EMR A;  3VA2 A;  4BBR D;  3PO2 D;  2LAG A;  1M47 A;  1IRL A;  3LB6 A;  1V7N V;  5IP7 D;  3AYH A;  1HZI A;  5FHX A;  1EVS A;  1A22 A;  3EW3 A;  4BXX D;  1FG9 A;  2B8U A;  1IL6 A;  2GMF A;  3DLQ I;  2B8X A;  1KF9 A;  3INK C;  4CNI C;  4GS7 A;  4DKF A;  1Y1V D;  2O6I A;  4A3F D;  1RFB A;  4NI7 A;  3S9D A;  4A3E D;  5IP9 D;  4Z5R D;  3DUH C;  1CNT 1;  2B5I A;  1M4R A;  5IYD D;  1PGR A;  4EXN A;  1HWG A;  3NCE A;  4DKC A;  4FA8 E;  2IL6 A;  3Q1S I;  5FUC A;  3DI3 A;  3BPL A;  1INR A;  3DGC L;  1ETE A;  4A3K D;  3HOV D;  4NEJ A;  5D28 B;  1LKI A;  3BPN A;  5D71 A;  1ITL A;  1HWH A;  1Y14 A;  4A3M D;  3HOY D;  4EXP A;  2LMS A;  3N06 A;  1F45 B;  1SCF A;  4MHL A;  4ZF7 A;  5D70 A;  1V7M V;  1WU3 I;  3UF5 A;  1PY2 A;  4NN7 A;  1M48 A;  2D48 A;  3N0P A;  3L5W I;  4YPG C;  2ERJ D;  2OQP A;  1AX8 A;  4YQX A;  3BES L;  1RW5 A;  4NN6 A;  3H0G D;  2XQB A;  1D9G A;  2B8Y A;  1JLI A;  4NI9 A;  4A3B D;  3QAZ A;  2B90 A;  2Z3R A;  4NEM A;  1HIJ A;  3NPZ A;  4RS1 A;  1ITF A;  5C44 D;  5IYB D;  1BGC A;  1HIK A;  4GRW A;  1M49 A;  4A3D D;  1VLK A;  2JA7 D;  1RHG A;  1CYL A;  3HOU D;  5E4E A;  2R92 D;  1Y6K L;  2R7Z D;  2B63 D;  1BP3 A;  1CD9 A;  2L3O A;  1A7M A;  1M4C A;  5FLM D;  3D48 P;  3TGX B;  3NCC A;  3HOW D;  4BBS D;  4A93 D;  4BY1 D;  1BGE A;  1WCM D;  2H24 A;  2Q98 A;  3OQ3 A;  4YDY I;  1GNC A;  3IRH A;  1N1F A;  5D22 A;  3LB6 B;  4DKD A;  3PO3 D;  2B8Z A;  1BBN A;  1M4B A;  4A3I D;  2JA5 D;  4A3G D;  1BCN A;  1Y6N L;  2VUM D;  3UEZ E;  2E9W C;  2R93 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...