1IK0A

Solution structure of human il-13
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
113
structure length
113
Chain Sequence
b'MGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTERLEUKIN-13
publication title Solution structure of human IL-13 and implication for receptor binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 23
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2001-05-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1250.10 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; Growth Hormone; Chain: A; 1ik0A00
4YPGC 2HYMB 1ITMA 1HIKA 2B91A 3NCFA 4WRLB 5LQBA 1Z7CA 2L3YA 3D85C 1EKUA 1J7VL 1HGUA 1AX8A 1NBPA 3NPZA 4J4LC 1ETEA 1GNCA 1IJZA 1AU1A 2H24A 3HHRA 5FHXA 1RW5A 3LB6B 1QVNA 1ITLA 1EXZA 2B8ZA 4CNIC 1V7NV 2L3OA 4NKQC 3NCBA 2GMFA 1IL6A 4NEJA 3SE4B 2B90A 2Q7NB 1SCFA 1IK0A 3WCYI 1CNT1 1LQSL 1BCNA 3QB7A 1A22A 1FYHA 1JLIA 1WU3I 2O26A 1HWHA 1AXIA 2D9QA 3DUHC 5L6YC 4PS4A 3QB1A 1RFBA 2O27A 1PVHB 1M49A 1KF9A 4ZF7A 4YUEC 4YDYI 2IL6A 4Z5RD 4NI9A 1CD9A 1B5LA 1D9CA 3DLQI 2B8YA 1BGCA 5D72A 1Y6NL 1HUWA 1IARA 1Y6ML 1M4AA 3G9VB 3UF5A 1CN4C 2B8UA 1BGEA 3UEZE 5D22A 1N1FA 4FA8E 1YKBA 1M4RA 3EJJA 1M4CA 3DGCL 3MZGA 1V7MV 1RCBA 1PW6A 2E9WC 3B5KA 3NCEA 5FUCA 3BPOA 3L5WI 1HIJA 3VA2A 1D9GA 1BGDA 1EVSA 1M48A 3D48P 1BBNA 2Q98A 1P9MB 3HMXB 4X51A 3OQ3A 1FG9A 2ERJD 3QT2C 4NI7A 4RS1A 2LMSA 1HULA 3INKC 2INTA 1CYLA 1PY2A 2ILKA 3PIVA 3Q1SI 2B8XA 2D48A 3UX9A 3S9DA 2KZ1A 4O9HA 1EERA 5D28B 3LB6A 1ITIA 1ALUA 3BPLA 1CSGA 1PGRA 3QAZA 5D70A 3D87A 1LK3A 1F6FA 4O6KA 1M47A 1M4BA 1INRA 1ILKA 5D71A 1VLKA 3PIWA 1LKIA 1Z92A 5C7XA 1I1RB 1RHGA 1A7MA 3UF2A 4ZS7A 1HZIA 3G6DA 4MHLA 1BP3A 3EW3A 1GA3A 4GRWA 3QWRB 1HWGA 1F45B 3N06A 3BPNA 4I77Z 1Y6KL 5KNHI 4DOHA 3L5XA 3NCCA 3SE3B 1IRLA 3N0PA 1BUYA 2B5IA 2CYKA 3BESL 1EMRA 1ITFA 5E4EA 2LAGA 4NEMA 4YQXA
chains in the Genus database with same CATH superfamily
