1ITFA

Interferon alpha-2a, nmr, 24 structures
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
165
structure length
165
Chain Sequence
b'CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTERFERON ALPHA-2A
publication title The three-dimensional high resolution structure of human interferon alpha-2a determined by heteronuclear NMR spectroscopy in solution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 46
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 1997-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00143 Interferon Interferon alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1250.10 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; Growth Hormone; Chain: A; 1itfA00
2O27A 4Z5RD 5LQBA 3QB1A 5KNHI 4X51A 5D70A 4YUEC 4YDYI 4CNIC 1AU1A 1VLKA 2B8XA 5C7XA 4RS1A 2B5IA 1IRLA 1PW6A 2ERJD 3G6DA 4NKQC 1LK3A 3NCCA 1ITLA 3MZGA 5E4EA 1BBNA 3EJJA 3UF5A 1HWGA 2LMSA 1KF9A 1AX8A 1CNT1 1BGCA 2Q7NB 3WCYI 1BUYA 1IJZA 5D28B 1CSGA 1IL6A 3S9DA 1ITMA 1LQSL 2Q98A 4NEJA 1HULA 1N1FA 4PS4A 4O9HA 1A7MA 3BPOA 1HWHA 2HYMB 3NCFA 1HGUA 1ALUA 1HUWA 1FYHA 2L3YA 3LB6B 1IK0A 1M48A 3HHRA 4WRLB 3UF2A 1HIKA 1I1RB 2LAGA 1BP3A 2ILKA 1J7VL 1F6FA 3QWRB 1NBPA 3VA2A 4ZS7A 1CD9A 1V7MV 3SE4B 1Y6KL 2B91A 1Z7CA 1GNCA 1PGRA 1D9CA 1EKUA 1CYLA 1M4CA 3SE3B 1M49A 2INTA 3BPNA 3D87A 5D72A 1SCFA 5L6YC 1V7NV 2D48A 3DUHC 3BPLA 1EERA 1BCNA 4NI7A 1JLIA 3EW3A 2E9WC 1Y6ML 3UX9A 4ZF7A 2B8ZA 5FHXA 3DGCL 1ITIA 1IARA 3NCEA 2B8YA 3OQ3A 4YQXA 3LB6A 4NI9A 1M4RA 1WU3I 1M47A 1BGDA 1EXZA 1HIJA 3D85C 4GRWA 4DOHA 1Y6NL 1EMRA 2IL6A 1D9GA 2B90A 1M4AA 1EVSA 3DLQI 1ETEA 2B8UA 5FUCA 5D22A 4NEMA 1RW5A 1PVHB 2L3OA 3NCBA 1RCBA 4J4LC 3INKC 3L5XA 3G9VB 3N0PA 3Q1SI 1RHGA 3D48P 1RFBA 1AXIA 3PIVA 1A22A 2H24A 1M4BA 1F45B 3NPZA 4FA8E 3B5KA 4O6KA 3N06A 1B5LA 3HMXB 2GMFA 1ILKA 3QB7A 3PIWA 1HZIA 3BESL 2O26A 4MHLA 2D9QA 1INRA 1FG9A 1PY2A 3UEZE 1Z92A 3QT2C 1GA3A 1P9MB 4YPGC 1QVNA 1CN4C 3QAZA 4I77Z 1ITFA 1LKIA 3L5WI 1YKBA 2KZ1A 1BGEA 5D71A 2CYKA
