1IK0A

Solution structure of human il-13
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
113
structure length
113
Chain Sequence
MGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords INTERLEUKIN-13
publication title Solution structure of human IL-13 and implication for receptor binding.
pubmed doi rcsb
source organism Homo sapiens
total genus 23
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2001-05-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1250.10 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; Growth Hormone; Chain: A; 1ik0A00
2KZ1A 3PIVA 1Y6ML 4YQXA 4J4LC 3SE3B 1BP3A 3DUHC 1D9CA 3UF5A 1M4CA 1BGDA 5E4EA 1GNCA 5D22A 2B91A 4NI7A 2B90A 4DOHA 5LQBA 1BBNA 1M4AA 1CNT1 1IJZA 4WRLB 4O9HA 5D70A 1AX8A 5D71A 1A22A 3MZGA 1ETEA 5D28B 1ITIA 4I77Z 5D72A 3NCFA 1F45B 2Q98A 3G6DA 3NCEA 2B8XA 1V7NV 1IRLA 3N06A 1YKBA 3UEZE 1LKIA 4NEMA 1FYHA 1ALUA 2GMFA 2LMSA 4PS4A 3UX9A 1Y6NL 1JLIA 2E9WC 5FHXA 1F6FA 2IL6A 1IK0A 1FG9A 2L3YA 4ZS7A 3D87A 3EW3A 2LAGA 1HZIA 1CD9A 1IL6A 3QT2C 1HWHA 1RW5A 3QAZA 1HULA 1LK3A 5FUCA 3Q1SI 1BCNA 1EXZA 3LB6A 3S9DA 1EERA 3L5WI 4NEJA 1AU1A 2HYMB 4MHLA 3DLQI 1EMRA 1BGEA 3NCCA 1HIJA 3HMXB 1I1RB 3SE4B 1CN4C 3NPZA 3VA2A 4GRWA 1RFBA 1SCFA 3BESL 2D9QA 1V7MV 1ILKA 1M48A 3BPOA 1B5LA 3HHRA 5C7XA 3INKC 4RS1A 1Z7CA 1HUWA 2O26A 4YPGC 1PW6A 1IARA 1M47A 4Z5RD 5L6YC 1J7VL 1CYLA 1M4RA 1INRA 1RHGA 3NCBA 3D85C 1GA3A 1HGUA 1P9MB 1ITLA 5KNHI 1ITMA 1VLKA 1HIKA 2B8ZA 1RCBA 4X51A 4CNIC 1ITFA 1LQSL 1BUYA 2INTA 1Z92A 2Q7NB 4NI9A 3B5KA 1A7MA 3G9VB 1D9GA 3D48P 2H24A 3OQ3A 2CYKA 2O27A 2B8YA 1PY2A 3LB6B 1CSGA 2ERJD 3L5XA 1WU3I 1M4BA 3QWRB 1EVSA 2D48A 1N1FA 3PIWA 1EKUA 4NKQC 2B8UA 4YDYI 3QB1A 3BPNA 3WCYI 1PVHB 1M49A 1AXIA 1Y6KL 1PGRA 3QB7A 1KF9A 2B5IA 2ILKA 3BPLA 1HWGA 4YUEC 3UF2A 1QVNA 3N0PA 4ZF7A 3EJJA 4O6KA 2L3OA 1BGCA 1NBPA 3DGCL 4FA8E
chains in the Genus database with same CATH superfamily
