1GNCA

Structure and dynamics of the human granulocyte colony-stimulating factor determined by nmr spectroscopy. loop mobility in a four-helix-bundle protein
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
178
structure length
175
Chain Sequence
MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Growth factor
molecule keywords GRANULOCYTE COLONY-STIMULATING FACTOR
publication title Structure and dynamics of the human granulocyte colony-stimulating factor determined by NMR spectroscopy. Loop mobility in a four-helix-bundle protein.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 175
sequence length 178
ec nomenclature
pdb deposition date 1994-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16647 GCSF Granulocyte colony-stimulating factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1250.10 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; Growth Hormone; Chain: A; 1gncA00
3N0PA 5KNHI 3EJJA 4NEMA 2Q7NB 1EXZA 1BGCA 1M4RA 1BBNA 4NEJA 1P9MB 1F6FA 2GMFA 3UF2A 1ITMA 3SE4B 1INRA 4NI9A 3QT2C 2L3YA 2INTA 1PW6A 4YUEC 1IARA 1V7NV 3B5KA 1LQSL 3WCYI 1HIJA 1VLKA 1IK0A 1AU1A 1WU3I 3NPZA 4DOHA 1CSGA 4WRLB 1A22A 2B91A 2D9QA 1M47A 4YPGC 3DGCL 1BUYA 1M48A 1YKBA 3BPNA 1Z7CA 1IL6A 5D28B 3S9DA 1KF9A 3BPOA 4YDYI 1ALUA 1IJZA 1EERA 2B5IA 3NCEA 4CNIC 2HYMB 5D72A 1HWGA 3BPLA 3HMXB 4RS1A 1RW5A 1A7MA 2IL6A 3G9VB 4GRWA 1F45B 2B90A 2O27A 3NCBA 3SE3B 1CYLA 1Y6ML 2LMSA 1EVSA 1I1RB 2O26A 1M49A 2LAGA 3Q1SI 4MHLA 3L5WI 4Z5RD 1FYHA 1ITIA 2B8XA 1LK3A 1Y6KL 1ETEA 1BGDA 1M4CA 1RFBA 2ILKA 5D71A 4FA8E 3D85C 1HGUA 1EKUA 1BCNA 2Q98A 3QB1A 3QAZA 1NBPA 1RCBA 4ZF7A 1HULA 3N06A 1PGRA 2ERJD 1J7VL 2B8YA 4PS4A 5D22A 2B8UA 1CNT1 3PIWA 3QB7A 3QWRB 1M4BA 3UX9A 3LB6B 5FHXA 1CN4C 2KZ1A 4J4LC 2CYKA 3DLQI 3HHRA 4NI7A 4I77Z 1ILKA 5L6YC 4O9HA 1AX8A 1PVHB 1RHGA 3D48P 5C7XA 4YQXA 5E4EA 3UF5A 1HIKA 2L3OA 3PIVA 1BP3A 1ITFA 3UEZE 1HZIA 1SCFA 1JLIA 2H24A 5D70A 1ITLA 1IRLA 3BESL 1FG9A 1CD9A 2B8ZA 3G6DA 3INKC 1LKIA 4X51A 3NCCA 5LQBA 4O6KA 3DUHC 1GA3A 1HWHA 3L5XA 1BGEA 1D9CA 3VA2A 3EW3A 1V7MV 5FUCA 1AXIA 1M4AA 1PY2A 2E9WC 1EMRA 3MZGA 1GNCA 1B5LA 1QVNA 1Z92A 1HUWA 2D48A 3NCFA 4NKQC 3D87A 3LB6A 1N1FA 3OQ3A 1D9GA 1Y6NL 4ZS7A