chains in the Genus database with same CATH superfamily
3OG6A 5KNHI 5D70A 4YDYI 4CNIC 2B8XA 5C7XA 4U4WA 2B5IA 3PO3D 4IKYA 1LK3A 1PW4A 3UF5A 4D2CA 1HWGA 1BGCA 4ZW9A 2O6IA 4NEJA 3I4MD 5D59A 4O9HA 1Y1VD 1HWHA 3DI3A 1HGUA 3NCFA 1ALUA 4A3ED 3LB6B 5A2NA 3TGXB 4JR9A 2LAGA 5IYDD 5C44D 5C65A 4ZS7A 1Z7CA 1GNCA 1EKUA 4APSA 1CYLA 3D87A 5L6YC 1SCFA 5EQGA 1V7NV 1PV6A 5EQIA 2Q14A 4U4TA 2E9WC 3I4ND 1ITIA 1IARA 4YQXA 3OQ3A 5TS9A 1M4RA 4XNIA 4IU8A 4ZWBA 4U4VA 3AYHA 1Y6NL 5IP7D 2IL6A 4OH3A 4Q65A 3DLQI 1ETEA 2B8UA 4J4LC 3L5XA 2CFQA 4LEPA 1PV7A 2H24A 1M4BA 4DKDA 3B5KA 4JREA 3QB7A 3PIWA 2O26A 1FG9A 3QAZA 4I77Z 2KZ1A 2O27A 3QB1A 4X51A 2JA6D 1IRLA 5C4XD 4NKQC 5E4EA 4DKEA 2LMSA 1KF9A 1CNT1 4LDSA 2Q7NB 3WCYI 1BUYA 1CSGA 1ITMA 4IKXA 5C3ED 4A3DD 4J05A 5EQHA 5IYBD 3O7PA 2ILKA 3QWRB 1NBPA 4GC0A 3VA2A 2OQPA 3SE4B 4LRLA 4BXXD 4GBZA 2INTA 3BPLA 1EERA 4NI7A 4A3KD 1Y6ML 2B8ZA 3NCEA 2B8YA 4IU9A 4EXPA 3PO2D 2B63D 4GRWA 4NN6A 1EMRA 4BY1D 1D9GA 1M4AA 5A2OA 4TPJA 5FUCA 5D22A 4NEMA 1RW5A 4ZWCA 3INKC 3G9VB 3N0PA 3D48P 3NPZA 3HOWD 1B5LA 2GMFA 2JA7D 2D9QA 1INRA 3HOYD 3HOVD 1GA3A 1QVNA 4UVMA 1ITFA 3L5WI 1Y14A 4TPHA 5LQBA 4YUEC 4D2BA 2R7ZD 4BBRD 1PW6A 2ERJD 3G6DA 4DKCA 2V8NA 3S9DA 1LQSL 2Q98A 5IYCD 4A3ID 3BPOA 4PYPA 1FYHA 3O7QA 3UF2A 4A3CD 1I1RB 4XNJA 1BP3A 1J7VL 1F6FA 3FKID 4TPGA 3DI2A 1Y6KL 2B91A 1PGRA 1D9CA 3SE3B 3BPNA 3DUHC 4W6VA 1BCNA 4OAAA 3EW3A 4A93D 2R93D 3UX9A 5FHXA 3DGCL 3LB6A 2Z3RA 4IKWA 1M47A 1EXZA 2Z3QA 2XUTA 2B90A 2C35A 1EVSA 1PVHB 3NCBA 1RCBA 3H3VE 2PSMA 3Q1SI 1RHGA 4A3BD 1AXIA 4NN7A 1A22A 3H0GD 2VUMD 3HOXD 1F45B 4IKVA 4O6KA 3N06A 4A3JD 3BESL 4MHLA 1Z92A 3QT2C 3HOUD 1P9MB 1WCMD 4YPGC 1CN4C 1LKIA 1Y1WD 4BBSD 5D71A 4GS7A 4Z5RD 4IKZA 1AU1A 1VLKA 4RS1A 2CFPA 4A3LD 3HOZD 3NCCA 1ITLA 3MZGA 1BBNA 3EJJA 3WDOA 2Y5YA 3OG4A 5FLMD 1AX8A 4QIQA 4D2DA 1IJZA 5D28B 1IL6A 1HULA 1N1FA 4PS4A 1A7MA 4YB9D 2HYMB 1HUWA 1IK0A 2L3YA 1M48A 4A3MD 3HHRA 4WRLB 1HIKA 4DKFA 1CD9A 1V7MV 4YBQA 4A3FD 1M4CA 1M49A 5D72A 3HHCA 2D48A 4GBYA 1JLIA 3IRHA 5D6KA 4ZF7A 5GXBA 2XQBA 4NI9A 4EXNA 2JA5D 1WU3I 1BGDA 1HIJA 3D85C 4DOHA 4NN5A 4A3GD 4ZYRA 2L3OA 1RFBA 3PIVA 2JA8D 4FA8E 4JA3A 3HMXB 1ILKA 4BY7D 5IP9D 1HZIA 2R92D 1PY2A 3UEZE 1YKBA 5D58A 1BGEA 2CYKA