3PIVA 3SE3B 4U4VA 3DUHC 3UF5A 1M4CA 4U4WA 4TPJA 2B91A 2B90A 1BBNA 4OH3A 1M4AA 4O9HA 4IKVA 1A22A 4J05A 5D28B 4A3KD 2Q98A 4D2CA 5IYDD 1IRLA 3UEZE 2OQPA 4DKFA 2GMFA 1PV7A 2E9WC 1F6FA 1IK0A 4BY1D 3EW3A 4A3CD 2LAGA 1IL6A 2PSMA 1RW5A 3LB6A 3AYHA 3HOUD 4DKEA 2HYMB 1EMRA 3HMXB 3FKID 3HOZD 4A3ED 1B5LA 4EXPA 4IKYA 1Z7CA 4GC0A 1HUWA 4YPGC 1PW6A 1INRA 4DKDA 4YB9D 3D85C 4A3GD 4U4TA 1ITLA 5KNHI 4X51A 1LQSL 1A7MA 1D9GA 3D48P 4LRLA 4UVMA 3QWRB 2D48A 1M49A 1Y6KL 1PGRA 1KF9A 1HWGA 1QVNA 4ZF7A 4NN5A 1NBPA 2B63D 1Y6ML 2Z3RA 4ZW9A 5E4EA 2JA8D 5IYCD 5C44D 2XUTA 4A3DD 5D70A 5D71A 3MZGA 1ETEA 5D72A 3NCFA 3G6DA 3NCEA 1V7NV 3DI3A 1ALUA 2LMSA 4PS4A 1Y6NL 1JLIA 3TGXB 3D87A 1Y1WD 1HULA 1LK3A 5FUCA 3Q1SI 1BCNA 4MHLA 1HIJA 2JA6D 4APSA 4NN6A 4GRWA 3VA2A 4JREA 3BESL 1V7MV 3O7QA 3BPOA 5C7XA 2R92D 4A3FD 3INKC 3PO3D 3HOXD 4Z5RD 1CYLA 1RHGA 1GA3A 1ITMA 5D58A 3HOVD 4IKWA 4IU9A 5C3ED 1ITFA 2INTA 5C4XD 3HHCA 3B5KA 3HOYD 5C65A 2H24A 5A2OA 2B8YA 4ZYRA 4NN7A 3LB6B 4XNIA 2ERJD 4NKQC 1N1FA 3PIWA 1EKUA 3QB1A 3QB7A 5D59A 2ILKA 3BPLA 4YUEC 2CFQA 4O6KA 4FA8E 1PW4A 4GS7A 4LEPA 1D9CA 3H3VE 1GNCA 4GBZA 4QIQA 4NI7A 4DOHA 4IKXA 1IJZA 3I4MD 4WRLB 4BY7D 1AX8A 4XNJA 1ITIA 4I77Z 2XQBA 3UX9A 2R93D 5FHXA 2IL6A 1FG9A 4ZS7A 4D2BA 2C35A 4D2DA 1EERA 2JA5D 1BGEA 3NCCA 1CN4C 1RFBA 1ILKA 1M48A 3HHRA 4A3BD 2R7ZD 1Y1VD 2O26A 1IARA 1M47A 3IRHA 1J7VL 3NCBA 4BXXD 4ZWBA 3DI2A 1P9MB 5EQHA 4TPHA 4EXNA 1VLKA 3I4ND 1HIKA 3H0GD 4DKCA 4CNIC 1BUYA 1Z92A 2Q7NB 3OG6A 3OQ3A 2O27A 3O7PA 1PY2A 5TS9A 3L5XA 1WU3I 1M4BA 4A3JD 4YDYI 2B8UA 4YBQA 3BPNA 1PVHB 1AXIA 3UF2A 4GBYA 3N0PA 4JA3A 3PO2D 1BGCA 4A3ID 2Q14A 2KZ1A 4YQXA 4J4LC 1BP3A 5IYBD 1BGDA 5D22A 2JA7D 5LQBA 2V8NA 1CNT1 2O6IA 1F45B 2B8XA 3N06A 4IKZA 1YKBA 3HOWD 1LKIA 4NEMA 4TPGA 1FYHA 5IP7D 4PYPA 2L3YA 1HZIA 1CD9A 5EQGA 3QT2C 1HWHA 3QAZA 5EQIA 1EXZA 4IU8A 3S9DA 3L5WI 4NEJA 1AU1A 3DLQI 3OG4A 3SE4B 1I1RB 3NPZA 2Y5YA 1Y14A 1SCFA 1WCMD 2D9QA 4W6VA 4BBRD 5GXBA 3WDOA 4RS1A 4A3LD 1PV6A 5L6YC 1M4RA 1HGUA 4ZWCA 2B8ZA 1RCBA 4NI9A 5A2NA 5FLMD 5IP9D 3G9VB 4Q65A 2CYKA 2CFPA 4A93D 1CSGA 4OAAA 1EVSA 3WCYI 2VUMD 4JR9A 2B5IA 4BBSD 3EJJA 4A3MD 2Z3QA 2L3OA 4LDSA 5D6KA 3DGCL