chains in the Genus database with same CATH superfamily
4JREA 3EJJA 4IU9A 4Q65A 4NEJA 1F6FA 2GMFA 2JA5D 4A3GD 3B5KA 1AU1A 5D6KA 1IL6A 1KF9A 3OG6A 4DKCA 5A2NA 4CNIC 4YBQA 4RS1A 4TPHA 2R7ZD 3TGXB 4NN7A 3NCBA 4A3CD 1CYLA 4D2DA 4BY1D 4Z5RD 1Y6KL 2ILKA 5D71A 4FA8E 4BY7D 1HGUA 1BCNA 3QAZA 1RCBA 4ZF7A 4EXPA 1PGRA 4A3DD 4PS4A 5D22A 3QB7A 2R92D 1CN4C 2KZ1A 4A3FD 1AX8A 3D48P 5E4EA 4ZWBA 1ITFA 3UEZE 5D70A 1ITLA 1IRLA 3G6DA 1FG9A 3INKC 4U4TA 3H3VE 4IKXA 1HWHA 3L5XA 4XNIA 4U4WA 1BGEA 1AXIA 1PY2A 1EMRA 1B5LA 1WCMD 1QVNA 3DI3A 4UVMA 3NCFA 1N1FA 1GA3A 4NEMA 2Q7NB 1EXZA 1BGCA 1P9MB 1ITMA 2L3YA 2INTA 1PW6A 4YUEC 1LQSL 4YB9D 5IP9D 1A22A 2B91A 1M47A 2V8NA 3HOZD 1YKBA 3BPNA 1Z7CA 5D28B 3BPOA 4LRLA 4YDYI 1ALUA 1EERA 2B5IA 2HYMB 5D72A 1HWGA 1RW5A 1A7MA 4DKEA 4ZW9A 4GRWA 5D58A 5EQHA 2XUTA 3SE3B 1I1RB 4J05A 4MHLA 2LAGA 3Q1SI 3L5WI 2Q14A 3HHCA 2B8XA 1LK3A 4A3ID 1BGDA 3D85C 2Z3QA 4ZYRA 3N06A 3I4MD 2B63D 1M4BA 3UX9A 3LB6B 4A3LD 4IKYA 4J4LC 2CYKA 3HOWD 3DLQI 3HHRA 1ILKA 5L6YC 5D59A 4D2BA 4GBZA 5TS9A 2L3OA 3PIVA 2R93D 4JA3A 1SCFA 2PSMA 1JLIA 2CFQA 1LKIA 1PW4A 5LQBA 3AYHA 3EW3A 5FUCA 2Z3RA 1GNCA 3D87A 3LB6A 3O7PA 4IKZA 1D9GA 4ZS7A 4NN6A 3O7QA 3N0PA 1BBNA 4EXNA 3UF2A 3SE4B 2O6IA 3WCYI 1HIJA 1IK0A 5C44D 3NPZA 4DOHA 4QIQA 4WRLB 3DGCL 3S9DA 4BBSD 3DI2A 4A3KD 3NCEA 4DKFA 3BPLA 3HMXB 5FLMD 5EQIA 4D2CA 3G9VB 4LDSA 2B90A 5EQGA 4TPJA 1Y6ML 1EVSA 1ITIA 2JA7D 1ETEA 1M4CA 1RFBA 2Q98A 3WDOA 1HULA 5IYDD 2B8YA 3QWRB 2XQBA 1PV7A 5C4XD 4NI7A 4I77Z 4OH3A 4O9HA 1PVHB 4ZWCA 5C7XA 4YQXA 1HIKA 1BP3A 1PV6A 4BBRD 3FKID 2H24A 4A3JD 3BESL 2B8ZA 4X51A 4A3BD 5IP7D 1D9CA 3VA2A 1V7MV 4APSA 2E9WC 3PO3D 2Y5YA 1Z92A 1HUWA 1Y1VD 3H0GD 4NKQC 4A93D 2VUMD 3OQ3A 4YPGC 5KNHI 5A2OA 4A3ED 1M4RA 5C3ED 3HOXD 1INRA 4NI9A 3QT2C 1Y14A 1IARA 1V7NV 4IKWA 1VLKA 1WU3I 2JA8D 5GXBA 1CSGA 4GC0A 2D9QA 1BUYA 1M48A 4PYPA 