1BCNA

Three-dimensional solution structure of human interleukin-4 by multi-dimensional heteronuclear magnetic resonance spectroscopy
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
133
structure length
133
Chain Sequence
EAEAHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKDTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEADQSTLENFLERLKTIMREKYSKCSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords INTERLEUKIN-4
publication title Three-dimensional solution structure of human interleukin-4 by multidimensional heteronuclear magnetic resonance spectroscopy.
pubmed rcsb
source organism Homo sapiens
total genus 31
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 1992-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00727 IL4 Interleukin 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1250.10 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; Growth Hormone; Chain: A; 1bcnA00
1BP3A 1RFBA 1BUYA 1V7MV 2B8ZA 4CNIC 4NI9A 5D72A 1ITFA 1A7MA 1GA3A 3DGCL 1INRA 1M47A 3G6DA 4PS4A 5E4EA 3N0PA 2O26A 3N06A 2B90A 2INTA 5D71A 5C7XA 1CYLA 1RHGA 3WCYI 2B8YA 4NEJA 2HYMB 3BESL 3PIWA 1M49A 2B8XA 1D9CA 2L3OA 5D28B 3QB7A 3QAZA 3INKC 2B5IA 1SCFA 1BGCA 1M4AA 1ETEA 1HULA 1AU1A 1Z7CA 3QT2C 3D85C 3EW3A 2ERJD 1IRLA 4J4LC 1HGUA 3HMXB 4ZS7A 1IJZA 1HWHA 3UF2A 1EERA 1HIKA 3Q1SI 1FG9A 1KF9A 1ITIA 1M4CA 2D48A 3L5WI 1LQSL 1PGRA 2IL6A 1EVSA 1Y6NL 3BPNA 3NPZA 1ILKA 1PY2A 1BBNA 1V7NV 1PW6A 3DLQI 1CSGA 1YKBA 4ZF7A 2LMSA 4I77Z 3G9VB 5LQBA 3QB1A 2KZ1A 3UX9A 1RW5A 4Z5RD 1M4RA 1CNT1 1Y6KL 1IL6A 5FUCA 3VA2A 1CD9A 5D22A 3EJJA 1JLIA 5L6YC 4YDYI 4X51A 4FA8E 1B5LA 4YPGC 1J7VL 1ITLA 1VLKA 3MZGA 4O6KA 2H24A 1BGDA 2CYKA 4YQXA 1AXIA 5KNHI 3OQ3A 1D9GA 1M48A 2D9QA 2ILKA 1I1RB 4RS1A 1Z92A 1P9MB 1RCBA 1N1FA 3SE4B 2Q98A 3HHRA 3B5KA 3BPOA 4YUEC 3UF5A 3UEZE 1M4BA 1PVHB 2Q7NB 4NI7A 4O9HA 1BCNA 1IARA 2GMFA 4WRLB 1Y6ML 1EXZA 3NCBA 1AX8A 5D70A 1GNCA 1EKUA 3BPLA 1HWGA 1WU3I 1QVNA 2B8UA 1ITMA 1F45B 4NEMA 3DUHC 1FYHA 1CN4C 1LK3A 1HIJA 4MHLA 1ALUA 4NKQC 2B91A 3QWRB 3LB6A 2E9WC 3NCCA 1EMRA 3NCEA 3S9DA 1HZIA 2LAGA 1BGEA 3D48P 1NBPA 3LB6B 1A22A 3SE3B 2O27A 3NCFA 2L3YA 1HUWA 1IK0A 1LKIA 4GRWA 3L5XA 4DOHA 5FHXA 3PIVA 1F6FA 3D87A