chains in the Genus database with same CATH topology
2KZ1A 3PIVA 2B63D 1Y6ML 4YQXA 4J4LC 3SE3B 2Z3RA 1BP3A 4GS7A 3DUHC 1D9CA 3UF5A 1M4CA 5IYBD 1BGDA 5E4EA 2JA8D 3H3VE 5IYCD 1GNCA 5D22A 2B91A 2JA7D 4NI7A 2B90A 4DOHA 5LQBA 1BBNA 5C44D 1M4AA 1CNT1 1IJZA 3I4MD 4WRLB 4A3DD 4O9HA 4BY7D 5D70A 1AX8A 5D71A 2O6IA 1A22A 3MZGA 1ETEA 5D28B 1ITIA 4I77Z 5D72A 3NCFA 4A3KD 1F45B 2Q98A 3G6DA 3NCEA 5IYDD 2B8XA 1V7NV 2XQBA 1IRLA 3N06A 1YKBA 3UEZE 3DI3A 2OQPA 1LKIA 4NEMA 3HOWD 4DKFA 1FYHA 1ALUA 2GMFA 2LMSA 4PS4A 3UX9A 1Y6NL 1JLIA 2E9WC 5IP7D 5FHXA 2R93D 1F6FA 2IL6A 1IK0A 3TGXB 4BY1D 1FG9A 2L3YA 4ZS7A 3D87A 3EW3A 4A3CD 2LAGA 1Y1WD 1HZIA 1CD9A 1IL6A 2PSMA 3QT2C 1HWHA 1RW5A 2C35A 3QAZA 1HULA 1LK3A 5FUCA 3Q1SI 1BCNA 1EXZA 3LB6A 3AYHA 3S9DA 3HOUD 1EERA 4DKEA 3L5WI 4NEJA 1AU1A 2HYMB 4MHLA 2JA5D 3DLQI 1EMRA 3OG4A 1BGEA 3NCCA 1HIJA 3HMXB 1I1RB 3SE4B 1CN4C 3FKID 3NPZA 2JA6D 1Y14A 3HOZD 4NN6A 4GRWA 3VA2A 1RFBA 1SCFA 4A3ED 3BESL 1WCMD 1V7MV 1ILKA 2D9QA 1M48A 3BPOA 1B5LA 3HHRA 4BBRD 5C7XA 4A3FD 3INKC 2R92D 4A3BD 4RS1A 4EXPA 2R7ZD 1Y1VD 4A3LD 3PO3D 1Z7CA 1HUWA 2O26A 4YPGC 1PW6A 1IARA 1M47A 3IRHA 3HOXD 4Z5RD 5L6YC 1J7VL 1CYLA 1M4RA 1INRA 1RHGA 3NCBA 4BXXD 4DKDA 3D85C 1GA3A 3DI2A 1HGUA 1P9MB 4A3GD 1ITLA 5KNHI 4EXNA 1ITMA 1VLKA 3HOVD 3I4ND 1HIKA 3H0GD 2B8ZA 5C3ED 1RCBA 4DKCA 4X51A 4CNIC 1ITFA 1LQSL 1BUYA 2INTA 1Z92A 5C4XD 3HHCA 2Q7NB 4NI9A 3B5KA 1A7MA 3HOYD 3OG6A 5FLMD 5IP9D 3G9VB 1D9GA 3D48P 2H24A 3OQ3A 4LRLA 2CYKA 2O27A 2B8YA 4NN7A 1PY2A 3LB6B 5TS9A 4A93D 1CSGA 2ERJD 3L5XA 1WU3I 1M4BA 3QWRB 1EVSA 2D48A 1N1FA 3PIWA 1EKUA 4NKQC 2B8UA 4YDYI 4A3JD 3QB1A 3BPNA 3WCYI 2VUMD 1PVHB 1M49A 1AXIA 1Y6KL 1PGRA 3QB7A 1KF9A 2B5IA 4BBSD 2ILKA 3BPLA 1HWGA 4YUEC 3UF2A 1QVNA 3N0PA 4ZF7A 4NN5A 3EJJA 4A3MD 3PO2D 2Z3QA 4O6KA 2L3OA 1BGCA 1NBPA 4A3ID 3DGCL 4FA8E 2Q14A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KZ1 