4XNJA 3IRHA 1IJZA 4GBYA 4OAAA 2C35A 4IKVA 2IL6A 4NN5A 1F45B 2O27A 5IYBD 2LMSA 2O26A 1M49A 1FYHA 3PO2D 4IU8A 4U4VA 1EKUA 3QB1A 1NBPA 2ERJD 1J7VL 2JA6D 2OQPA 2B8UA 1CNT1 3PIWA 4LEPA 3HOVD 3HOYD 5FHXA 4W6VA 2CFPA 1RHGA 5IYCD 3UF5A 3I4ND 5C65A 1HZIA 4GS7A 1CD9A 4JR9A 4DKDA 3NCCA 4O6KA 3DUHC 3HOUD 1M4AA 3MZGA 4BXXD 4A3MD 2D48A 3OG4A 1Y1WD 4TPGA 1Y6NL
chains in the Genus database with same CATH topology
3N0PA 5KNHI 3EJJA 4NEMA 2Q7NB 1EXZA 1BGCA 4ZS7A 4A3ED 1M4RA 1BBNA 4NEJA 1P9MB 4EXNA 1F6FA 2GMFA 3UF2A 5C3ED 2JA5D 3HOXD 1ITMA 3SE4B 1INRA 4NI9A 3QT2C 1Y14A 2L3YA 2INTA 1PW6A 4YUEC 1IARA 1V7NV 4A3GD 3B5KA 1LQSL 2O6IA 3WCYI 1HIJA 1VLKA 1IK0A 1AU1A 1WU3I 5IP9D 2JA8D 5C44D 3NPZA 4DOHA 1CSGA 4WRLB 1A22A 2B91A 2D9QA 1M47A 4YPGC 3DGCL 1BUYA 1M48A 3HOZD 1YKBA 3BPNA 1Z7CA 1IL6A 5D28B 3S9DA 1KF9A 3BPOA 4LRLA 3OG6A 4YDYI 3IRHA 1ALUA 1IJZA 1EERA 3DI2A 4DKCA 4BBSD 2C35A 4A3KD 2B5IA 3NCEA 4CNIC 2HYMB 5D72A 4DKFA 1HWGA 3BPLA 3HMXB 5FLMD 4RS1A 1RW5A 1A7MA 2IL6A 2R7ZD 4NN5A 3G9VB 4DKEA 4GRWA 3TGXB 1F45B 2B90A 4NN7A 2O27A 3NCBA 3SE3B 4A3CD 5IYBD 1CYLA 1Y6ML 2LMSA 1EVSA 1I1RB 2O26A 1M49A 2LAGA 3Q1SI 4MHLA 4BY1D 3L5WI 2Q14A 1FYHA 3HHCA 4Z5RD 2JA7D 3PO2D 1ITIA 2B8XA 1LK3A 1Y6KL 1ETEA 4A3ID 1BGDA 1M4CA 1RFBA 2ILKA 5D71A 4FA8E 4BY7D 3D85C 1HGUA 1EKUA 1BCNA 2Q98A 3QB1A 3QAZA 1NBPA 1RCBA 2Z3QA 4ZF7A 4EXPA 1HULA 5IYDD 3N06A 3I4MD 1PGRA 2ERJD 1J7VL 2B8YA 4PS4A 2OQPA 5D22A 2B8UA 1CNT1 2JA6D 4A3DD 3PIWA 3QB7A 3QWRB 2XQBA 2B63D 2R92D 1M4BA 3UX9A 3LB6B 3HOVD 4A3LD 3HOYD 5FHXA 5C4XD 1CN4C 2KZ1A 4J4LC 2CYKA 3HOWD 3DLQI 3HHRA 4NI7A 4I77Z 1ILKA 4A3FD 5L6YC 4O9HA 1AX8A 5TS9A 1PVHB 1RHGA 5IYCD 3D48P 5C7XA 4YQXA 5E4EA 3UF5A 1HIKA 3I4ND 2L3OA 3PIVA 1BP3A 1ITFA 2R93D 3UEZE 1HZIA 4BBRD 3FKID 1SCFA 2PSMA 1JLIA 2H24A 4GS7A 5D70A 3H3VE 4A3JD 1ITLA 1IRLA 3BESL 1FG9A 1CD9A 2B8ZA 3G6DA 3INKC 1LKIA 4X51A 4DKDA 3NCCA 5LQBA 3AYHA 4O6KA 3DUHC 1GA3A 1HWHA 4A3BD 3L5XA 5IP7D 1BGEA 1D9CA 3VA2A 3EW3A 1V7MV 2Z3RA 5FUCA 1AXIA 1M4AA 1PY2A 3HOUD 2E9WC 1EMRA 3PO3D 3MZGA 4BXXD 1GNCA 