1ITIA

The high resolution three-dimensional solution structure of human interleukin-4 determined by multi-dimensional heteronuclear magnetic resonance spectroscopy
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
133
structure length
133
Chain Sequence
b'EAEAHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKDTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEADQSTLENFLERLKTIMREKYSKCSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTERLEUKIN-4
publication title The high-resolution, three-dimensional solution structure of human interleukin-4 determined by multidimensional heteronuclear magnetic resonance spectroscopy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 34
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 1993-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00727 IL4 Interleukin 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1250.10 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; Growth Hormone; Chain: A; 1itiA00
4Z5RD 1RFBA 4MHLA 2L3YA 3EW3A 3S9DA 3BPNA 1Y6KL 3UF5A 1P9MB 4FA8E 1M4CA 3QWRB 1PGRA 3N0PA 4YPGC 1HUWA 4ZF7A 1IK0A 4NEJA 2ERJD 5E4EA 3NCFA 1INRA 5D22A 1ITMA 3NCCA 2E9WC 5D28B 1CYLA 4NEMA 5FHXA 1GNCA 1HIKA 1EXZA 1F6FA 1PY2A 3G9VB 2ILKA 1BGCA 2B5IA 3B5KA 1AX8A 1CN4C 1NBPA 3LB6A 3BESL 4X51A 4NI7A 1RCBA 1Z92A 1BGDA 4GRWA 1FG9A 1J7VL 1CD9A 3Q1SI 1M4AA 3PIWA 4NKQC 3G6DA 3PIVA 1Y6NL 3N06A 3VA2A 1EKUA 1HULA 2B8XA 3OQ3A 1IL6A 2D9QA 1JLIA 2D48A 1M4RA 4O9HA 1BCNA 3D48P 3DLQI 3SE4B 1GA3A 3UEZE 1BP3A 1BBNA 3NCBA 1PVHB 1LK3A 2IL6A 3QB1A 1IJZA 1V7MV 5C7XA 1M47A 3UX9A 2CYKA 3EJJA 1Y6ML 1V7NV 1EVSA 1EERA 4CNIC 3INKC 1D9CA 3LB6B 1N1FA 2INTA 1RHGA 4YQXA 1A7MA 1IRLA 3SE3B 1QVNA 1ITFA 1CSGA 1CNT1 3D85C 2Q98A 3MZGA 2GMFA 2L3OA 3QAZA 3BPLA 2O26A 5D72A 1HIJA 3HMXB 1LKIA 4NI9A 2B8YA 1ITIA 1WU3I 1Z7CA 4PS4A 1HWHA 3DUHC 2LAGA 3NCEA 1ITLA 5D70A 3QT2C 4J4LC 1ALUA 1HWGA 2B90A 1VLKA 1AU1A 4YDYI 1ILKA 3DGCL 2HYMB 1A22A 1HZIA 5LQBA 3NPZA 5FUCA 1SCFA 1BGEA 1F45B 3WCYI 5KNHI 4YUEC 2Q7NB 5L6YC 3BPOA 1LQSL 1EMRA 1PW6A 4WRLB 1YKBA 1M48A 4DOHA 1IARA 1B5LA 2B8ZA 2B8UA 1D9GA 3L5WI 3HHRA 1KF9A 3L5XA 3UF2A 2KZ1A 4ZS7A 4I77Z 1AXIA 2O27A 1M49A 5D71A 2LMSA 3QB7A 1I1RB 4RS1A 1FYHA 2H24A 1BUYA 1ETEA 2B91A 1M4BA 3D87A 1RW5A 1HGUA 4O6KA