A;  3PIV A;  1Y6M L;  4YQX A;  4J4L C;  3SE3 B;  1BP3 A;  3DUH C;  1D9C A;  3UF5 A;  1M4C A;  1BGD A;  5E4E A;  1GNC A;  5D22 A;  2B91 A;  4NI7 A;  2B90 A;  4DOH A;  5LQB A;  1BBN A;  1M4A A;  1CNT 1;  1IJZ A;  4WRL B;  4O9H A;  5D70 A;  1AX8 A;  5D71 A;  1A22 A;  3MZG A;  1ETE A;  5D28 B;  1ITI A;  4I77 Z;  5D72 A;  3NCF A;  1F45 B;  2Q98 A;  3G6D A;  3NCE A;  2B8X A;  1V7N V;  1IRL A;  3N06 A;  1YKB A;  3UEZ E;  1LKI A;  4NEM A;  1FYH A;  1ALU A;  2GMF A;  2LMS A;  4PS4 A;  3UX9 A;  1Y6N L;  1JLI A;  2E9W C;  5FHX A;  1F6F A;  2IL6 A;  1IK0 A;  1FG9 A;  2L3Y A;  4ZS7 A;  3D87 A;  3EW3 A;  2LAG A;  1HZI A;  1CD9 A;  1IL6 A;  3QT2 C;  1HWH A;  1RW5 A;  3QAZ A;  1HUL A;  1LK3 A;  5FUC A;  3Q1S I;  1BCN A;  1EXZ A;  3LB6 A;  3S9D A;  1EER A;  3L5W I;  4NEJ A;  1AU1 A;  2HYM B;  4MHL A;  3DLQ I;  1EMR A;  1BGE A;  3NCC A;  1HIJ A;  3HMX B;  1I1R B;  3SE4 B;  1CN4 C;  3NPZ A;  3VA2 A;  4GRW A;  1RFB A;  1SCF A;  3BES L;  2D9Q A;  1V7M V;  1ILK A;  1M48 A;  3BPO A;  1B5L A;  3HHR A;  5C7X A;  3INK C;  4RS1 A;  1Z7C A;  1HUW A;  2O26 A;  4YPG C;  1PW6 A;  1IAR A;  1M47 A;  4Z5R D;  5L6Y C;  1J7V L;  1CYL A;  1M4R A;  1INR A;  1RHG A;  3NCB A;  3D85 C;  1GA3 A;  1HGU A;  1P9M B;  1ITL A;  5KNH I;  1ITM A;  1VLK A;  1HIK A;  2B8Z A;  1RCB A;  4X51 A;  4CNI C;  1ITF A;  1LQS L;  1BUY A;  2INT A;  1Z92 A;  2Q7N B;  4NI9 A;  3B5K A;  1A7M A;  3G9V B;  1D9G A;  3D48 P;  2H24 A;  3OQ3 A;  2CYK A;  2O27 A;  2B8Y A;  1PY2 A;  3LB6 B;  1CSG A;  2ERJ D;  3L5X A;  1WU3 I;  1M4B A;  3QWR B;  1EVS A;  2D48 A;  1N1F A;  3PIW A;  1EKU A;  4NKQ C;  2B8U A;  4YDY I;  3QB1 A;  3BPN A;  3WCY I;  1PVH B;  1M49 A;  1AXI A;  1Y6K L;  1PGR A;  3QB7 A;  1KF9 A;  2B5I A;  2ILK A;  3BPL A;  1HWG A;  4YUE C;  3UF2 A;  1QVN A;  3N0P A;  4ZF7 A;  3EJJ A;  4O6K A;  2L3O A;  1BGC A;  1NBP A;  3DGC L;  4FA8 E; 
#chains in the Genus database with same CATH topology
