1ITFA

Interferon alpha-2a, nmr, 24 structures
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
165
structure length
165
Chain Sequence
CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords INTERFERON ALPHA-2A
publication title The three-dimensional high resolution structure of human interferon alpha-2a determined by heteronuclear NMR spectroscopy in solution.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 1997-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00143 Interferon Interferon alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1250.10 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; Growth Hormone; Chain: A; 1itfA00
1M4BA 3BPOA 4NKQC 1M4RA 1B5LA 1P9MB 3EJJA 1ITLA 1FYHA 1NBPA 2L3OA 2B5IA 1ITFA 1SCFA 3UX9A 1AX8A 3QWRB 3SE4B 1KF9A 1Y6KL 4O6KA 1PY2A 4Z5RD 3WCYI 4NEMA 2B91A 1HUWA 3D87A 1EKUA 3G9VB 2ILKA 1D9CA 1CD9A 2L3YA 1F45B 4I77Z 5D72A 4CNIC 2O27A 1V7MV 3N0PA 1EVSA 1GNCA 2Q98A 1IL6A 1EERA 1INRA 1BP3A 3LB6A 3NCCA 3NCEA 3QT2C 5L6YC 3NCFA 4YPGC 1AXIA 1BCNA 3NPZA 1LKIA 1Z7CA 4ZS7A 3DLQI 3DUHC 1J7VL 1JLIA 1HGUA 1Y6NL 1PGRA 1HULA 1LQSL 5D71A 1EMRA 5D22A 1N1FA 1ILKA 1BGCA 1RCBA 1RHGA 3LB6B 2O26A 4WRLB 3PIWA 1HWHA 4PS4A 2LAGA 1M47A 3G6DA 1V7NV 1FG9A 3BPNA 2E9WC 1I1RB 3MZGA 1Y6ML 2LMSA 1HZIA 1IARA 1BGDA 1RFBA 1ALUA 2INTA 3HMXB 1F6FA 4MHLA 5D70A 3L5WI 1HWGA 2KZ1A 4NEJA 4YUEC 5FUCA 2IL6A 2B8ZA 5LQBA 2ERJD 3B5KA 1IJZA 3EW3A 4J4LC 2H24A 1M4CA 1M49A 1PVHB 3QB1A 5D28B 1ITIA 3L5XA 1AU1A 5KNHI 1YKBA 1HIJA 2Q7NB 1HIKA 1GA3A 1LK3A 2B90A 1M4AA 4YDYI 1EXZA 1M48A 1VLKA 2B8UA 2B8XA 3QB7A 4RS1A 3SE3B 1CSGA 1BBNA 2GMFA 5FHXA 3VA2A 3N06A 2D9QA 3Q1SI 2D48A 3PIVA 4X51A 5C7XA 3OQ3A 3S9DA 2HYMB 1PW6A 3UF2A 1A22A 1CN4C 4GRWA 1RW5A 1QVNA 3QAZA 5E4EA 3UEZE 1IK0A 4NI9A 3BESL 2CYKA 1ITMA 3BPLA 1D9GA 4DOHA 1CNT1 3DGCL 3INKC 3D85C 1ETEA 3NCBA 4YQXA 1CYLA 1A7MA 4FA8E 1BGEA 1WU3I 4ZF7A 4NI7A 1IRLA 1BUYA 1Z92A 2B8YA 3HHRA 4O9HA 3UF5A 3D48P
chains in the Genus database with same CATH superfamily