3I4MD 1Y14A 2B91A 3HOVD 3D85C 1J7VL 1HGUA 5D58A 5FHXA 4DKEA 1EXZA 4CNIC 3H0GD 1Y1WD 3NCBA 3SE4B 2B90A 3WCYI 1CNT1 1JLIA 1WU3I 4GBYA 4IKWA 1HWHA 2D9QA 3QB1A 4EXNA 1PVHB 1M49A 1KF9A 4YDYI 4A3JD 3DI2A 1CD9A 1D9CA 4ZYRA 1HUWA 2B8UA 1BGEA 5D22A 4EXPA 4UVMA 1V7MV 1RCBA 5EQIA 3BPOA 3VA2A 1P9MB 1FG9A 3QT2C 4NI7A 5A2OA 1WCMD 3WDOA 1CYLA 4ZW9A 1PV7A 3Q1SI 3HOZD 1ITIA 2KZ1A 4XNIA 1EERA 3BPLA 1CSGA 1PGRA 4BBRD 4NN7A 4O6KA 2CFQA 4D2DA 4IKVA 5C65A 1INRA 1ILKA 4IKYA 1A7MA 4ZS7A 4GRWA 1F45B 4LEPA 4I77Z 4YBQA 4A3ED 4NN5A 4XNJA 3FKID 3SE3B 1ITFA 5E4EA 4Z5RD 4YPGC 1ITMA 5C3ED 4WRLB 1Z7CA 4JR9A 2L3YA 2R7ZD 1EKUA 1NBPA 4J4LC 1ETEA 5EQHA 3LB6B 4TPJA 2B8ZA 4Q65A 1V7NV 3O7QA 4A3KD 4NEJA 4TPGA 4BXXD 1SCFA 1IK0A 1LQSL 3QB7A 1FYHA 2O26A 5L6YC 3HOWD 4PS4A 2JA8D 4DKCA 2C35A 2Z3QA 4ZF7A 4YUEC 4ZWCA 4NI9A 4IKZA 4A3MD 3DLQI 5IP9D 5D72A 3UF5A 1Y6ML 5A2NA 1PW4A 1M4RA 1M4CA 5D6KA 4BY1D 1PW6A 3B5KA 3DI3A 4DKFA 4A3GD 1BGDA 3OG4A 2VUMD 4QIQA 1BBNA 2Q98A 3HMXB 2ERJD 4RS1A 3INKC 2INTA 3PO2D 1PY2A 3IRHA 2B8XA 3LB6A 3AYHA 3QAZA 5D70A 3TGXB 2B63D 4A3CD 4U4TA 1RHGA 4TPHA 5IYDD 1GA3A 1BP3A 4U4VA 1Y6KL 4LRLA 4J05A 1BUYA 4YQXA 4D2CA 1HIKA 3NCFA 4PYPA 1AX8A 1GNCA 1IJZA 1AU1A 2H24A 1RW5A 4NN6A 1ITLA 3H3VE 2JA5D 4ZWBA 4NKQC 2CFPA 1BCNA 1A22A 3DUHC 1RFBA 2O27A 5C44D 4OH3A 1PV6A 3OG6A 4A3LD 5EQGA 1B5LA 2XQBA 5IP7D 2B8YA 3HOXD 1M4AA 1CN4C 3MZGA 4IU8A 2E9WC 5GXBA 3NCEA 5FUCA 3L5WI 1HIJA 1M48A 2LMSA 1HULA 2ILKA 3PIVA 5D28B 1ALUA 5C4XD 2JA6D 2O6IA 1M47A 3HHCA 4BY7D 5IYCD 3PIWA 1I1RB 4W6VA 3EW3A 3QWRB 4A3DD 1HWGA 3N06A 3BPNA 5KNHI 4DOHA 3NCCA 4JA3A 2B5IA 3O7PA 2PSMA 2HYMB 5LQBA 4JREA 3NPZA 3HHRA 2XUTA 1QVNA 4U4WA 4D2BA 2L3OA 3HOUD 2GMFA 1IL6A 4GBZA 2Q7NB 2OQPA 4GS7A 2Z3RA 5TS9A 4IKXA 1AXIA 2IL6A 4A3BD 1BGCA 4YB9D 1Y6NL 1IARA 3G9VB 3I4ND 2Y5YA 3UEZE 1N1FA 3HOYD 4FA8E 1YKBA 3EJJA 3DGCL 4IU9A 2Q14A 1D9GA 1EVSA 3D48P 4X51A 3OQ3A 2R93D 5D59A 4DKDA 2D48A 3UX9A 3S9DA 4O9HA 2JA7D 4APSA 2R92D 4A3FD 4OAAA 3D87A 4A3ID 1LK3A 4LDSA 2V8NA 4GC0A 1F6FA 1M4BA 5FLMD 5D71A 1VLKA 1LKIA 3PO3D 1Z92A 5C7XA 3UF2A 1HZIA 3G6DA 4MHLA 4A93D 1Y1VD 3L5XA 1IRLA 3N0PA 2CYKA 3BESL 5IYBD 1EMRA 2LAGA 4NEMA 4BBSD