chains in the Genus database with same CATH superfamily
4DKCA 3S9DA 1Y6KL 1P9MB 4FA8E 3QWRB 4YPGC 4A3FD 4NEJA 3NCFA 4DKDA 5GXBA 5FHXA 1GNCA 4A3GD 4DKFA 3HOZD 4X51A 4NI7A 5EQHA 3BESL 4BY1D 3HOUD 3O7PA 4NKQC 3G6DA 3VA2A 1Y6NL 3N06A 5D6KA 4Q65A 1IL6A 2D9QA 4EXPA 4OAAA 5D58A 2CFPA 1BBNA 1LK3A 4TPGA 3QB1A 5C7XA 3I4MD 4JA3A 4D2DA 1V7NV 1EVSA 5IP7D 3LB6B 4YQXA 3SE3B 3OG6A 3IRHA 4BY7D 1CNT1 2GMFA 3BPLA 2O26A 4BXXD 3I4ND 2O6IA 4A3JD 1ITIA 3PO2D 4W6VA 4PS4A 1HWHA 3DUHC 3QT2C 2B90A 2HYMB 4A93D 5LQBA 5D59A 3WCYI 1F45B 1PV6A 1LQSL 1EMRA 4WRLB 2B8UA 1KF9A 2PSMA 2KZ1A 1AXIA 2LMSA 4U4TA 5EQIA 1FYHA 4A3LD 1M4BA 3HOWD 1PV7A 4LRLA 1RFBA 3BPNA 2JA6D 3H3VE 4A3BD 3N0PA 1HUWA 1IK0A 2ERJD 5D22A 1ITMA 2OQPA 5D28B 1CYLA 3G9VB 1EXZA 1F6FA 1BGCA 1AX8A 4IKVA 3HOVD 4A3ED 1J7VL 4ZWBA 1Y1WD 1EKUA 2B8XA 3OQ3A 4GBYA 3DLQI 3SE4B 5C3ED 4J05A 3NCBA 2IL6A 1Y6ML 2R93D 1D9CA 1N1FA 2INTA 5IYCD 3QAZA 5D72A 1Y1VD 5IP9D 2R92D 1LKIA 4NI9A 3HOXD 4YB9D 4IU9A 4NN5A 4APSA 2Q14A 1ALUA 1HWGA 3FKID 1ILKA 3DGCL 3NPZA 1SCFA 1Y14A 3BPOA 1PW6A 4DOHA 4ZYRA 4A3DD 4U4VA 4ZWCA 3HHRA 5C4XD 3L5XA 3TGXB 4U4WA 4ZS7A 2O27A 2H24A 4XNIA 4MHLA 2L3YA 3EW3A 3UF5A 1M4CA 2C35A 2XUTA 4GS7A 2CFQA 4YBQA 4NEMA 4BBRD 2ILKA 1CN4C 1NBPA 4GRWA 3OG4A 1CD9A 1M4AA 2Y5YA 5C44D 2D48A 2Z3RA 3UEZE 3HHCA 1PVHB 1M47A 3UX9A 2CYKA 3EJJA 4ZW9A 1RHGA 4OH3A 4TPHA 1CSGA 2Z3QA 4GC0A 3D85C 2Q98A 3MZGA 3DI3A 4PYPA 1HIJA 3HMXB 3PO3D 2B8YA 5EQGA 1WU3I 1Z7CA 3O7QA 5IYBD 4J4LC 4LEPA 1A22A 4IKXA 4XNJA 4DKEA 4IKWA 2JA8D 5KNHI 4YUEC 5L6YC 4IU8A 1YKBA 1M48A 1B5LA 1D9GA 3UF2A 4I77Z 4JR9A 5D71A 3QB7A 4RS1A 4EXNA 1BUYA 3DI2A 1PW4A 1ETEA 5A2OA 4D2BA 4IKZA 5A2NA 1HGUA 3AYHA 4Z5RD 4JREA 4A3KD 1PGRA 4A3MD 5IYDD 4ZF7A 2JA5D 3H0GD 5E4EA 1INRA 3NCCA 4QIQA 2E9WC 2XQBA 1HIKA 1PY2A 2B5IA 3B5KA 3LB6A 1RCBA 1Z92A 1BGDA 1FG9A 3Q1SI 3PIWA 3PIVA 5TS9A 