chains in the Genus database with same CATH superfamily
1V7MV 5D72A 1A7MA 1INRA 2B90A 4BBRD 2HYMB 3PIWA 3QAZA 3INKC 1M4AA 4JR9A 1PV7A 4A3GD 4U4VA 4J4LC 3HMXB 1HIKA 4ZW9A 1FG9A 5FLMD 2D48A 4OH3A 1Y6NL 4DKFA 1V7NV 1PW6A 3DLQI 3HOYD 1YKBA 2V8NA 3QB1A 5C44D 4ZWBA 2KZ1A 1RW5A 1M4RA 1IL6A 1JLIA 5L6YC 1B5LA 4YPGC 4U4WA 3OG6A 2JA7D 4W6VA 3OQ3A 3HHCA 4IU9A 1M48A 3H0GD 2ILKA 1P9MB 4XNJA 5D59A 4YUEC 3UF5A 1M4BA 5TS9A 4TPHA 1EXZA 1WCMD 3HOUD 1ITMA 2JA5D 2B63D 3DUHC 1HIJA 4NKQC 2R7ZD 2B91A 3LB6A 4A3CD 2JA6D 3IRHA 1NBPA 1A22A 3SE3B 3NCFA 2L3YA 1HUWA 2JA8D 1LKIA 4DOHA 3D87A 4A3KD 4ZWCA 1RFBA 1Y14A 4A3LD 3DGCL 4J05A 4PS4A 2O26A 3TGXB 1RHGA 4IKXA 4NEJA 4A3ED 3BESL 1D9CA 2L3OA 4IKYA 2B5IA 1SCFA 5IP7D 4IKZA 1ETEA 1HULA 4YB9D 3DI2A 1AU1A 3D85C 3EW3A 2ERJD 3PO2D 4ZS7A 3HOXD 1HWHA 5C4XD 3UF2A 1EERA 1KF9A 1LQSL 2IL6A 1EVSA 3BPNA 1ILKA 3G9VB 1CNT1 4D2CA 1Y6KL 3EJJA 4YDYI 1VLKA 2OQPA 4O6KA 5IYDD 2H24A 2CYKA 5IYBD 5C3ED 3O7QA 1Z92A 4DKEA 3DI3A 2Q98A 3HHRA 3WDOA 3UEZE 1PVHB 2Q7NB 4NI7A 4O9HA 4Q65A 1Y1VD 4WRLB 5D70A 1AX8A 1F45B 4A3MD 1FYHA 4A3DD 4QIQA 2C35A 1LK3A 4MHLA 4NN7A 4EXPA 2Z3RA 3S9DA 4NN6A 3LB6B 2O27A 4PYPA 4GRWA 3PIVA 1BP3A 1BUYA 4CNIC 1ITFA 3HOZD 1GA3A 3N06A 2INTA 4YBQA 5D6KA 2B8YA 1M49A 2B8XA 3QB7A 4A3BD 2Q14A 4A3ID 4GBZA 1Z7CA 2PSMA 3QT2C 4LDSA 4BXXD 1HGUA 4GBYA 3Q1SI 4NN5A 1PGRA 4TPJA 4D2DA 1PY2A 1Y1WD 1BBNA 1CSGA 3UX9A 5IP9D 4Z5RD 3VA2A 5D22A 1J7VL 1ITLA 4A3JD 4A3FD 1BGDA 4DKDA 5A2OA 2R92D 4IU8A 1F6FA 2VUMD 4BY1D 1D9GA 3HOVD 1I1RB 2CFQA 1RCBA 4LRLA 3I4ND 1IARA 2GMFA 3HOWD 1EKUA 1HWGA 1WU3I 1QVNA 2B8UA 5EQGA 1CN4C 2E9WC 3NCCA 1EMRA 1HZIA 1PW4A 3D48P 3L5XA 4GS7A 2B8ZA 4NI9A 5GXBA 1M47A 3G6DA 5E4EA 2Y5YA 3N0PA 5C7XA 5D71A 4GC0A 2R93D 1CYLA 2Z3QA 3WCYI 5D28B 3OG4A 1BGCA 5D58A 4TPGA 1IRLA 5IYCD 3O7PA 1IJZA 4ZYRA 3PO3D 5A2NA 2XUTA 1M4CA 3L5WI 1ITIA 