chains in the Genus database with same CATH topology
4YPGC 2HYMB 3I4MD 1ITMA 1HIKA 1Y14A 2B91A 3NCFA 4WRLB 5LQBA 5C3ED 3HOVD 1Z7CA 2L3YA 3D85C 2R7ZD 1EKUA 1J7VL 1HGUA 1AX8A 1NBPA 3NPZA 4J4LC 1ETEA 1ITIA 1GNCA 1IJZA 1AU1A 2H24A 3HHRA 5FHXA 1RW5A 3LB6B 4DKEA 1QVNA 4NN6A 1ITLA 1EXZA 2B8ZA 4CNIC 1V7NV 3H0GD 1Y1WD 2L3OA 3H3VE 4A3KD 2JA5D 4NKQC 3HOUD 3NCBA 2GMFA 1IL6A 4NEJA 3SE4B 4BXXD 2B90A 2Q7NB 1SCFA 2OQPA 1IK0A 4GS7A 3WCYI 1CNT1 1LQSL 2Z3RA 1BCNA 3QB7A 5TS9A 1A22A 1FYHA 1JLIA 1WU3I 2O26A 1HWHA 1AXIA 2D9QA 3DUHC 5L6YC 4PS4A 2JA8D 3QB1A 4EXNA 3HOWD 1RFBA 2O27A 1PVHB 5C44D 4DKCA 2C35A 1M49A 2Z3QA 1KF9A 3OG6A 4ZF7A 4YUEC 4A3LD 4YDYI 2IL6A 4Z5RD 4A3JD 4NI9A 3DI2A 1CD9A 4A3BD 1B5LA 4A3MD 2XQBA 1D9CA 3DLQI 5IP7D 2B8YA 1BGCA 5IP9D 5D72A 1Y6NL 1HUWA 1IARA 1Y6ML 1M4AA 3G9VB 3UF5A 3HOXD 1CN4C 2B8UA 1BGEA 3UEZE 5D22A 1N1FA 4EXPA 3HOYD 4FA8E 1YKBA 1M4RA 3EJJA 1M4CA 3DGCL 3MZGA 1V7MV 4BY1D 1RCBA 1PW6A 2E9WC 2Q14A 3B5KA 3NCEA 3DI3A 3BPOA 3L5WI 5FUCA 4DKFA 1HIJA 3VA2A 1D9GA 1BGDA 3OG4A 2VUMD 4A3GD 1EVSA 1M48A 3D48P 1BBNA 2Q98A 1P9MB 3HMXB 4X51A 3OQ3A 1FG9A 2ERJD 3QT2C 4NI7A 4RS1A 2LMSA 3I4ND 2R93D 1WCMD 1HULA 3INKC 2INTA 3PO2D 1PY2A 1CYLA 2ILKA 3PIVA 3Q1SI 3IRHA 4DKDA 2B8XA 2D48A 3UX9A 3S9DA 2KZ1A 4O9HA 1EERA 5D28B 3LB6A 2JA7D 2R92D 1ALUA 3BPLA 4A3FD 2JA6D 3AYHA 1CSGA 5C4XD 1PGRA 3QAZA 5D70A 3D87A 4A3ID 1LK3A 4BBRD 2O6IA 3TGXB 4NN7A 1F6FA 2B63D 4O6KA 1M47A 1M4BA 4A3CD 3HHCA 1INRA 1ILKA 5FLMD 3HOZD 5D71A 1VLKA 3PIWA 5IYCD 1LKIA 4BY7D 3PO3D 1Z92A 5C7XA 1I1RB 1RHGA 5IYDD 1A7MA 3UF2A 4ZS7A 1HZIA 3G6DA 4MHLA 1BP3A 3EW3A 1GA3A 4GRWA 4A93D 3QWRB 4A3DD 1HWGA 1F45B 3N06A 1Y1VD 3BPNA 4I77Z 4A3ED 1Y6KL 4LRLA 5KNHI 4DOHA 3L5XA 3NCCA 4NN5A 3FKID 3SE3B 1IRLA 3N0PA 1BUYA 2B5IA 2CYKA 3BESL 5IYBD 2PSMA 1EMRA 1ITFA 5E4EA 2LAGA 4NEMA 4BBSD 4YQXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YPG C;  2HYM