 3PIV A;  3SE3 B;  4U4V A;  3DUH C;  3UF5 A;  1M4C A;  4U4W A;  4TPJ A;  2B91 A;  2B90 A;  1BBN A;  4OH3 A;  1M4A A;  4O9H A;  4IKV A;  1A22 A;  4J05 A;  5D28 B;  4A3K D;  2Q98 A;  4D2C A;  5IYD D;  1IRL A;  3UEZ E;  2OQP A;  4DKF A;  2GMF A;  1PV7 A;  2E9W C;  1F6F A;  1IK0 A;  4BY1 D;  3EW3 A;  4A3C D;  2LAG A;  1IL6 A;  2PSM A;  1RW5 A;  3LB6 A;  3AYH A;  3HOU D;  4DKE A;  2HYM B;  1EMR A;  3HMX B;  3FKI D;  3HOZ D;  4A3E D;  1B5L A;  4EXP A;  4IKY A;  1Z7C A;  4GC0 A;  1HUW A;  4YPG C;  1PW6 A;  1INR A;  4DKD A;  4YB9 D;  3D85 C;  4A3G D;  4U4T A;  1ITL A;  5KNH I;  4X51 A;  1LQS L;  1A7M A;  1D9G A;  3D48 P;  4LRL A;  4UVM A;  3QWR B;  2D48 A;  1M49 A;  1Y6K L;  1PGR A;  1KF9 A;  1HWG A;  1QVN A;  4ZF7 A;  4NN5 A;  1NBP A;  2B63 D;  1Y6M L;  2Z3R A;  4ZW9 A;  5E4E A;  2JA8 D;  5IYC D;  5C44 D;  2XUT A;  4A3D D;  5D70 A;  5D71 A;  3MZG A;  1ETE A;  5D72 A;  3NCF A;  3G6D A;  3NCE A;  1V7N V;  3DI3 A;  1ALU A;  2LMS A;  4PS4 A;  1Y6N L;  1JLI A;  3TGX B;  3D87 A;  1Y1W D;  1HUL A;  1LK3 A;  5FUC A;  3Q1S I;  1BCN A;  4MHL A;  1HIJ A;  2JA6 D;  4APS A;  4NN6 A;  4GRW A;  3VA2 A;  4JRE A;  3BES L;  1V7M V;  3O7Q A;  3BPO A;  5C7X A;  2R92 D;  4A3F D;  3INK C;  3PO3 D;  3HOX D;  4Z5R D;  1CYL A;  1RHG A;  1GA3 A;  1ITM A;  5D58 A;  3HOV D;  4IKW A;  4IU9 A;  5C3E D;  1ITF A;  2INT A;  5C4X D;  3HHC A;  3B5K A;  3HOY D;  5C65 A;  2H24 A;  5A2O A;  2B8Y A;  4ZYR A;  4NN7 A;  3LB6 B;  4XNI A;  2ERJ D;  4NKQ C;  1N1F A;  3PIW A;  1EKU A;  3QB1 A;  3QB7 A;  5D59 A;  2ILK A;  3BPL A;  4YUE C;  2CFQ A;  4O6K A;  4FA8 E;  1PW4 A;  4GS7 A;  4LEP A;  1D9C A;  3H3V E;  1GNC A;  4GBZ A;  4QIQ A;  4NI7 A;  4DOH A;  4IKX A;  1IJZ A;  3I4M D;  4WRL B;  4BY7 D;  1AX8 A;  4XNJ A;  1ITI A;  4I77 Z;  2XQB A;  3UX9 A;  2R93 D;  5FHX A;  2IL6 A;  1FG9 A;  4ZS7 A;  4D2B A;  2C35 A;  4D2D A;  1EER A;  2JA5 D;  1BGE A;  3NCC A;  1CN4 C;  1RFB A;  1ILK A;  1M48 A;  3HHR A;  4A3B D;  2R7Z D;  1Y1V D;  2O26 A;  1IAR A;  1M47 