1PV6A 4APSA 3AYHA 4LEPA 3NPZA 3FKID 3I4MD 4ZF7A 2LMSA 4I77Z 5EQIA 2XQBA 5FUCA 1CD9A 4X51A 4FA8E 3MZGA 5C65A 4BY7D 4DKCA 4YQXA 1AXIA 5KNHI 4XNIA 2D9QA 4EXNA 4RS1A 4U4TA 1N1FA 3SE4B 3B5KA 3BPOA 4JA3A 4JREA 1BCNA 2CFPA 4IKWA 1Y6ML 3NCBA 1GNCA 3BPLA 4NEMA 4IKVA 1ALUA 3QWRB 2O6IA 3NCEA 2LAGA 1BGEA 4BBSD 4A93D 4UVMA 3H3VE 1IK0A 5LQBA 5FHXA 5EQHA 4OAAA 4D2BA
chains in the Genus database with same CATH topology
1BP3A 4A3KD 1RFBA 1BUYA 1V7MV 2B8ZA 4CNIC 4NI9A 5D72A 1Y14A 4A3LD 3HOZD 1ITFA 1GA3A 1A7MA 3DGCL 1INRA 1M47A 3G6DA 4PS4A 5E4EA 3N0PA 2O26A 3N06A 2B90A 2INTA 5D71A 4BBRD 3TGXB 5C7XA 2R93D 1CYLA 1RHGA 2Z3QA 3WCYI 2B8YA 4NEJA 4A3ED 2HYMB 3BESL 3PIWA 1M49A 2B8XA 1D9CA 2L3OA 3OG4A 5D28B 3QB7A 3QAZA 3INKC 2B5IA 1SCFA 5IP7D 4A3BD 1BGCA 1M4AA 2Q14A 1ETEA 4A3ID 1HULA 3DI2A 1AU1A 1Z7CA 2PSMA 3D85C 3QT2C 3EW3A 4A3GD 2ERJD 1IRLA 4BXXD 4J4LC 3PO2D 5IYCD 1HGUA 3HMXB 4ZS7A 3HOXD 1IJZA 1HWHA 3PO3D 5C4XD 3UF2A 1EERA 1HIKA 3Q1SI 1FG9A 1KF9A 5FLMD 1ITIA 1M4CA 2D48A 3L5WI 1LQSL 4NN5A 1PGRA 2IL6A 3AYHA 1EVSA 1Y6NL 4DKFA 3BPNA 3NPZA 1ILKA 1PY2A 1Y1WD 1BBNA 1V7NV 1PW6A 3DLQI 1CSGA 3FKID 3I4MD 3HOYD 1YKBA 4ZF7A 2LMSA 4I77Z 3G9VB 5LQBA 3QB1A 5C44D 2KZ1A 3UX9A 1RW5A 5IP9D 4Z5RD 1M4RA 1CNT1 1IL6A 1Y6KL 2XQBA 5FUCA 3VA2A 1CD9A 5D22A 3EJJA 1JLIA 5L6YC 4YDYI 4X51A 4FA8E 1B5LA 4YPGC 1J7VL 1ITLA 1VLKA 3MZGA 2OQPA 4A3JD 4O6KA 4BY7D 3OG6A 5IYDD 4A3FD 2H24A 1BGDA 4DKDA 2JA7D 2R92D 2CYKA 4YQXA 4DKCA 1AXIA 5IYBD 5KNHI 3OQ3A 3HHCA 2VUMD 4BY1D 1D9GA 5C3ED 3HOVD 1M48A 3H0GD 2D9QA 2ILKA 1I1RB 4EXNA 4RS1A 1Z92A 1P9MB 1RCBA 3DI3A 4DKEA 1N1FA 3SE4B 2Q98A 3HHRA 3B5KA 3BPOA 4YUEC 3UF5A 3UEZE 1M4BA 4LRLA 3I4ND 5TS9A 1PVHB 2Q7NB 4NI7A 4O9HA 1BCNA 1IARA 1Y1VD 2GMFA 4WRLB 1Y6ML 1EXZA 3NCBA 1AX8A 5D70A 1GNCA 1WCMD 3HOWD 1EKUA 3BPLA 1HWGA 1WU3I 3HOUD 1QVNA 2B8UA 1ITMA 1F45B 4NEMA 3DUHC 4A3MD 2JA5D 2B63D 1FYHA 1CN4C 4A3DD 2C35A 1LK3A 1HIJA 4MHLA 1ALUA 4NKQC 4NN7A 2B91A 3QWRB 3LB6A 2R7ZD 2O6IA 2E9WC 3NCCA 4A3CD 4EXPA 2JA6D 1EMRA 2Z3RA 3NCEA 3S9DA 1HZIA 2LAGA 1BGEA 4BBSD 