B;  1ITM A;  1HIK A;  2B91 A;  3NCF A;  4WRL B;  5LQB A;  1Z7C A;  2L3Y A;  3D85 C;  1EKU A;  1J7V L;  1HGU A;  1AX8 A;  1NBP A;  3NPZ A;  4J4L C;  1ETE A;  1GNC A;  1IJZ A;  1AU1 A;  2H24 A;  3HHR A;  5FHX A;  1RW5 A;  3LB6 B;  1QVN A;  1ITL A;  1EXZ A;  2B8Z A;  4CNI C;  1V7N V;  2L3O A;  4NKQ C;  3NCB A;  2GMF A;  1IL6 A;  4NEJ A;  3SE4 B;  2B90 A;  2Q7N B;  1SCF A;  1IK0 A;  3WCY I;  1CNT 1;  1LQS L;  1BCN A;  3QB7 A;  1A22 A;  1FYH A;  1JLI A;  1WU3 I;  2O26 A;  1HWH A;  1AXI A;  2D9Q A;  3DUH C;  5L6Y C;  4PS4 A;  3QB1 A;  1RFB A;  2O27 A;  1PVH B;  1M49 A;  1KF9 A;  4ZF7 A;  4YUE C;  4YDY I;  2IL6 A;  4Z5R D;  4NI9 A;  1CD9 A;  1B5L A;  1D9C A;  3DLQ I;  2B8Y A;  1BGC A;  5D72 A;  1Y6N L;  1HUW A;  1IAR A;  1Y6M L;  1M4A A;  3G9V B;  3UF5 A;  1CN4 C;  2B8U A;  1BGE A;  3UEZ E;  5D22 A;  1N1F A;  4FA8 E;  1YKB A;  1M4R A;  3EJJ A;  1M4C A;  3DGC L;  3MZG A;  1V7M V;  1RCB A;  1PW6 A;  2E9W C;  3B5K A;  3NCE A;  5FUC A;  3BPO A;  3L5W I;  1HIJ A;  3VA2 A;  1D9G A;  1BGD A;  1EVS A;  1M48 A;  3D48 P;  1BBN A;  2Q98 A;  1P9M B;  3HMX B;  4X51 A;  3OQ3 A;  1FG9 A;  2ERJ D;  3QT2 C;  4NI7 A;  4RS1 A;  2LMS A;  1HUL A;  3INK C;  2INT A;  1CYL A;  1PY2 A;  2ILK A;  3PIV A;  3Q1S I;  2B8X A;  2D48 A;  3UX9 A;  3S9D A;  2KZ1 A;  4O9H A;  1EER A;  5D28 B;  3LB6 A;  1ITI A;  1ALU A;  3BPL A;  1CSG A;  1PGR A;  3QAZ A;  5D70 A;  3D87 A;  1LK3 A;  1F6F A;  4O6K A;  1M47 A;  1M4B A;  1INR A;  1ILK A;  5D71 A;  1VLK A;  3PIW A;  1LKI A;  1Z92 A;  5C7X A;  1I1R B;  1RHG A;  1A7M A;  3UF2 A;  4ZS7 A;  1HZI A;  3G6D A;  4MHL A;  1BP3 A;  3EW3 A;  1GA3 A;  4GRW A;  3QWR B;  1HWG A;  1F45 B;  3N06 A;  3BPN A;  4I77 Z;  1Y6K L;  5KNH I;  4DOH A;  3L5X A;  3NCC A;  3SE3 B;  1IRL A;  3N0P A;  1BUY A;  2B5I A;  2CYK A;  3BES L;  1EMR A;  1ITF A;  5E4E A;  2LAG A;  4NEM A;  4YQX A; 
#chains in the Genus database with same CATH topology