2JA6D 1FYHA 1ITFA 3HOWD 1AX8A 4DKEA 4Z5RD 3WCYI 1HUWA 4A3JD 1CD9A 5EQHA 5D72A 4D2DA 4CNIC 2O27A 1V7MV 1GNCA 2Q98A 4DKCA 3NCEA 3NCCA 4BBSD 1LKIA 4A3ED 5GXBA 4ZS7A 4DKDA 2XQBA 1PGRA 2Z3RA 4PYPA 2OQPA 5D22A 4JREA 1BGCA 1RCBA 2O26A 4TPHA 2LAGA 3G6DA 2E9WC 3MZGA 2C35A 1HZIA 4BY1D 4IKXA 1RFBA 4NN5A 4YUEC 4A3CD 5C44D 2B8ZA 1M49A 5D28B 3HOZD 4IKVA 3L5XA 2R92D 5IYDD 4YDYI 4YBQA 4ZYRA 2B8XA 1BBNA 3VA2A 4TPJA 4ZW9A 5A2OA 3HOYD 2HYMB 1PW6A 4IKZA 1CN4C 3UF2A 4GRWA 1QVNA 3IRHA 4DOHA 3D85C 4EXPA 1WU3I 1IRLA 1WCMD 2JA7D 4D2CA 3UF5A 3D48P 5IYBD 4NKQC 1P9MB 3EJJA 4A3BD 3UX9A 5D59A 1KF9A 1PY2A 4IKWA 5FLMD 2ILKA 1D9CA 4YB9D 2JA5D 4NN6A 1INRA 1BP3A 4ZWCA 5L6YC 4A93D 3NCFA 4ZWBA 4YPGC 1AXIA 3DI3A 1J7VL 5A2NA 1HULA 1LQSL 1EMRA 1RHGA 3PIWA 4PS4A 4XNIA 4J05A 1FG9A 3BPNA 2V8NA 4BBRD 1IARA 3I4MD 2INTA 5IP9D 5D70A 3B5KA 3EW3A 1M4CA 4A3FD 3DI2A 4U4WA 1HIJA 2JA8D 1HIKA 1GA3A 3HOVD 4APSA 5C4XD 4LRLA 4RS1A 3SE3B 1CSGA 5FHXA 3N06A 3Q1SI 4GS7A 2D48A 4A3LD 4X51A 3OQ3A 4QIQA 4OAAA 1A22A 1RW5A 3QAZA 5E4EA 3BESL 3BPLA 4NN7A 3PO2D 1CNT1 3INKC 2Q14A 4YQXA 1CYLA 1A7MA 4ZF7A 3HHRA 4O9HA 2R7ZD 4A3DD 1B5LA 4A3MD 1ITLA 1NBPA 3WDOA 4A3KD 3OG4A 4XNJA 1Y1VD 1Y6KL 4LEPA 4NEMA 2B91A 3D87A 1EKUA 2O6IA 3G9VB 3HOXD 2PSMA 2L3YA 1F45B 4I77Z 5EQGA 1EVSA 1IL6A 3QT2C 1BCNA 3NPZA 3DLQI 3DUHC 3O7QA 1JLIA 1HGUA 1Y6NL 4U4TA 4W6VA 2CFPA 1ILKA 4WRLB 1HWHA 1V7NV 3I4ND 1I1RB 1Y6ML 2LMSA 4GBZA 1ALUA 3HMXB 4MHLA 4NEJA 2IL6A 5LQBA 1Y14A 1IJZA 4J4LC 3TGXB 2H24A 1PVHB 3QB1A 5KNHI 1YKBA 1PW4A 1PV7A 2B90A 3HHCA 4UVMA 4A3GD 1EXZA 2GMFA 2D9QA 3FKID 5D6KA 3PIVA 5C7XA 3S9DA 4OH3A 4JR9A 4EXNA 4JA3A 3HOUD 1IK0A 1D9GA 3DGCL 2CFQA 4FA8E 4Q65A 4IKYA 4NI7A 1M4BA 3BPOA 1M4RA 5C65A 2L3OA 2B5IA 1SCFA 3QWRB 3SE4B 4O6KA 4BY7D 4A3ID 4GBYA 2VUMD 5IYCD 3N0PA 5D58A 1EERA 3LB6A 1Z7CA 2R93D 5D71A 3AYHA 1N1FA 3LB6B 1M47A 1BGDA 1F6FA 3L5WI 1HWGA 2KZ1A 5FUCA 1Y1WD 2ERJD 3H0GD 2B63D 3O7PA 4IU8A 3PO3D 1ITIA 4DKFA 4D2BA 1AU1A 5TS9A 2Q7NB 1LK3A 1M4AA 1M48A 1VLKA 2B8UA 3OG6A 3QB7A 4LDSA 2XUTA 4IU9A 5EQIA 3UEZE 2Z3QA 5IP7D 4NI9A 2CYKA 1ITMA 5C3ED 1PV6A 1ETEA 2Y5YA 3NCBA 4U4VA 4BXXD 3H3VE 1BGEA 1BUYA 1Z92A 2B8YA 4GC0A 4TPGA