A;  3IRH A;  1J7V L;  3NCB A;  4BXX D;  4ZWB A;  3DI2 A;  1P9M B;  5EQH A;  4TPH A;  4EXN A;  1VLK A;  3I4N D;  1HIK A;  3H0G D;  4DKC A;  4CNI C;  1BUY A;  1Z92 A;  2Q7N B;  3OG6 A;  3OQ3 A;  2O27 A;  3O7P A;  1PY2 A;  5TS9 A;  3L5X A;  1WU3 I;  1M4B A;  4A3J D;  4YDY I;  2B8U A;  4YBQ A;  3BPN A;  1PVH B;  1AXI A;  3UF2 A;  4GBY A;  3N0P A;  4JA3 A;  3PO2 D;  1BGC A;  4A3I D;  2Q14 A;  2KZ1 A;  4YQX A;  4J4L C;  1BP3 A;  5IYB D;  1BGD A;  5D22 A;  2JA7 D;  5LQB A;  2V8N A;  1CNT 1;  2O6I A;  1F45 B;  2B8X A;  3N06 A;  4IKZ A;  1YKB A;  3HOW D;  1LKI A;  4NEM A;  4TPG A;  1FYH A;  5IP7 D;  4PYP A;  2L3Y A;  1HZI A;  1CD9 A;  5EQG A;  3QT2 C;  1HWH A;  3QAZ A;  5EQI A;  1EXZ A;  4IU8 A;  3S9D A;  3L5W I;  4NEJ A;  1AU1 A;  3DLQ I;  3OG4 A;  3SE4 B;  1I1R B;  3NPZ A;  2Y5Y A;  1Y14 A;  1SCF A;  1WCM D;  2D9Q A;  4W6V A;  4BBR D;  5GXB A;  3WDO A;  4RS1 A;  4A3L D;  1PV6 A;  5L6Y C;  1M4R A;  1HGU A;  4ZWC A;  2B8Z A;  1RCB A;  4NI9 A;  5A2N A;  5FLM D;  5IP9 D;  3G9V B;  4Q65 A;  2CYK A;  2CFP A;  4A93 D;  1CSG A;  4OAA A;  1EVS A;  3WCY I;  2VUM D;  4JR9 A;  2B5I A;  4BBS D;  3EJJ A;  4A3M D;  2Z3Q A;  2L3O A;  4LDS A;  5D6K A;  3DGC L; 
#chains in the Genus database with same CATH homology
 2KZ1 A;  3PIV A;  2B63 D;  1Y6M L;  4YQX A;  4J4L C;  3SE3 B;  2Z3R A;  1BP3 A;  4GS7 A;  3DUH C;  1D9C A;  3UF5 A;  1M4C A;  5IYB D;  1BGD A;  5E4E A;  2JA8 D;  3H3V E;  5IYC D;  1GNC A;  5D22 A;  2B91 A;  2JA7 D;  4NI7 A;  2B90 A;  4DOH A;  5LQB A;  1BBN A;  5C44 D;  1M4A A;  1CNT 1;  1IJZ A;  3I4M D;  4WRL B;  4A3D D;  4O9H A;  4BY7 D;  5D70 A;  1AX8 A;  5D71 A;  2O6I A;  1A22 A;  3MZG A;  1ETE A;  5D28 B;  1ITI A;  4I77 Z;  5D72 A;  3NCF A;  4A3K D;  1F45 B;  2Q98 A;  3G6D A;  3NCE A;  5IYD D;  2B8X A;  1V7N V;  2XQB A;  1IRL A;  3N06 A;  1YKB A;  3UEZ E;  3DI3 A;  2OQP A;  1LKI A;  4NEM A;  3HOW D;  4DKF A;  1FYH A;  1ALU A;  2GMF A;  2LMS A;  4PS4 A;  3UX9 A;  1Y6N L;  