1B5LA 1WCMD 1QVNA 1Z92A 3DI3A 1HUWA 1Y1VD 4A3MD 2D48A 3NCFA 3OG4A 3H0GD 3D87A 3LB6A 1N1FA 4NKQC 3OQ3A 1Y1WD 1D9GA 2VUMD 4A93D 1Y6NL 4NN6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N0P A;  5KNH I;  3EJJ A;  4NEM A;  2Q7N B;  1EXZ A;  1BGC A;  1M4R A;  1BBN A;  4NEJ A;  1P9M B;  1F6F A;  2GMF A;  3UF2 A;  1ITM A;  3SE4 B;  1INR A;  4NI9 A;  3QT2 C;  2L3Y A;  2INT A;  1PW6 A;  4YUE C;  1IAR A;  1V7N V;  3B5K A;  1LQS L;  3WCY I;  1HIJ A;  1VLK A;  1IK0 A;  1AU1 A;  1WU3 I;  3NPZ A;  4DOH A;  1CSG A;  4WRL B;  1A22 A;  2B91 A;  2D9Q A;  1M47 A;  4YPG C;  3DGC L;  1BUY A;  1M48 A;  1YKB A;  3BPN A;  1Z7C A;  1IL6 A;  5D28 B;  3S9D A;  1KF9 A;  3BPO A;  4YDY I;  1ALU A;  1IJZ A;  1EER A;  2B5I A;  3NCE A;  4CNI C;  2HYM B;  5D72 A;  1HWG A;  3BPL A;  3HMX B;  4RS1 A;  1RW5 A;  1A7M A;  2IL6 A;  3G9V B;  4GRW A;  1F45 B;  2B90 A;  2O27 A;  3NCB A;  3SE3 B;  1CYL A;  1Y6M L;  2LMS A;  1EVS A;  1I1R B;  2O26 A;  1M49 A;  2LAG A;  3Q1S I;  4MHL A;  3L5W I;  4Z5R D;  1FYH A;  1ITI A;  2B8X A;  1LK3 A;  1Y6K L;  1ETE A;  1BGD A;  1M4C A;  1RFB A;  2ILK A;  5D71 A;  4FA8 E;  3D85 C;  1HGU A;  1EKU A;  1BCN A;  2Q98 A;  3QB1 A;  3QAZ A;  1NBP A;  1RCB A;  4ZF7 A;  1HUL A;  3N06 A;  1PGR A;  2ERJ D;  1J7V L;  2B8Y A;  4PS4 A;  5D22 A;  2B8U A;  1CNT 1;  3PIW A;  3QB7 A;  3QWR B;  1M4B A;  3UX9 A;  3LB6 B;  5FHX A;  1CN4 C;  2KZ1 A;  4J4L C;  2CYK A;  3DLQ I;  3HHR A;  4NI7 A;  4I77 Z;  1ILK A;  5L6Y C;  4O9H A;  1AX8 A;  1PVH B;  1RHG A;  3D48 P;  5C7X A;  4YQX A;  5E4E A;  3UF5 A;  1HIK A;  2L3O A;  3PIV A;  1BP3 A;  1ITF A;  3UEZ E;  1HZI A;  1SCF A;  1JLI A;  2H24 A;  5D70 A;  1ITL A;  1IRL A;  3BES L;  1FG9 A;  1CD9 A;  2B8Z A;  3G6D A;  3INK C;  1LKI A;  4X51 A;  3NCC A;  5LQB A;  4O6K A;  3DUH C;  1GA3 A;  1HWH A;  3L5X A;  1BGE A;  1D9C A;  3VA2 A;  3EW3 A;  1V7M V;  5FUC A;  1AXI A;  1M4A A;  1PY2 A;  2E9W C;  1EMR A;  3MZG A;  1GNC A;  1B5L A;  1QVN A;  1Z92 A;  1HUW A;  2D48 A;  3NCF A;  4NKQ C;  3D87 A;  3LB6 A;  1N1F A;  3OQ3 A;  1D9G A;  1Y6N L;  4ZS7 A; 