chains in the Genus database with same CATH topology
1M4BA 3BPOA 4A3DD 5IYBD 4NKQC 1M4RA 2JA6D 1B5LA 4A3MD 1P9MB 3EJJA 1ITLA 1FYHA 1NBPA 2L3OA 2B5IA 4A3KD 4A3BD 1ITFA 3HOWD 3OG4A 1SCFA 3UX9A 1AX8A 1Y1VD 3QWRB 3SE4B 4DKEA 1KF9A 1Y6KL 4O6KA 1PY2A 4Z5RD 3WCYI 4NEMA 4A3ID 4BY7D 2B91A 5FLMD 1HUWA 2R7ZD 3D87A 1EKUA 2O6IA 3G9VB 2ILKA 1D9CA 3HOXD 4A3JD 2PSMA 1CD9A 2L3YA 2VUMD 5IYCD 1F45B 4I77Z 5D72A 4CNIC 2O27A 1V7MV 3N0PA 1EVSA 1GNCA 2JA5D 2Q98A 1IL6A 4NN6A 1EERA 4DKCA 1INRA 1BP3A 3LB6A 3NCCA 3NCEA 3QT2C 5L6YC 4A93D 3NCFA 4YPGC 1AXIA 4BBSD 3NPZA 1LKIA 1Z7CA 4A3ED 4ZS7A 3DI3A 3DLQI 3DUHC 1J7VL 4DKDA 1JLIA 1HGUA 1Y6NL 2XQBA 1PGRA 1HULA 2Z3RA 2R93D 1LQSL 2OQPA 5D71A 1EMRA 3AYHA 5D22A 1N1FA 1ILKA 1BGCA 1RCBA 1RHGA 3LB6B 2O26A 4WRLB 3PIWA 1HWHA 4PS4A 2LAGA 1M47A 3G6DA 1V7NV 1FG9A 3BPNA 2E9WC 3I4ND 1I1RB 3MZGA 1Y6ML 2LMSA 4BBRD 2C35A 1HZIA 1IARA 4BY1D 3I4MD 1BGDA 1RFBA 1ALUA 2INTA 5IP9D 3HMXB 1F6FA 4MHLA 5D70A 4NN5A 3L5WI 1HWGA 2KZ1A 4NEJA 4YUEC 5FUCA 1Y1WD 4A3CD 2IL6A 5C44D 2B8ZA 5LQBA 2ERJD 3B5KA 1Y14A 3H0GD 1IJZA 3EW3A 4J4LC 3TGXB 2H24A 1M4CA 1M49A 1PVHB 4A3FD 3QB1A 2B63D 5D28B 3PO3D 1BCNA 3HOZD 1ITIA 4DKFA 3DI2A 1AU1A 3L5XA 5KNHI 5TS9A 1YKBA 1HIJA 2Q7NB 2JA8D 2R92D 1HIKA 1GA3A 1LK3A 2B90A 5IYDD 3HOVD 1M4AA 3HHCA 4YDYI 4A3GD 1EXZA 1M48A 1VLKA 4LRLA 2B8UA 2B8XA 5C4XD 3OG6A 3QB7A 4RS1A 3SE3B 1CSGA 1BBNA 2GMFA 5FHXA 3VA2A 3N06A 2D9QA 3Q1SI 4GS7A 2D48A 3FKID 4A3LD 3PIVA 4X51A 5C7XA 3OQ3A 3HOYD 3S9DA 2HYMB 1PW6A 3UF2A 1A22A 1CN4C 4EXNA 4GRWA 1RW5A 1QVNA 3QAZA 5E4EA 3UEZE 2Z3QA 5IP7D 4NI9A 3HOUD 3IRHA 1IK0A 3BESL 2CYKA 1ITMA 3BPLA 4NN7A 1D9GA 4DOHA 5C3ED 3PO2D 1CNT1 3DGCL 3INKC 3D85C 2Q14A 1ETEA 3NCBA 4BXXD 4YQXA 4EXPA 1CYLA 3H3VE 1A7MA 4FA8E 1BGEA 1WU3I 4ZF7A 4NI7A 1IRLA 1BUYA 1Z92A 1WCMD 2B8YA 2JA7D 3HHRA 4O9HA 3UF5A 