chains in the Genus database with same CATH topology
2O27A 3OG6A 4Z5RD 5LQBA 3QB1A 5KNHI 4X51A 5D70A 2JA6D 4YUEC 4YDYI 4CNIC 1AU1A 2R7ZD 1VLKA 2B8XA 5C7XA 4GS7A 2B5IA 1IRLA 4RS1A 1PW6A 4BBRD 2ERJD 3G6DA 4NKQC 1LK3A 3NCCA 1ITLA 3MZGA 5E4EA 1BBNA 3EJJA 3OG4A 4DKEA 3UF5A 5FLMD 1HWGA 2LMSA 1KF9A 1AX8A 1CNT1 1BGCA 2Q7NB 3WCYI 1BUYA 1IJZA 5D28B 1CSGA 1IL6A 3S9DA 2O6IA 1ITMA 1LQSL 2Q98A 4NEJA 1HULA 1N1FA 5IYCD 3I4MD 5C3ED 3HOZD 4PS4A 4A3ID 4O9HA 1A7MA 1Y1VD 3BPOA 1HWHA 2HYMB 3DI3A 1HGUA 3NCFA 4A3DD 1ALUA 1HUWA 4A3ED 1FYHA 2L3YA 3LB6B 1IK0A 1M48A 4A3MD 3HHRA 4WRLB 3UF2A 1HIKA 4A3CD 1I1RB 5IYBD 4A3LD 3TGXB 2LAGA 5IYDD 1BP3A 2ILKA 1J7VL 5C44D 1F6FA 3QWRB 3FKID 1NBPA 3VA2A 4DKFA 1CD9A 2OQPA 1V7MV 3DI2A 3SE4B 1Y6KL 2B91A 1Z7CA 4LRLA 1GNCA 1PGRA 1D9CA 4BXXD 4A3FD 1EKUA 1CYLA 1M4CA 3SE3B 1M49A 2INTA 3BPNA 3D87A 5D72A 1SCFA 5L6YC 3HHCA 1V7NV 2D48A 3DUHC 3BPLA 4ZS7A 1EERA 2Q14A 1BCNA 4NI7A 1JLIA 3EW3A 2E9WC 3IRHA 4A3KD 4A93D 3I4ND 2R93D 1Y6ML 3UX9A 4ZF7A 2B8ZA 5FHXA 3DGCL 1ITIA 1IARA 3NCEA 2B8YA 3OQ3A 4YQXA 4EXPA 2XQBA 3LB6A 5TS9A 4NI9A 4EXNA 2Z3RA 1M4RA 2JA5D 1WU3I 3PO2D 1M47A 2B63D 1BGDA 1EXZA 1HIJA 3D85C 4GRWA 4NN6A 2Z3QA 3AYHA 4DOHA 1Y6NL 1EMRA 4NN5A 4BY1D 5IP7D 2IL6A 1D9GA 2B90A 1M4AA 1EVSA 2C35A 4A3GD 3DLQI 1ETEA 2B8UA 5FUCA 5D22A 4NEMA 1RW5A 1PVHB 2L3OA 3NCBA 1RCBA 4J4LC 3INKC 2PSMA 3H3VE 3L5XA 3G9VB 3N0PA 3Q1SI 1RHGA 3D48P 4A3BD 1RFBA 1AXIA 3PIVA 4NN7A 2JA8D 1A22A 3H0GD 2VUMD 3HOXD 2H24A 1M4BA 4DKDA 1F45B 3NPZA 3HOWD 4FA8E 3PO3D 3B5KA 4O6KA 3N06A 1B5LA 3HMXB 2GMFA 1ILKA 3QB7A 3PIWA 2JA7D 4A3JD 4BY7D 5IP9D 5C4XD 1HZIA 2R92D 3BESL 2O26A 4MHLA 2D9QA 1INRA 1FG9A 1PY2A 3HOYD 3HOVD 3UEZE 1Z92A 3QT2C 3HOUD 1GA3A 1WCMD 1P9MB 4YPGC 4DKCA 1QVNA 1CN4C 3QAZA 4I77Z 1ITFA 1LKIA 1Y1WD 3L5WI 1YKBA 2KZ1A 