4A93D 3D48P 3IRHA 4GS7A 1NBPA 4NN6A 3LB6B 1A22A 3SE3B 3H3VE 2O27A 3NCFA 2L3YA 1HUWA 2JA8D 1LKIA 4GRWA 1IK0A 3L5XA 4DOHA 5FHXA 3PIVA 1F6FA 3D87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BP3 A;  1RFB A;  1BUY A;  1V7M V;  2B8Z A;  4CNI C;  4NI9 A;  5D72 A;  1ITF A;  1A7M A;  1GA3 A;  3DGC L;  1INR A;  1M47 A;  3G6D A;  4PS4 A;  5E4E A;  3N0P A;  2O26 A;  3N06 A;  2B90 A;  2INT A;  5D71 A;  5C7X A;  1CYL A;  1RHG A;  3WCY I;  2B8Y A;  4NEJ A;  2HYM B;  3BES L;  3PIW A;  1M49 A;  2B8X A;  1D9C A;  2L3O A;  5D28 B;  3QB7 A;  3QAZ A;  3INK C;  2B5I A;  1SCF A;  1BGC A;  1M4A A;  1ETE A;  1HUL A;  1AU1 A;  1Z7C A;  3QT2 C;  3D85 C;  3EW3 A;  2ERJ D;  1IRL A;  4J4L C;  1HGU A;  3HMX B;  4ZS7 A;  1IJZ A;  1HWH A;  3UF2 A;  1EER A;  1HIK A;  3Q1S I;  1FG9 A;  1KF9 A;  1ITI A;  1M4C A;  2D48 A;  3L5W I;  1LQS L;  1PGR A;  2IL6 A;  1EVS A;  1Y6N L;  3BPN A;  3NPZ A;  1ILK A;  1PY2 A;  1BBN A;  1V7N V;  1PW6 A;  3DLQ I;  1CSG A;  1YKB A;  4ZF7 A;  2LMS A;  4I77 Z;  3G9V B;  5LQB A;  3QB1 A;  2KZ1 A;  3UX9 A;  1RW5 A;  4Z5R D;  1M4R A;  1CNT 1;  1Y6K L;  1IL6 A;  5FUC A;  3VA2 A;  1CD9 A;  5D22 A;  3EJJ A;  1JLI A;  5L6Y C;  4YDY I;  4X51 A;  4FA8 E;  1B5L A;  4YPG C;  1J7V L;  1ITL A;  1VLK A;  3MZG A;  4O6K A;  2H24 A;  1BGD A;  2CYK A;  4YQX A;  1AXI A;  5KNH I;  3OQ3 A;  1D9G A;  1M48 A;  2D9Q A;  2ILK A;  1I1R B;  4RS1 A;  1Z92 A;  1P9M B;  1RCB A;  1N1F A;  3SE4 B;  2Q98 A;  3HHR A;  3B5K A;  3BPO A;  4YUE C;  3UF5 A;  3UEZ E;  1M4B A;  1PVH B;  2Q7N B;  4NI7 A;  4O9H A;  1BCN A;  1IAR A;  2GMF A;  4WRL B;  1Y6M L;  1EXZ A;  3NCB A;  1AX8 A;  5D70 A;  1GNC A;  1EKU A;  3BPL A;  1HWG A;  1WU3 I;  1QVN A;  2B8U A;  1ITM A;  1F45 B;  4NEM A;  3DUH C;  1FYH A;  1CN4 C;  1LK3 A;  1HIJ A;  4MHL A;  1ALU A;  4NKQ C;  2B91 A;  3QWR B;  3LB6 A;  2E9W C;  3NCC A;  1EMR A;  3NCE A;  3S9D A;  1HZI A;  2LAG A;  1BGE A;  3D48 P;  1NBP A;  3LB6 B;  1A22 A;  3SE3 B;  2O27 A;  3NCF A;  2L3Y A;  1HUW A;  1IK0 A;  1LKI A;  4GRW A;  3L5X A;  4DOH A;  5FHX A;  3PIV A;  1F6F A;  3D87 A; 