3D48P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M4B A;  3BPO A;  4NKQ C;  1M4R A;  1B5L A;  1P9M B;  3EJJ A;  1ITL A;  1FYH A;  1NBP A;  2L3O A;  2B5I A;  1ITF A;  1SCF A;  3UX9 A;  1AX8 A;  3QWR B;  3SE4 B;  1KF9 A;  1Y6K L;  4O6K A;  1PY2 A;  4Z5R D;  3WCY I;  4NEM A;  2B91 A;  1HUW A;  3D87 A;  1EKU A;  3G9V B;  2ILK A;  1D9C A;  1CD9 A;  2L3Y A;  1F45 B;  4I77 Z;  5D72 A;  4CNI C;  2O27 A;  1V7M V;  3N0P A;  1EVS A;  1GNC A;  2Q98 A;  1IL6 A;  1EER A;  1INR A;  1BP3 A;  3LB6 A;  3NCC A;  3NCE A;  3QT2 C;  5L6Y C;  3NCF A;  4YPG C;  1AXI A;  1BCN A;  3NPZ A;  1LKI A;  1Z7C A;  4ZS7 A;  3DLQ I;  3DUH C;  1J7V L;  1JLI A;  1HGU A;  1Y6N L;  1PGR A;  1HUL A;  1LQS L;  5D71 A;  1EMR A;  5D22 A;  1N1F A;  1ILK A;  1BGC A;  1RCB A;  1RHG A;  3LB6 B;  2O26 A;  4WRL B;  3PIW A;  1HWH A;  4PS4 A;  2LAG A;  1M47 A;  3G6D A;  1V7N V;  1FG9 A;  3BPN A;  2E9W C;  1I1R B;  3MZG A;  1Y6M L;  2LMS A;  1HZI A;  1IAR A;  1BGD A;  1RFB A;  1ALU A;  2INT A;  3HMX B;  1F6F A;  4MHL A;  5D70 A;  3L5W I;  1HWG A;  2KZ1 A;  4NEJ A;  4YUE C;  5FUC A;  2IL6 A;  2B8Z A;  5LQB A;  2ERJ D;  3B5K A;  1IJZ A;  3EW3 A;  4J4L C;  2H24 A;  1M4C A;  1M49 A;  1PVH B;  3QB1 A;  5D28 B;  1ITI A;  3L5X A;  1AU1 A;  5KNH I;  1YKB A;  1HIJ A;  2Q7N B;  1HIK A;  1GA3 A;  1LK3 A;  2B90 A;  1M4A A;  4YDY I;  1EXZ A;  1M48 A;  1VLK A;  2B8U A;  2B8X A;  3QB7 A;  4RS1 A;  3SE3 B;  1CSG A;  1BBN A;  2GMF A;  5FHX A;  3VA2 A;  3N06 A;  2D9Q A;  3Q1S I;  2D48 A;  3PIV A;  4X51 A;  5C7X A;  3OQ3 A;  3S9D A;  2HYM B;  1PW6 A;  3UF2 A;  1A22 A;  1CN4 C;  4GRW A;  1RW5 A;  1QVN A;  3QAZ A;  5E4E A;  3UEZ E;  1IK0 A;  4NI9 A;  3BES L;  2CYK A;  1ITM A;  3BPL A;  1D9G A;  4DOH A;  1CNT 1;  3DGC L;  3INK C;  3D85 C;  1ETE A;  3NCB A;  4YQX A;  1CYL A;  1A7M A;  4FA8 E;  1BGE A;  1WU3 I;  4ZF7 A;  4NI7 A;  1IRL A;  1BUY A;  1Z92 A;  2B8Y A;  3HHR A;  4O9H A;  3UF5 A;  3D48 P; 
#chains in the Genus database with same CATH topology