 3I4M D;  1Y14 A;  2B91 A;  3HOV D;  3D85 C;  1J7V L;  1HGU A;  5D58 A;  5FHX A;  4DKE A;  1EXZ A;  4CNI C;  3H0G D;  1Y1W D;  3NCB A;  3SE4 B;  2B90 A;  3WCY I;  1CNT 1;  1JLI A;  1WU3 I;  4GBY A;  4IKW A;  1HWH A;  2D9Q A;  3QB1 A;  4EXN A;  1PVH B;  1M49 A;  1KF9 A;  4YDY I;  4A3J D;  3DI2 A;  1CD9 A;  1D9C A;  4ZYR A;  1HUW A;  2B8U A;  1BGE A;  5D22 A;  4EXP A;  4UVM A;  1V7M V;  1RCB A;  5EQI A;  3BPO A;  3VA2 A;  1P9M B;  1FG9 A;  3QT2 C;  4NI7 A;  5A2O A;  1WCM D;  3WDO A;  1CYL A;  4ZW9 A;  1PV7 A;  3Q1S I;  3HOZ D;  1ITI A;  2KZ1 A;  4XNI A;  1EER A;  3BPL A;  1CSG A;  1PGR A;  4BBR D;  4NN7 A;  4O6K A;  2CFQ A;  4D2D A;  4IKV A;  5C65 A;  1INR A;  1ILK A;  4IKY A;  1A7M A;  4ZS7 A;  4GRW A;  1F45 B;  4LEP A;  4I77 Z;  4YBQ A;  4A3E D;  4NN5 A;  4XNJ A;  3FKI D;  3SE3 B;  1ITF A;  5E4E A;  4Z5R D;  4YPG C;  1ITM A;  5C3E D;  4WRL B;  1Z7C A;  4JR9 A;  2L3Y A;  2R7Z D;  1EKU A;  1NBP A;  4J4L C;  1ETE A;  5EQH A;  3LB6 B;  4TPJ A;  2B8Z A;  4Q65 A;  1V7N V;  3O7Q A;  4A3K D;  4NEJ A;  4TPG A;  4BXX D;  1SCF A;  1IK0 A;  1LQS L;  3QB7 A;  1FYH A;  2O26 A;  5L6Y C;  3HOW D;  4PS4 A;  2JA8 D;  4DKC A;  2C35 A;  2Z3Q A;  4ZF7 A;  4YUE C;  4ZWC A;  4NI9 A;  4IKZ A;  4A3M D;  3DLQ I;  5IP9 D;  5D72 A;  3UF5 A;  1Y6M L;  5A2N A;  1PW4 A;  1M4R A;  1M4C A;  5D6K A;  4BY1 D;  1PW6 A;  3B5K A;  3DI3 A;  4DKF A;  4A3G D;  1BGD A;  3OG4 A;  2VUM D;  4QIQ A;  1BBN A;  2Q98 A;  3HMX B;  2ERJ D;  4RS1 A;  3INK C;  2INT A;  3PO2 D;  1PY2 A;  3IRH A;  2B8X A;  3LB6 A;  3AYH A;  3QAZ A;  5D70 A;  3TGX B;  2B63 D;  4A3C D;  4U4T A;  1RHG A;  4TPH A;  5IYD D;  1GA3 A;  1BP3 A;  4U4V A;  1Y6K L;  4LRL A;  4J05 A;  1BUY A;  4YQX A;  4D2C A;  1HIK A;  3NCF A;  4PYP A;  1AX8 A;  1GNC A;  1IJZ A;  1AU1 A;  2H24 A;  1RW5 A;  4NN6 A;  1ITL A;  3H3V E;  2JA5 D;  4ZWB A;  4NKQ C;  2CFP A;  1BCN A;  1A22 A;  3DUH C;  1RFB A;  2O27 A;  5C44 D;  4OH3 A;  1PV6 A;  3OG6 A;  4A3L D;  5EQG A;  1B5L A;  2XQB A;  5IP7 D;  2B8Y A;  