1BGEA 4BBSD 5D71A 1Y14A 2CYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O27 A;  4Z5R D;  5LQB A;  3QB1 A;  5KNH I;  4X51 A;  5D70 A;  4YUE C;  4YDY I;  4CNI C;  1AU1 A;  1VLK A;  2B8X A;  5C7X A;  4RS1 A;  2B5I A;  1IRL A;  1PW6 A;  2ERJ D;  3G6D A;  4NKQ C;  1LK3 A;  3NCC A;  1ITL A;  3MZG A;  5E4E A;  1BBN A;  3EJJ A;  3UF5 A;  1HWG A;  2LMS A;  1KF9 A;  1AX8 A;  1CNT 1;  1BGC A;  2Q7N B;  3WCY I;  1BUY A;  1IJZ A;  5D28 B;  1CSG A;  1IL6 A;  3S9D A;  1ITM A;  1LQS L;  2Q98 A;  4NEJ A;  1HUL A;  1N1F A;  4PS4 A;  4O9H A;  1A7M A;  3BPO A;  1HWH A;  2HYM B;  3NCF A;  1HGU A;  1ALU A;  1HUW A;  1FYH A;  2L3Y A;  3LB6 B;  1IK0 A;  1M48 A;  3HHR A;  4WRL B;  3UF2 A;  1HIK A;  1I1R B;  2LAG A;  1BP3 A;  2ILK A;  1J7V L;  1F6F A;  3QWR B;  1NBP A;  3VA2 A;  4ZS7 A;  1CD9 A;  1V7M V;  3SE4 B;  1Y6K L;  2B91 A;  1Z7C A;  1GNC A;  1PGR A;  1D9C A;  1EKU A;  1CYL A;  1M4C A;  3SE3 B;  1M49 A;  2INT A;  3BPN A;  3D87 A;  5D72 A;  1SCF A;  5L6Y C;  1V7N V;  2D48 A;  3DUH C;  3BPL A;  1EER A;  1BCN A;  4NI7 A;  1JLI A;  3EW3 A;  2E9W C;  1Y6M L;  3UX9 A;  4ZF7 A;  2B8Z A;  5FHX A;  3DGC L;  1ITI A;  1IAR A;  3NCE A;  2B8Y A;  3OQ3 A;  4YQX A;  3LB6 A;  4NI9 A;  1M4R A;  1WU3 I;  1M47 A;  1BGD A;  1EXZ A;  1HIJ A;  3D85 C;  4GRW A;  4DOH A;  1Y6N L;  1EMR A;  2IL6 A;  1D9G A;  2B90 A;  1M4A A;  1EVS A;  3DLQ I;  1ETE A;  2B8U A;  5FUC A;  5D22 A;  4NEM A;  1RW5 A;  1PVH B;  2L3O A;  3NCB A;  1RCB A;  4J4L C;  3INK C;  3L5X A;  3G9V B;  3N0P A;  3Q1S I;  1RHG A;  3D48 P;  1RFB A;  1AXI A;  3PIV A;  1A22 A;  2H24 A;  1M4B A;  1F45 B;  3NPZ A;  4FA8 E;  3B5K A;  4O6K A;  3N06 A;  1B5L A;  3HMX B;  2GMF A;  1ILK A;  3QB7 A;  3PIW A;  1HZI A;  3BES L;  2O26 A;  4MHL A;  2D9Q A;  1INR A;  1FG9 A;  1PY2 A;  3UEZ E;  1Z92 A;  3QT2 C;  1GA3 A;  1P9M B;  4YPG C;  1QVN A;  1CN4 C;  3QAZ A;  4I77 Z;  1ITF A;  1LKI A;  3L5W I;  1YKB A;  2KZ1 A;  1BGE A;  5D71 A;  2CYK A; 
#chains in the Genus database with same CATH topology