 2JA6 D;  1FYH A;  1ITF A;  3HOW D;  1AX8 A;  4DKE A;  4Z5R D;  3WCY I;  1HUW A;  4A3J D;  1CD9 A;  5EQH A;  5D72 A;  4D2D A;  4CNI C;  2O27 A;  1V7M V;  1GNC A;  2Q98 A;  4DKC A;  3NCE A;  3NCC A;  4BBS D;  1LKI A;  4A3E D;  5GXB A;  4ZS7 A;  4DKD A;  2XQB A;  1PGR A;  2Z3R A;  4PYP A;  2OQP A;  5D22 A;  4JRE A;  1BGC A;  1RCB A;  2O26 A;  4TPH A;  2LAG A;  3G6D A;  2E9W C;  3MZG A;  2C35 A;  1HZI A;  4BY1 D;  4IKX A;  1RFB A;  4NN5 A;  4YUE C;  4A3C D;  5C44 D;  2B8Z A;  1M49 A;  5D28 B;  3HOZ D;  4IKV A;  3L5X A;  2R92 D;  5IYD D;  4YDY I;  4YBQ A;  4ZYR A;  2B8X A;  1BBN A;  3VA2 A;  4TPJ A;  4ZW9 A;  5A2O A;  3HOY D;  2HYM B;  1PW6 A;  4IKZ A;  1CN4 C;  3UF2 A;  4GRW A;  1QVN A;  3IRH A;  4DOH A;  3D85 C;  4EXP A;  1WU3 I;  1IRL A;  1WCM D;  2JA7 D;  4D2C A;  3UF5 A;  3D48 P;  5IYB D;  4NKQ C;  1P9M B;  3EJJ A;  4A3B D;  3UX9 A;  5D59 A;  1KF9 A;  1PY2 A;  4IKW A;  5FLM D;  2ILK A;  1D9C A;  4YB9 D;  2JA5 D;  4NN6 A;  1INR A;  1BP3 A;  4ZWC A;  5L6Y C;  4A93 D;  3NCF A;  4ZWB A;  4YPG C;  1AXI A;  3DI3 A;  1J7V L;  5A2N A;  1HUL A;  1LQS L;  1EMR A;  1RHG A;  3PIW A;  4PS4 A;  4XNI A;  4J05 A;  1FG9 A;  3BPN A;  2V8N A;  4BBR D;  1IAR A;  3I4M D;  2INT A;  5IP9 D;  5D70 A;  3B5K A;  3EW3 A;  1M4C A;  4A3F D;  3DI2 A;  4U4W A;  1HIJ A;  2JA8 D;  1HIK A;  1GA3 A;  3HOV D;  4APS A;  5C4X D;  4LRL A;  4RS1 A;  3SE3 B;  1CSG A;  5FHX A;  3N06 A;  3Q1S I;  4GS7 A;  2D48 A;  4A3L D;  4X51 A;  3OQ3 A;  4QIQ A;  4OAA A;  1A22 A;  1RW5 A;  3QAZ A;  5E4E A;  3BES L;  3BPL A;  4NN7 A;  3PO2 D;  1CNT 1;  3INK C;  2Q14 A;  4YQX A;  1CYL A;  1A7M A;  4ZF7 A;  3HHR A;  4O9H A;  2R7Z D;  4A3D D;  1B5L A;  4A3M D;  1ITL A;  1NBP A;  3WDO A;  4A3K D;  3OG4 A;  4XNJ A;  1Y1V D;  1Y6K L;  4LEP A;  4NEM A;  2B91 A;  3D87 A;  1EKU A;  2O6I A;  3G9V B;  3HOX D;  2PSM A;  2L3Y A;  1F45 B;  4I77 Z;  5EQG A;  1EVS A;  1IL6 A;  3QT2 C;  1BCN A;  3NPZ A;  3DLQ I;  3DUH C;  3O7Q A;  1JLI A;  1HGU