3HOX D;  1M4A A;  1CN4 C;  3MZG A;  4IU8 A;  2E9W C;  5GXB A;  3NCE A;  5FUC A;  3L5W I;  1HIJ A;  1M48 A;  2LMS A;  1HUL A;  2ILK A;  3PIV A;  5D28 B;  1ALU A;  5C4X D;  2JA6 D;  2O6I A;  1M47 A;  3HHC A;  4BY7 D;  5IYC D;  3PIW A;  1I1R B;  4W6V A;  3EW3 A;  3QWR B;  4A3D D;  1HWG A;  3N06 A;  3BPN A;  5KNH I;  4DOH A;  3NCC A;  4JA3 A;  2B5I A;  3O7P A;  2PSM A;  2HYM B;  5LQB A;  4JRE A;  3NPZ A;  3HHR A;  2XUT A;  1QVN A;  4U4W A;  4D2B A;  2L3O A;  3HOU D;  2GMF A;  1IL6 A;  4GBZ A;  2Q7N B;  2OQP A;  4GS7 A;  2Z3R A;  5TS9 A;  4IKX A;  1AXI A;  2IL6 A;  4A3B D;  1BGC A;  4YB9 D;  1Y6N L;  1IAR A;  3G9V B;  3I4N D;  2Y5Y A;  3UEZ E;  1N1F A;  3HOY D;  4FA8 E;  1YKB A;  3EJJ A;  3DGC L;  4IU9 A;  2Q14 A;  1D9G A;  1EVS A;  3D48 P;  4X51 A;  3OQ3 A;  2R93 D;  5D59 A;  4DKD A;  2D48 A;  3UX9 A;  3S9D A;  4O9H A;  2JA7 D;  4APS A;  2R92 D;  4A3F D;  4OAA A;  3D87 A;  4A3I D;  1LK3 A;  4LDS A;  2V8N A;  4GC0 A;  1F6F A;  1M4B A;  5FLM D;  5D71 A;  1VLK A;  1LKI A;  3PO3 D;  1Z92 A;  5C7X A;  3UF2 A;  1HZI A;  3G6D A;  4MHL A;  4A93 D;  1Y1V D;  3L5X A;  1IRL A;  3N0P A;  2CYK A;  3BES L;  5IYB D;  1EMR A;  2LAG A;  4NEM A;  4BBS D; 
#chains in the Genus database with same CATH homology
 4YPG C;  2HYM B;  3I4M D;  1ITM A;  1HIK A;  1Y14 A;  2B91 A;  3NCF A;  4WRL B;  5LQB A;  5C3E D;  3HOV D;  1Z7C A;  2L3Y A;  3D85 C;  2R7Z D;  1EKU A;  1J7V L;  1HGU A;  1AX8 A;  1NBP A;  3NPZ A;  4J4L C;  1ETE A;  1ITI A;  1GNC A;  1IJZ A;  1AU1 A;  2H24 A;  3HHR A;  5FHX A;  1RW5 A;  3LB6 B;  4DKE A;  1QVN A;  4NN6 A;  1ITL A;  1EXZ A;  2B8Z A;  4CNI C;  1V7N V;  3H0G D;  1Y1W D;  2L3O A;  3H3V E;  4A3K D;  2JA5 D;  4NKQ C;  3HOU D;  3NCB A;  2GMF A;  1IL6 A;  4NEJ A;  3SE4 B;  4BXX D;  2B90 A;  2Q7N B;  1SCF A;  2OQP A;  1IK0 A;  4GS7 A;  3WCY I;  1CNT 1;  1LQS L;  2Z3R A;  1BCN A;  3QB7 A;  5TS9 A;  1A22 A;  1FYH A;  1JLI A;  1WU3 I;  2O26 A;  1HWH A;  1AXI A;  2D9Q A;  3DUH