 3OG6 A;  5KNH I;  5D70 A;  4YDY I;  4CNI C;  2B8X A;  5C7X A;  4U4W A;  2B5I A;  3PO3 D;  4IKY A;  1LK3 A;  1PW4 A;  3UF5 A;  4D2C A;  1HWG A;  1BGC A;  4ZW9 A;  2O6I A;  4NEJ A;  3I4M D;  5D59 A;  4O9H A;  1Y1V D;  1HWH A;  3DI3 A;  1HGU A;  3NCF A;  1ALU A;  4A3E D;  3LB6 B;  5A2N A;  3TGX B;  4JR9 A;  2LAG A;  5IYD D;  5C44 D;  5C65 A;  4ZS7 A;  1Z7C A;  1GNC A;  1EKU A;  4APS A;  1CYL A;  3D87 A;  5L6Y C;  1SCF A;  5EQG A;  1V7N V;  1PV6 A;  5EQI A;  2Q14 A;  4U4T A;  2E9W C;  3I4N D;  1ITI A;  1IAR A;  4YQX A;  3OQ3 A;  5TS9 A;  1M4R A;  4XNI A;  4IU8 A;  4ZWB A;  4U4V A;  3AYH A;  1Y6N L;  5IP7 D;  2IL6 A;  4OH3 A;  4Q65 A;  3DLQ I;  1ETE A;  2B8U A;  4J4L C;  3L5X A;  2CFQ A;  4LEP A;  1PV7 A;  2H24 A;  1M4B A;  4DKD A;  3B5K A;  4JRE A;  3QB7 A;  3PIW A;  2O26 A;  1FG9 A;  3QAZ A;  4I77 Z;  2KZ1 A;  2O27 A;  3QB1 A;  4X51 A;  2JA6 D;  1IRL A;  5C4X D;  4NKQ C;  5E4E A;  4DKE A;  2LMS A;  1KF9 A;  1CNT 1;  4LDS A;  2Q7N B;  3WCY I;  1BUY A;  1CSG A;  1ITM A;  4IKX A;  5C3E D;  4A3D D;  4J05 A;  5EQH A;  5IYB D;  3O7P A;  2ILK A;  3QWR B;  1NBP A;  4GC0 A;  3VA2 A;  2OQP A;  3SE4 B;  4LRL A;  4BXX D;  4GBZ A;  2INT A;  3BPL A;  1EER A;  4NI7 A;  4A3K D;  1Y6M L;  2B8Z A;  3NCE A;  2B8Y A;  4IU9 A;  4EXP A;  3PO2 D;  2B63 D;  4GRW A;  4NN6 A;  1EMR A;  4BY1 D;  1D9G A;  1M4A A;  5A2O A;  4TPJ A;  5FUC A;  5D22 A;  4NEM A;  1RW5 A;  4ZWC A;  3INK C;  3G9V B;  3N0P A;  3D48 P;  3NPZ A;  3HOW D;  1B5L A;  2GMF A;  2JA7 D;  2D9Q A;  1INR A;  3HOY D;  3HOV D;  1GA3 A;  1QVN A;  4UVM A;  1ITF A;  3L5W I;  1Y14 A;  4TPH A;  5LQB A;  4YUE C;  4D2B A;  2R7Z D;  4BBR D;  1PW6 A;  2ERJ D;  3G6D A;  4DKC A;  2V8N A;  3S9D A;  1LQS L;  2Q98 A;  5IYC D;  4A3I D;  3BPO A;  4PYP A;  1FYH A;  3O7Q A;  3UF2 A;  4A3C D;  1I1R B;  4XNJ A;  1BP3 A;  1J7V L;  1F6F A;  3FKI D;  4TPG A;  3DI2 A;  1Y6K L;  2B91 A;  1PGR A;  1D9C A;  3SE3 B;  3BPN A;  3DUH C;  4W6V A;  1BCN A;  