#chains in the Genus database with same CATH topology
 4JRE A;  3EJJ A;  4IU9 A;  4Q65 A;  4NEJ A;  1F6F A;  2GMF A;  2JA5 D;  4A3G D;  3B5K A;  1AU1 A;  5D6K A;  1IL6 A;  1KF9 A;  3OG6 A;  4DKC A;  5A2N A;  4CNI C;  4YBQ A;  4RS1 A;  4TPH A;  2R7Z D;  3TGX B;  4NN7 A;  3NCB A;  4A3C D;  1CYL A;  4D2D A;  4BY1 D;  4Z5R D;  1Y6K L;  2ILK A;  5D71 A;  4FA8 E;  4BY7 D;  1HGU A;  1BCN A;  3QAZ A;  1RCB A;  4ZF7 A;  4EXP A;  1PGR A;  4A3D D;  4PS4 A;  5D22 A;  3QB7 A;  2R92 D;  1CN4 C;  2KZ1 A;  4A3F D;  1AX8 A;  3D48 P;  5E4E A;  4ZWB A;  1ITF A;  3UEZ E;  5D70 A;  1ITL A;  1IRL A;  3G6D A;  1FG9 A;  3INK C;  4U4T A;  3H3V E;  4IKX A;  1HWH A;  3L5X A;  4XNI A;  4U4W A;  1BGE A;  1AXI A;  1PY2 A;  1EMR A;  1B5L A;  1WCM D;  1QVN A;  3DI3 A;  4UVM A;  3NCF A;  1N1F A;  1GA3 A;  4NEM A;  2Q7N B;  1EXZ A;  1BGC A;  1P9M B;  1ITM A;  2L3Y A;  2INT A;  1PW6 A;  4YUE C;  1LQS L;  4YB9 D;  5IP9 D;  1A22 A;  2B91 A;  1M47 A;  2V8N A;  3HOZ D;  1YKB A;  3BPN A;  1Z7C A;  5D28 B;  3BPO A;  4LRL A;  4YDY I;  1ALU A;  1EER A;  2B5I A;  2HYM B;  5D72 A;  1HWG A;  1RW5 A;  1A7M A;  4DKE A;  4ZW9 A;  4GRW A;  5D58 A;  5EQH A;  2XUT A;  3SE3 B;  1I1R B;  4J05 A;  4MHL A;  2LAG A;  3Q1S I;  3L5W I;  2Q14 A;  3HHC A;  2B8X A;  1LK3 A;  4A3I D;  1BGD A;  3D85 C;  2Z3Q A;  4ZYR A;  3N06 A;  3I4M D;  2B63 D;  1M4B A;  3UX9 A;  3LB6 B;  4A3L D;  4IKY A;  4J4L C;  2CYK A;  3HOW D;  3DLQ I;  3HHR A;  1ILK A;  5L6Y C;  5D59 A;  4D2B A;  4GBZ A;  5TS9 A;  2L3O A;  3PIV A;  2R93 D;  4JA3 A;  1SCF A;  2PSM A;  1JLI A;  2CFQ A;  1LKI A;  1PW4 A;  5LQB A;  3AYH A;  3EW3 A;  5FUC A;  2Z3R A;  1GNC A;  3D87 A;  3LB6 A;  3O7P A;  4IKZ A;  1D9G A;  4ZS7 A;  4NN6 A;  3O7Q A;  3N0P A;  1BBN A;  4EXN A;  3UF2 A;  3SE4 B;  2O6I A;  3WCY I;  1HIJ A;  1IK0 A;  5C44 D;  3NPZ A;  4DOH A;  4QIQ A;  4WRL B;  3DGC L;  3S9D A;  4BBS D;  3DI2 A;  4A3K D;  3NCE A;  4DKF A;  3BPL A;  3HMX B;  5FLM D;  5EQI