C;  5L6Y C;  4PS4 A;  2JA8 D;  3QB1 A;  4EXN A;  3HOW D;  1RFB A;  2O27 A;  1PVH B;  5C44 D;  4DKC A;  2C35 A;  1M49 A;  2Z3Q A;  1KF9 A;  3OG6 A;  4ZF7 A;  4YUE C;  4A3L D;  4YDY I;  2IL6 A;  4Z5R D;  4A3J D;  4NI9 A;  3DI2 A;  1CD9 A;  4A3B D;  1B5L A;  4A3M D;  2XQB A;  1D9C A;  3DLQ I;  5IP7 D;  2B8Y A;  1BGC A;  5IP9 D;  5D72 A;  1Y6N L;  1HUW A;  1IAR A;  1Y6M L;  1M4A A;  3G9V B;  3UF5 A;  3HOX D;  1CN4 C;  2B8U A;  1BGE A;  3UEZ E;  5D22 A;  1N1F A;  4EXP A;  3HOY D;  4FA8 E;  1YKB A;  1M4R A;  3EJJ A;  1M4C A;  3DGC L;  3MZG A;  1V7M V;  4BY1 D;  1RCB A;  1PW6 A;  2E9W C;  2Q14 A;  3B5K A;  3NCE A;  3DI3 A;  3BPO A;  3L5W I;  5FUC A;  4DKF A;  1HIJ A;  3VA2 A;  1D9G A;  1BGD A;  3OG4 A;  2VUM D;  4A3G D;  1EVS A;  1M48 A;  3D48 P;  1BBN A;  2Q98 A;  1P9M B;  3HMX B;  4X51 A;  3OQ3 A;  1FG9 A;  2ERJ D;  3QT2 C;  4NI7 A;  4RS1 A;  2LMS A;  3I4N D;  2R93 D;  1WCM D;  1HUL A;  3INK C;  2INT A;  3PO2 D;  1PY2 A;  1CYL A;  2ILK A;  3PIV A;  3Q1S I;  3IRH A;  4DKD A;  2B8X A;  2D48 A;  3UX9 A;  3S9D A;  2KZ1 A;  4O9H A;  1EER A;  5D28 B;  3LB6 A;  2JA7 D;  2R92 D;  1ALU A;  3BPL A;  4A3F D;  2JA6 D;  3AYH A;  1CSG A;  5C4X D;  1PGR A;  3QAZ A;  5D70 A;  3D87 A;  4A3I D;  1LK3 A;  4BBR D;  2O6I A;  3TGX B;  4NN7 A;  1F6F A;  2B63 D;  4O6K A;  1M47 A;  1M4B A;  4A3C D;  3HHC A;  1INR A;  1ILK A;  5FLM D;  3HOZ D;  5D71 A;  1VLK A;  3PIW A;  5IYC D;  1LKI A;  4BY7 D;  3PO3 D;  1Z92 A;  5C7X A;  1I1R B;  1RHG A;  5IYD D;  1A7M A;  3UF2 A;  4ZS7 A;  1HZI A;  3G6D A;  4MHL A;  1BP3 A;  3EW3 A;  1GA3 A;  4GRW A;  4A93 D;  3QWR B;  4A3D D;  1HWG A;  1F45 B;  3N06 A;  1Y1V D;  3BPN A;  4I77 Z;  4A3E D;  1Y6K L;  4LRL A;  5KNH I;  4DOH A;  3L5X A;  3NCC A;  4NN5 A;  3FKI D;  3SE3 B;  1IRL A;  3N0P A;  1BUY A;  2B5I A;  2CYK A;  3BES L;  5IYB D;  2PSM A;  1EMR A;  1ITF A;  5E4E A;  2LAG A;  4NEM A;  4BBS D;  4YQX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...