4OAA A;  3EW3 A;  4A93 D;  2R93 D;  3UX9 A;  5FHX A;  3DGC L;  3LB6 A;  2Z3R A;  4IKW A;  1M47 A;  1EXZ A;  2Z3Q A;  2XUT A;  2B90 A;  2C35 A;  1EVS A;  1PVH B;  3NCB A;  1RCB A;  3H3V E;  2PSM A;  3Q1S I;  1RHG A;  4A3B D;  1AXI A;  4NN7 A;  1A22 A;  3H0G D;  2VUM D;  3HOX D;  1F45 B;  4IKV A;  4O6K A;  3N06 A;  4A3J D;  3BES L;  4MHL A;  1Z92 A;  3QT2 C;  3HOU D;  1P9M B;  1WCM D;  4YPG C;  1CN4 C;  1LKI A;  1Y1W D;  4BBS D;  5D71 A;  4GS7 A;  4Z5R D;  4IKZ A;  1AU1 A;  1VLK A;  4RS1 A;  2CFP A;  4A3L D;  3HOZ D;  3NCC A;  1ITL A;  3MZG A;  1BBN A;  3EJJ A;  3WDO A;  2Y5Y A;  3OG4 A;  5FLM D;  1AX8 A;  4QIQ A;  4D2D A;  1IJZ A;  5D28 B;  1IL6 A;  1HUL A;  1N1F A;  4PS4 A;  1A7M A;  4YB9 D;  2HYM B;  1HUW A;  1IK0 A;  2L3Y A;  1M48 A;  4A3M D;  3HHR A;  4WRL B;  1HIK A;  4DKF A;  1CD9 A;  1V7M V;  4YBQ A;  4A3F D;  1M4C A;  1M49 A;  5D72 A;  3HHC A;  2D48 A;  4GBY A;  1JLI A;  3IRH A;  5D6K A;  4ZF7 A;  5GXB A;  2XQB A;  4NI9 A;  4EXN A;  2JA5 D;  1WU3 I;  1BGD A;  1HIJ A;  3D85 C;  4DOH A;  4NN5 A;  4A3G D;  4ZYR A;  2L3O A;  1RFB A;  3PIV A;  2JA8 D;  4FA8 E;  4JA3 A;  3HMX B;  1ILK A;  4BY7 D;  5IP9 D;  1HZI A;  2R92 D;  1PY2 A;  3UEZ E;  1YKB A;  5D58 A;  1BGE A;  2CYK A; 
#chains in the Genus database with same CATH homology
 2O27 A;  3OG6 A;  4Z5R D;  5LQB A;  3QB1 A;  5KNH I;  4X51 A;  5D70 A;  2JA6 D;  4YUE C;  4YDY I;  4CNI C;  1AU1 A;  2R7Z D;  1VLK A;  2B8X A;  5C7X A;  4GS7 A;  2B5I A;  1IRL A;  4RS1 A;  1PW6 A;  4BBR D;  2ERJ D;  3G6D A;  4NKQ C;  1LK3 A;  3NCC A;  1ITL A;  3MZG A;  5E4E A;  1BBN A;  3EJJ A;  3OG4 A;  4DKE A;  3UF5 A;  5FLM D;  1HWG A;  2LMS A;  1KF9 A;  1AX8 A;  1CNT 1;  1BGC A;  2Q7N B;  3WCY I;  1BUY A;  1IJZ A;  5D28 B;  1CSG A;  1IL6 A;  3S9D A;  2O6I A;  1ITM A;  1LQS L;  2Q98 A;  4NEJ A;  1HUL A;  1N1F A;  5IYC D;  3I4M D;  5C3E D;  3HOZ D;  4PS4 A;  4A3I D;  4O9H A;  1A7M A;  1Y1V D;  3BPO A;  1HWH A;  2HYM B;  3DI3 A;  1HGU A;  3NCF A;  4A3D