#chains in the Genus database with same CATH topology
 1V7M V;  5D72 A;  1A7M A;  1INR A;  2B90 A;  4BBR D;  2HYM B;  3PIW A;  3QAZ A;  3INK C;  1M4A A;  4JR9 A;  1PV7 A;  4A3G D;  4U4V A;  4J4L C;  3HMX B;  1HIK A;  4ZW9 A;  1FG9 A;  5FLM D;  2D48 A;  4OH3 A;  1Y6N L;  4DKF A;  1V7N V;  1PW6 A;  3DLQ I;  3HOY D;  1YKB A;  2V8N A;  3QB1 A;  5C44 D;  4ZWB A;  2KZ1 A;  1RW5 A;  1M4R A;  1IL6 A;  1JLI A;  5L6Y C;  1B5L A;  4YPG C;  4U4W A;  3OG6 A;  2JA7 D;  4W6V A;  3OQ3 A;  3HHC A;  4IU9 A;  1M48 A;  3H0G D;  2ILK A;  1P9M B;  4XNJ A;  5D59 A;  4YUE C;  3UF5 A;  1M4B A;  5TS9 A;  4TPH A;  1EXZ A;  1WCM D;  3HOU D;  1ITM A;  2JA5 D;  2B63 D;  3DUH C;  1HIJ A;  4NKQ C;  2R7Z D;  2B91 A;  3LB6 A;  4A3C D;  2JA6 D;  3IRH A;  1NBP A;  1A22 A;  3SE3 B;  3NCF A;  2L3Y A;  1HUW A;  2JA8 D;  1LKI A;  4DOH A;  3D87 A;  4A3K D;  4ZWC A;  1RFB A;  1Y14 A;  4A3L D;  3DGC L;  4J05 A;  4PS4 A;  2O26 A;  3TGX B;  1RHG A;  4IKX A;  4NEJ A;  4A3E D;  3BES L;  1D9C A;  2L3O A;  4IKY A;  2B5I A;  1SCF A;  5IP7 D;  4IKZ A;  1ETE A;  1HUL A;  4YB9 D;  3DI2 A;  1AU1 A;  3D85 C;  3EW3 A;  2ERJ D;  3PO2 D;  4ZS7 A;  3HOX D;  1HWH A;  5C4X D;  3UF2 A;  1EER A;  1KF9 A;  1LQS L;  2IL6 A;  1EVS A;  3BPN A;  1ILK A;  3G9V B;  1CNT 1;  4D2C A;  1Y6K L;  3EJJ A;  4YDY I;  1VLK A;  2OQP A;  4O6K A;  5IYD D;  2H24 A;  2CYK A;  5IYB D;  5C3E D;  3O7Q A;  1Z92 A;  4DKE A;  3DI3 A;  2Q98 A;  3HHR A;  3WDO A;  3UEZ E;  1PVH B;  2Q7N B;  4NI7 A;  4O9H A;  4Q65 A;  1Y1V D;  4WRL B;  5D70 A;  1AX8 A;  1F45 B;  4A3M D;  1FYH A;  4A3D D;  4QIQ A;  2C35 A;  1LK3 A;  4MHL A;  4NN7 A;  4EXP A;  2Z3R A;  3S9D A;  4NN6 A;  3LB6 B;  2O27 A;  4PYP A;  4GRW A;  3PIV A;  1BP3 A;  1BUY A;  4CNI C;  1ITF A;  3HOZ D;  1GA3 A;  3N06 A;  2INT A;  4YBQ A;  5D6K A;  2B8Y A;  1M49 A;  2B8X A;  3QB7 A;  4A3B D;  2Q14 A;  4A3I D;  4GBZ A;  1Z7C A;  2PSM A;  3QT2 C;  4LDS A;  4BXX D;  1HGU A;  4GBY A;  3Q1S I;  4NN5 