1JLI A;  2E9W C;  5IP7 D;  5FHX A;  2R93 D;  1F6F A;  2IL6 A;  1IK0 A;  3TGX B;  4BY1 D;  1FG9 A;  2L3Y A;  4ZS7 A;  3D87 A;  3EW3 A;  4A3C D;  2LAG A;  1Y1W D;  1HZI A;  1CD9 A;  1IL6 A;  2PSM A;  3QT2 C;  1HWH A;  1RW5 A;  2C35 A;  3QAZ A;  1HUL A;  1LK3 A;  5FUC A;  3Q1S I;  1BCN A;  1EXZ A;  3LB6 A;  3AYH A;  3S9D A;  3HOU D;  1EER A;  4DKE A;  3L5W I;  4NEJ A;  1AU1 A;  2HYM B;  4MHL A;  2JA5 D;  3DLQ I;  1EMR A;  3OG4 A;  1BGE A;  3NCC A;  1HIJ A;  3HMX B;  1I1R B;  3SE4 B;  1CN4 C;  3FKI D;  3NPZ A;  2JA6 D;  1Y14 A;  3HOZ D;  4NN6 A;  4GRW A;  3VA2 A;  1RFB A;  1SCF A;  4A3E D;  3BES L;  1WCM D;  1V7M V;  1ILK A;  2D9Q A;  1M48 A;  3BPO A;  1B5L A;  3HHR A;  4BBR D;  5C7X A;  4A3F D;  3INK C;  2R92 D;  4A3B D;  4RS1 A;  4EXP A;  2R7Z D;  1Y1V D;  4A3L D;  3PO3 D;  1Z7C A;  1HUW A;  2O26 A;  4YPG C;  1PW6 A;  1IAR A;  1M47 A;  3IRH A;  3HOX D;  4Z5R D;  5L6Y C;  1J7V L;  1CYL A;  1M4R A;  1INR A;  1RHG A;  3NCB A;  4BXX D;  4DKD A;  3D85 C;  1GA3 A;  3DI2 A;  1HGU A;  1P9M B;  4A3G D;  1ITL A;  5KNH I;  4EXN A;  1ITM A;  1VLK A;  3HOV D;  3I4N D;  1HIK A;  3H0G D;  2B8Z A;  5C3E D;  1RCB A;  4DKC A;  4X51 A;  4CNI C;  1ITF A;  1LQS L;  1BUY A;  2INT A;  1Z92 A;  5C4X D;  3HHC A;  2Q7N B;  4NI9 A;  3B5K A;  1A7M A;  3HOY D;  3OG6 A;  5FLM D;  5IP9 D;  3G9V B;  1D9G A;  3D48 P;  2H24 A;  3OQ3 A;  4LRL A;  2CYK A;  2O27 A;  2B8Y A;  4NN7 A;  1PY2 A;  3LB6 B;  5TS9 A;  4A93 D;  1CSG A;  2ERJ D;  3L5X A;  1WU3 I;  1M4B A;  3QWR B;  1EVS A;  2D48 A;  1N1F A;  3PIW A;  1EKU A;  4NKQ C;  2B8U A;  4YDY I;  4A3J D;  3QB1 A;  3BPN A;  3WCY I;  2VUM D;  1PVH B;  1M49 A;  1AXI A;  1Y6K L;  1PGR A;  3QB7 A;  1KF9 A;  2B5I A;  4BBS D;  2ILK A;  3BPL A;  1HWG A;  4YUE C;  3UF2 A;  1QVN A;  3N0P A;  4ZF7 A;  4NN5 A;  3EJJ A;  4A3M D;  3PO2 D;  2Z3Q A;  4O6K A;  2L3O A;  1BGC A;  1NBP A;  4A3I D;  3DGC L;  4FA8 E;  2Q14 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...