D;  1ALU A;  1HUW A;  4A3E D;  1FYH A;  2L3Y A;  3LB6 B;  1IK0 A;  1M48 A;  4A3M D;  3HHR A;  4WRL B;  3UF2 A;  1HIK A;  4A3C D;  1I1R B;  5IYB D;  4A3L D;  3TGX B;  2LAG A;  5IYD D;  1BP3 A;  2ILK A;  1J7V L;  5C44 D;  1F6F A;  3QWR B;  3FKI D;  1NBP A;  3VA2 A;  4DKF A;  1CD9 A;  2OQP A;  1V7M V;  3DI2 A;  3SE4 B;  1Y6K L;  2B91 A;  1Z7C A;  4LRL A;  1GNC A;  1PGR A;  1D9C A;  4BXX D;  4A3F D;  1EKU A;  1CYL A;  1M4C A;  3SE3 B;  1M49 A;  2INT A;  3BPN A;  3D87 A;  5D72 A;  1SCF A;  5L6Y C;  3HHC A;  1V7N V;  2D48 A;  3DUH C;  3BPL A;  4ZS7 A;  1EER A;  2Q14 A;  1BCN A;  4NI7 A;  1JLI A;  3EW3 A;  2E9W C;  3IRH A;  4A3K D;  4A93 D;  3I4N D;  2R93 D;  1Y6M L;  3UX9 A;  4ZF7 A;  2B8Z A;  5FHX A;  3DGC L;  1ITI A;  1IAR A;  3NCE A;  2B8Y A;  3OQ3 A;  4YQX A;  4EXP A;  2XQB A;  3LB6 A;  5TS9 A;  4NI9 A;  4EXN A;  2Z3R A;  1M4R A;  2JA5 D;  1WU3 I;  3PO2 D;  1M47 A;  2B63 D;  1BGD A;  1EXZ A;  1HIJ A;  3D85 C;  4GRW A;  4NN6 A;  2Z3Q A;  3AYH A;  4DOH A;  1Y6N L;  1EMR A;  4NN5 A;  4BY1 D;  5IP7 D;  2IL6 A;  1D9G A;  2B90 A;  1M4A A;  1EVS A;  2C35 A;  4A3G D;  3DLQ I;  1ETE A;  2B8U A;  5FUC A;  5D22 A;  4NEM A;  1RW5 A;  1PVH B;  2L3O A;  3NCB A;  1RCB A;  4J4L C;  3INK C;  2PSM A;  3H3V E;  3L5X A;  3G9V B;  3N0P A;  3Q1S I;  1RHG A;  3D48 P;  4A3B D;  1RFB A;  1AXI A;  3PIV A;  4NN7 A;  2JA8 D;  1A22 A;  3H0G D;  2VUM D;  3HOX D;  2H24 A;  1M4B A;  4DKD A;  1F45 B;  3NPZ A;  3HOW D;  4FA8 E;  3PO3 D;  3B5K A;  4O6K A;  3N06 A;  1B5L A;  3HMX B;  2GMF A;  1ILK A;  3QB7 A;  3PIW A;  2JA7 D;  4A3J D;  4BY7 D;  5IP9 D;  5C4X D;  1HZI A;  2R92 D;  3BES L;  2O26 A;  4MHL A;  2D9Q A;  1INR A;  1FG9 A;  1PY2 A;  3HOY D;  3HOV D;  3UEZ E;  1Z92 A;  3QT2 C;  3HOU D;  1GA3 A;  1WCM D;  1P9M B;  4YPG C;  4DKC A;  1QVN A;  1CN4 C;  3QAZ A;  4I77 Z;  1ITF A;  1LKI A;  1Y1W D;  3L5W I;  1YKB A;  2KZ1 A;  1BGE A;  4BBS D;  5D71 A;  1Y14 A;  2CYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...