A;  4D2C A;  3G9V B;  4LDS A;  2B90 A;  5EQG A;  4TPJ A;  1Y6M L;  1EVS A;  1ITI A;  2JA7 D;  1ETE A;  1M4C A;  1RFB A;  2Q98 A;  3WDO A;  1HUL A;  5IYD D;  2B8Y A;  3QWR B;  2XQB A;  1PV7 A;  5C4X D;  4NI7 A;  4I77 Z;  4OH3 A;  4O9H A;  1PVH B;  4ZWC A;  5C7X A;  4YQX A;  1HIK A;  1BP3 A;  1PV6 A;  4BBR D;  3FKI D;  2H24 A;  4A3J D;  3BES L;  2B8Z A;  4X51 A;  4A3B D;  5IP7 D;  1D9C A;  3VA2 A;  1V7M V;  4APS A;  2E9W C;  3PO3 D;  2Y5Y A;  1Z92 A;  1HUW A;  1Y1V D;  3H0G D;  4NKQ C;  4A93 D;  2VUM D;  3OQ3 A;  4YPG C;  5KNH I;  5A2O A;  4A3E D;  1M4R A;  5C3E D;  3HOX D;  1INR A;  4NI9 A;  3QT2 C;  1Y14 A;  1IAR A;  1V7N V;  4IKW A;  1VLK A;  1WU3 I;  2JA8 D;  5GXB A;  1CSG A;  4GC0 A;  2D9Q A;  1BUY A;  1M48 A;  4PYP A;  4XNJ A;  3IRH A;  1IJZ A;  4GBY A;  4OAA A;  2C35 A;  4IKV A;  2IL6 A;  4NN5 A;  1F45 B;  2O27 A;  5IYB D;  2LMS A;  2O26 A;  1M49 A;  1FYH A;  3PO2 D;  4IU8 A;  4U4V A;  1EKU A;  3QB1 A;  1NBP A;  2ERJ D;  1J7V L;  2JA6 D;  2OQP A;  2B8U A;  1CNT 1;  3PIW A;  4LEP A;  3HOV D;  3HOY D;  5FHX A;  4W6V A;  2CFP A;  1RHG A;  5IYC D;  3UF5 A;  3I4N D;  5C65 A;  1HZI A;  4GS7 A;  1CD9 A;  4JR9 A;  4DKD A;  3NCC A;  4O6K A;  3DUH C;  3HOU D;  1M4A A;  3MZG A;  4BXX D;  4A3M D;  2D48 A;  3OG4 A;  1Y1W D;  4TPG A;  1Y6N L; 
#chains in the Genus database with same CATH homology
 3N0P A;  5KNH I;  3EJJ A;  4NEM A;  2Q7N B;  1EXZ A;  1BGC A;  4ZS7 A;  4A3E D;  1M4R A;  1BBN A;  4NEJ A;  1P9M B;  4EXN A;  1F6F A;  2GMF A;  3UF2 A;  5C3E D;  2JA5 D;  3HOX D;  1ITM A;  3SE4 B;  1INR A;  4NI9 A;  3QT2 C;  1Y14 A;  2L3Y A;  2INT A;  1PW6 A;  4YUE C;  1IAR A;  1V7N V;  4A3G D;  3B5K A;  1LQS L;  2O6I A;  3WCY I;  1HIJ A;  1VLK A;  1IK0 A;  1AU1 A;  1WU3 I;  5IP9 D;  2JA8 D;  5C44 D;  3NPZ A;  4DOH A;  1CSG A;  4WRL B;  1A22 A;  2B91 A;  2D9Q A;  1M47 A;  4YPG C;  3DGC L;  1BUY A;  1M48 A;  3HOZ D;  1YKB A;  3BPN A;  1Z7C A;  1IL6 A;  5D28 B;  3S9D A;  1KF9 A;  3BPO A;  4LRL A;  3OG6 A;  4YDY I;  3IRH A;  1ALU