A;  1Y6N L;  4U4T A;  4W6V A;  2CFP A;  1ILK A;  4WRL B;  1HWH A;  1V7N V;  3I4N D;  1I1R B;  1Y6M L;  2LMS A;  4GBZ A;  1ALU A;  3HMX B;  4MHL A;  4NEJ A;  2IL6 A;  5LQB A;  1Y14 A;  1IJZ A;  4J4L C;  3TGX B;  2H24 A;  1PVH B;  3QB1 A;  5KNH I;  1YKB A;  1PW4 A;  1PV7 A;  2B90 A;  3HHC A;  4UVM A;  4A3G D;  1EXZ A;  2GMF A;  2D9Q A;  3FKI D;  5D6K A;  3PIV A;  5C7X A;  3S9D A;  4OH3 A;  4JR9 A;  4EXN A;  4JA3 A;  3HOU D;  1IK0 A;  1D9G A;  3DGC L;  2CFQ A;  4FA8 E;  4Q65 A;  4IKY A;  4NI7 A;  1M4B A;  3BPO A;  1M4R A;  5C65 A;  2L3O A;  2B5I A;  1SCF A;  3QWR B;  3SE4 B;  4O6K A;  4BY7 D;  4A3I D;  4GBY A;  2VUM D;  5IYC D;  3N0P A;  5D58 A;  1EER A;  3LB6 A;  1Z7C A;  2R93 D;  5D71 A;  3AYH A;  1N1F A;  3LB6 B;  1M47 A;  1BGD A;  1F6F A;  3L5W I;  1HWG A;  2KZ1 A;  5FUC A;  1Y1W D;  2ERJ D;  3H0G D;  2B63 D;  3O7P A;  4IU8 A;  3PO3 D;  1ITI A;  4DKF A;  4D2B A;  1AU1 A;  5TS9 A;  2Q7N B;  1LK3 A;  1M4A A;  1M48 A;  1VLK A;  2B8U A;  3OG6 A;  3QB7 A;  4LDS A;  2XUT A;  4IU9 A;  5EQI A;  3UEZ E;  2Z3Q A;  5IP7 D;  4NI9 A;  2CYK A;  1ITM A;  5C3E D;  1PV6 A;  1ETE A;  2Y5Y A;  3NCB A;  4U4V A;  4BXX D;  3H3V E;  1BGE A;  1BUY A;  1Z92 A;  2B8Y A;  4GC0 A;  4TPG A; 
#chains in the Genus database with same CATH homology
 1M4B A;  3BPO A;  4A3D D;  5IYB D;  4NKQ C;  1M4R A;  2JA6 D;  1B5L A;  4A3M D;  1P9M B;  3EJJ A;  1ITL A;  1FYH A;  1NBP A;  2L3O A;  2B5I A;  4A3K D;  4A3B D;  1ITF A;  3HOW D;  3OG4 A;  1SCF A;  3UX9 A;  1AX8 A;  1Y1V D;  3QWR B;  3SE4 B;  4DKE A;  1KF9 A;  1Y6K L;  4O6K A;  1PY2 A;  4Z5R D;  3WCY I;  4NEM A;  4A3I D;  4BY7 D;  2B91 A;  5FLM D;  1HUW A;  2R7Z D;  3D87 A;  1EKU A;  2O6I A;  3G9V B;  2ILK A;  1D9C A;  3HOX D;  4A3J D;  2PSM A;  1CD9 A;  2L3Y A;  2VUM D;  5IYC D;  1F45 B;  4I77 Z;  5D72 A;  4CNI C;  2O27 A;  1V7M V;  3N0P A;  1EVS A;  1GNC A;  2JA5 D;  2Q98 A;  1IL6 A;  4NN6 A;  1EER A;  4DKC A;  1INR A;  1BP3 A;  3LB6 A;  3NCC A;  3NCE A;  3QT2 