A;  1PGR A;  4TPJ A;  4D2D A;  1PY2 A;  1Y1W D;  1BBN A;  1CSG A;  3UX9 A;  5IP9 D;  4Z5R D;  3VA2 A;  5D22 A;  1J7V L;  1ITL A;  4A3J D;  4A3F D;  1BGD A;  4DKD A;  5A2O A;  2R92 D;  4IU8 A;  1F6F A;  2VUM D;  4BY1 D;  1D9G A;  3HOV D;  1I1R B;  2CFQ A;  1RCB A;  4LRL A;  3I4N D;  1IAR A;  2GMF A;  3HOW D;  1EKU A;  1HWG A;  1WU3 I;  1QVN A;  2B8U A;  5EQG A;  1CN4 C;  2E9W C;  3NCC A;  1EMR A;  1HZI A;  1PW4 A;  3D48 P;  3L5X A;  4GS7 A;  2B8Z A;  4NI9 A;  5GXB A;  1M47 A;  3G6D A;  5E4E A;  2Y5Y A;  3N0P A;  5C7X A;  5D71 A;  4GC0 A;  2R93 D;  1CYL A;  2Z3Q A;  3WCY I;  5D28 B;  3OG4 A;  1BGC A;  5D58 A;  4TPG A;  1IRL A;  5IYC D;  3O7P A;  1IJZ A;  4ZYR A;  3PO3 D;  5A2N A;  2XUT A;  1M4C A;  3L5W I;  1ITI A;  1PV6 A;  4APS A;  3AYH A;  4LEP A;  3NPZ A;  3FKI D;  3I4M D;  4ZF7 A;  2LMS A;  4I77 Z;  5EQI A;  2XQB A;  5FUC A;  1CD9 A;  4X51 A;  4FA8 E;  3MZG A;  5C65 A;  4BY7 D;  4DKC A;  4YQX A;  1AXI A;  5KNH I;  4XNI A;  2D9Q A;  4EXN A;  4RS1 A;  4U4T A;  1N1F A;  3SE4 B;  3B5K A;  3BPO A;  4JA3 A;  4JRE A;  1BCN A;  2CFP A;  4IKW A;  1Y6M L;  3NCB A;  1GNC A;  3BPL A;  4NEM A;  4IKV A;  1ALU A;  3QWR B;  2O6I A;  3NCE A;  2LAG A;  1BGE A;  4BBS D;  4A93 D;  4UVM A;  3H3V E;  1IK0 A;  5LQB A;  5FHX A;  5EQH A;  4OAA A;  4D2B A; 
#chains in the Genus database with same CATH homology
 1BP3 A;  4A3K D;  1RFB A;  1BUY A;  1V7M V;  2B8Z A;  4CNI C;  4NI9 A;  5D72 A;  1Y14 A;  4A3L D;  3HOZ D;  1ITF A;  1GA3 A;  1A7M A;  3DGC L;  1INR A;  1M47 A;  3G6D A;  4PS4 A;  5E4E A;  3N0P A;  2O26 A;  3N06 A;  2B90 A;  2INT A;  5D71 A;  4BBR D;  3TGX B;  5C7X A;  2R93 D;  1CYL A;  1RHG A;  2Z3Q A;  3WCY I;  2B8Y A;  4NEJ A;  4A3E D;  2HYM B;  3BES L;  3PIW A;  1M49 A;  2B8X A;  1D9C A;  2L3O A;  3OG4 A;  5D28 B;  3QB7 A;  3QAZ A;  3INK C;  2B5I A;  1SCF A;  5IP7 D;  4A3B D;  1BGC A;  1M4A A;  2Q14 A;  1ETE A;  4A3I D;  1HUL A;  3DI2 A;  1AU1 A;  1Z7C A;  2PSM A;  3D85 C;  3QT2 C;  3EW3 A;  4A3G D;  2ERJ D;  1IRL A;  4BXX