A;  1IJZ A;  1EER A;  3DI2 A;  4DKC A;  4BBS D;  2C35 A;  4A3K D;  2B5I A;  3NCE A;  4CNI C;  2HYM B;  5D72 A;  4DKF A;  1HWG A;  3BPL A;  3HMX B;  5FLM D;  4RS1 A;  1RW5 A;  1A7M A;  2IL6 A;  2R7Z D;  4NN5 A;  3G9V B;  4DKE A;  4GRW A;  3TGX B;  1F45 B;  2B90 A;  4NN7 A;  2O27 A;  3NCB A;  3SE3 B;  4A3C D;  5IYB D;  1CYL A;  1Y6M L;  2LMS A;  1EVS A;  1I1R B;  2O26 A;  1M49 A;  2LAG A;  3Q1S I;  4MHL A;  4BY1 D;  3L5W I;  2Q14 A;  1FYH A;  3HHC A;  4Z5R D;  2JA7 D;  3PO2 D;  1ITI A;  2B8X A;  1LK3 A;  1Y6K L;  1ETE A;  4A3I D;  1BGD A;  1M4C A;  1RFB A;  2ILK A;  5D71 A;  4FA8 E;  4BY7 D;  3D85 C;  1HGU A;  1EKU A;  1BCN A;  2Q98 A;  3QB1 A;  3QAZ A;  1NBP A;  1RCB A;  2Z3Q A;  4ZF7 A;  4EXP A;  1HUL A;  5IYD D;  3N06 A;  3I4M D;  1PGR A;  2ERJ D;  1J7V L;  2B8Y A;  4PS4 A;  2OQP A;  5D22 A;  2B8U A;  1CNT 1;  2JA6 D;  4A3D D;  3PIW A;  3QB7 A;  3QWR B;  2XQB A;  2B63 D;  2R92 D;  1M4B A;  3UX9 A;  3LB6 B;  3HOV D;  4A3L D;  3HOY D;  5FHX A;  5C4X D;  1CN4 C;  2KZ1 A;  4J4L C;  2CYK A;  3HOW D;  3DLQ I;  3HHR A;  4NI7 A;  4I77 Z;  1ILK A;  4A3F D;  5L6Y C;  4O9H A;  1AX8 A;  5TS9 A;  1PVH B;  1RHG A;  5IYC D;  3D48 P;  5C7X A;  4YQX A;  5E4E A;  3UF5 A;  1HIK A;  3I4N D;  2L3O A;  3PIV A;  1BP3 A;  1ITF A;  2R93 D;  3UEZ E;  1HZI A;  4BBR D;  3FKI D;  1SCF A;  2PSM A;  1JLI A;  2H24 A;  4GS7 A;  5D70 A;  3H3V E;  4A3J D;  1ITL A;  1IRL A;  3BES L;  1FG9 A;  1CD9 A;  2B8Z A;  3G6D A;  3INK C;  1LKI A;  4X51 A;  4DKD A;  3NCC A;  5LQB A;  3AYH A;  4O6K A;  3DUH C;  1GA3 A;  1HWH A;  4A3B D;  3L5X A;  5IP7 D;  1BGE A;  1D9C A;  3VA2 A;  3EW3 A;  1V7M V;  2Z3R A;  5FUC A;  1AXI A;  1M4A A;  1PY2 A;  3HOU D;  2E9W C;  1EMR A;  3PO3 D;  3MZG A;  4BXX D;  1GNC A;  1B5L A;  1WCM D;  1QVN A;  1Z92 A;  3DI3 A;  1HUW A;  1Y1V D;  4A3M D;  2D48 A;  3NCF A;  3OG4 A;  3H0G D;  3D87 A;  3LB6 A;  1N1F A;  4NKQ C;  3OQ3 A;  1Y1W D;  1D9G A;  2VUM D;  4A93 D;  1Y6N L;  4NN6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...