C;  5L6Y C;  4A93 D;  3NCF A;  4YPG C;  1AXI A;  4BBS D;  3NPZ A;  1LKI A;  1Z7C A;  4A3E D;  4ZS7 A;  3DI3 A;  3DLQ I;  3DUH C;  1J7V L;  4DKD A;  1JLI A;  1HGU A;  1Y6N L;  2XQB A;  1PGR A;  1HUL A;  2Z3R A;  2R93 D;  1LQS L;  2OQP A;  5D71 A;  1EMR A;  3AYH A;  5D22 A;  1N1F A;  1ILK A;  1BGC A;  1RCB A;  1RHG A;  3LB6 B;  2O26 A;  4WRL B;  3PIW A;  1HWH A;  4PS4 A;  2LAG A;  1M47 A;  3G6D A;  1V7N V;  1FG9 A;  3BPN A;  2E9W C;  3I4N D;  1I1R B;  3MZG A;  1Y6M L;  2LMS A;  4BBR D;  2C35 A;  1HZI A;  1IAR A;  4BY1 D;  3I4M D;  1BGD A;  1RFB A;  1ALU A;  2INT A;  5IP9 D;  3HMX B;  1F6F A;  4MHL A;  5D70 A;  4NN5 A;  3L5W I;  1HWG A;  2KZ1 A;  4NEJ A;  4YUE C;  5FUC A;  1Y1W D;  4A3C D;  2IL6 A;  5C44 D;  2B8Z A;  5LQB A;  2ERJ D;  3B5K A;  1Y14 A;  3H0G D;  1IJZ A;  3EW3 A;  4J4L C;  3TGX B;  2H24 A;  1M4C A;  1M49 A;  1PVH B;  4A3F D;  3QB1 A;  2B63 D;  5D28 B;  3PO3 D;  1BCN A;  3HOZ D;  1ITI A;  4DKF A;  3DI2 A;  1AU1 A;  3L5X A;  5KNH I;  5TS9 A;  1YKB A;  1HIJ A;  2Q7N B;  2JA8 D;  2R92 D;  1HIK A;  1GA3 A;  1LK3 A;  2B90 A;  5IYD D;  3HOV D;  1M4A A;  3HHC A;  4YDY I;  4A3G D;  1EXZ A;  1M48 A;  1VLK A;  4LRL A;  2B8U A;  2B8X A;  5C4X D;  3OG6 A;  3QB7 A;  4RS1 A;  3SE3 B;  1CSG A;  1BBN A;  2GMF A;  5FHX A;  3VA2 A;  3N06 A;  2D9Q A;  3Q1S I;  4GS7 A;  2D48 A;  3FKI D;  4A3L D;  3PIV A;  4X51 A;  5C7X A;  3OQ3 A;  3HOY D;  3S9D A;  2HYM B;  1PW6 A;  3UF2 A;  1A22 A;  1CN4 C;  4EXN A;  4GRW A;  1RW5 A;  1QVN A;  3QAZ A;  5E4E A;  3UEZ E;  2Z3Q A;  5IP7 D;  4NI9 A;  3HOU D;  3IRH A;  1IK0 A;  3BES L;  2CYK A;  1ITM A;  3BPL A;  4NN7 A;  1D9G A;  4DOH A;  5C3E D;  3PO2 D;  1CNT 1;  3DGC L;  3INK C;  3D85 C;  2Q14 A;  1ETE A;  3NCB A;  4BXX D;  4YQX A;  4EXP A;  1CYL A;  3H3V E;  1A7M A;  4FA8 E;  1BGE A;  1WU3 I;  4ZF7 A;  4NI7 A;  1IRL A;  1BUY A;  1Z92 A;  1WCM D;  2B8Y A;  2JA7 D;  3HHR A;  4O9H A;  3UF5 A;  3D48 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...