D;  4J4L C;  3PO2 D;  5IYC D;  1HGU A;  3HMX B;  4ZS7 A;  3HOX D;  1IJZ A;  1HWH A;  3PO3 D;  5C4X D;  3UF2 A;  1EER A;  1HIK A;  3Q1S I;  1FG9 A;  1KF9 A;  5FLM D;  1ITI A;  1M4C A;  2D48 A;  3L5W I;  1LQS L;  4NN5 A;  1PGR A;  2IL6 A;  3AYH A;  1EVS A;  1Y6N L;  4DKF A;  3BPN A;  3NPZ A;  1ILK A;  1PY2 A;  1Y1W D;  1BBN A;  1V7N V;  1PW6 A;  3DLQ I;  1CSG A;  3FKI D;  3I4M D;  3HOY D;  1YKB A;  4ZF7 A;  2LMS A;  4I77 Z;  3G9V B;  5LQB A;  3QB1 A;  5C44 D;  2KZ1 A;  3UX9 A;  1RW5 A;  5IP9 D;  4Z5R D;  1M4R A;  1CNT 1;  1IL6 A;  1Y6K L;  2XQB A;  5FUC A;  3VA2 A;  1CD9 A;  5D22 A;  3EJJ A;  1JLI A;  5L6Y C;  4YDY I;  4X51 A;  4FA8 E;  1B5L A;  4YPG C;  1J7V L;  1ITL A;  1VLK A;  3MZG A;  2OQP A;  4A3J D;  4O6K A;  4BY7 D;  3OG6 A;  5IYD D;  4A3F D;  2H24 A;  1BGD A;  4DKD A;  2JA7 D;  2R92 D;  2CYK A;  4YQX A;  4DKC A;  1AXI A;  5IYB D;  5KNH I;  3OQ3 A;  3HHC A;  2VUM D;  4BY1 D;  1D9G A;  5C3E D;  3HOV D;  1M48 A;  3H0G D;  2D9Q A;  2ILK A;  1I1R B;  4EXN A;  4RS1 A;  1Z92 A;  1P9M B;  1RCB A;  3DI3 A;  4DKE A;  1N1F A;  3SE4 B;  2Q98 A;  3HHR A;  3B5K A;  3BPO A;  4YUE C;  3UF5 A;  3UEZ E;  1M4B A;  4LRL A;  3I4N D;  5TS9 A;  1PVH B;  2Q7N B;  4NI7 A;  4O9H A;  1BCN A;  1IAR A;  1Y1V D;  2GMF A;  4WRL B;  1Y6M L;  1EXZ A;  3NCB A;  1AX8 A;  5D70 A;  1GNC A;  1WCM D;  3HOW D;  1EKU A;  3BPL A;  1HWG A;  1WU3 I;  3HOU D;  1QVN A;  2B8U A;  1ITM A;  1F45 B;  4NEM A;  3DUH C;  4A3M D;  2JA5 D;  2B63 D;  1FYH A;  1CN4 C;  4A3D D;  2C35 A;  1LK3 A;  1HIJ A;  4MHL A;  1ALU A;  4NKQ C;  4NN7 A;  2B91 A;  3QWR B;  3LB6 A;  2R7Z D;  2O6I A;  2E9W C;  3NCC A;  4A3C D;  4EXP A;  2JA6 D;  1EMR A;  2Z3R A;  3NCE A;  3S9D A;  1HZI A;  2LAG A;  1BGE A;  4BBS D;  4A93 D;  3D48 P;  3IRH A;  4GS7 A;  1NBP A;  4NN6 A;  3LB6 B;  1A22 A;  3SE3 B;  3H3V E;  2O27 A;  3NCF A;  2L3Y A;  1HUW A;  2JA8 D;  1LKI A;  4GRW A;  1IK0 A;  3L5X A;  4DOH A;  5FHX A;  3PIV A;  1F6F A;  3D87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...