4NN7A 1HULA 1JLIA 1M4RA 4O9HA 1BCNA 3D48P 1GA3A 4D2CA 1BP3A 1WCMD 1IJZA 1V7MV 5C65A 2V8NA 4GBZA 5FLMD 1EERA 4CNIC 4UVMA 3INKC 1A7MA 1IRLA 1QVNA 1ITFA 2L3OA 2B63D 3HOYD 4A3CD 2VUMD 2LAGA 4TPJA 3NCEA 1ITLA 5D70A 1VLKA 1AU1A 4YDYI 1HZIA 5FUCA 1BGEA 4A3ID 2Q7NB 3WDOA 2R7ZD 1IARA 2B8ZA 3L5WI 1M49A 4BBSD 1I1RB 2JA7D 4LDSA 2B91A 4IKYA 4NN6A 3D87A 1RW5A 4O6KA
chains in the Genus database with same CATH topology
3AYHA 4DKCA 4LRLA 4Z5RD 1RFBA 4MHLA 2L3YA 3EW3A 3S9DA 3BPNA 1Y6KL 3UF5A 1P9MB 4FA8E 1M4CA 2C35A 3QWRB 2JA6D 3H3VE 4A3KD 4GS7A 1PGRA 3N0PA 4YPGC 4A3FD 5IYDD 1HUWA 4A3MD 4A3BD 4ZF7A 2JA5D 1IK0A 3H0GD 2ERJD 4NEJA 3NCFA 5E4EA 1INRA 5D22A 1ITMA 3NCCA 2OQPA 4DKDA 2E9WC 5D28B 1CYLA 4NEMA 5FHXA 1GNCA 4A3GD 2XQBA 4BBRD 4DKFA 1HIKA 1EXZA 1F6FA 1PY2A 3G9VB 2ILKA 3HOZD 1BGCA 2B5IA 3B5KA 1AX8A 1CN4C 1NBPA 3LB6A 3BESL 4X51A 4NI7A 4BY1D 1RCBA 1Z92A 3HOVD 4A3ED 1BGDA 4GRWA 1FG9A 3HOUD 1J7VL 1CD9A 3OG4A 1M4AA 3PIWA 3Q1SI 3G6DA 3PIVA 1Y6NL 3N06A 4NKQC 5TS9A 3VA2A 4NN7A 1Y1WD 1EKUA 5C44D 1HULA 2B8XA 3OQ3A 1IL6A 2D9QA 1JLIA 2D48A 4EXPA 1M4RA 4O9HA 1BCNA 3D48P 3DLQI 3SE4B 1GA3A 2Z3RA 3UEZE 1BP3A 3HHCA 1BBNA 5C3ED 1WCMD 3NCBA 1PVHB 1LK3A 2IL6A 3QB1A 1IJZA 1V7MV 5C7XA 1M47A 3I4MD 3UX9A 2CYKA 3EJJA 1Y6ML 5FLMD 1V7NV 2R93D 1EVSA 1EERA 4CNIC 3INKC 5IP7D 1D9CA 3LB6B 1N1FA 2INTA 1RHGA 4YQXA 1A7MA 1IRLA 3SE3B 3OG6A 1QVNA 1ITFA 3IRHA 1CSGA 4BY7D 2Z3QA 1CNT1 3D85C 2Q98A 3MZGA 2GMFA 3DI3A 2L3OA 5IYCD 2B63D 3QAZA 3BPLA 2O26A 5D72A 4BXXD 1Y1VD 3I4ND 5IP9D 2R92D 1HIJA 3HOYD 3HMXB 1LKIA 2O6IA 4A3JD 4NI9A 3PO3D 2B8YA 1ITIA 3HOXD 3PO2D 1WU3I 1Z7CA 4A3CD 2VUMD 4PS4A 4NN5A 1HWHA 3DUHC 2Q14A 2LAGA 5IYBD 3NCEA 1ITLA 5D70A 3QT2C 4J4LC 1ALUA 1HWGA 3FKID 2B90A 1VLKA 1AU1A 4YDYI 1ILKA 3DGCL 2HYMB 4A93D 1A22A 1HZIA 5LQBA 3NPZA 5FUCA 1SCFA 1BGEA 1F45B 3WCYI 4DKEA 4A3ID 1Y14A 2JA8D 5KNHI 4YUEC 2Q7NB 5L6YC 3BPOA 1LQSL 1EMRA 2R7ZD 1PW6A 4WRLB 1YKBA 1M48A 4DOHA 4A3DD 1IARA 1B5LA 2B8ZA 2B8UA 1D9GA 3L5WI 3HHRA 5C4XD 1KF9A 2PSMA 3L5XA 2KZ1A 3TGXB 3UF2A 4I77Z 4ZS7A 1AXIA 2O27A 1M49A 5D71A 4BBSD 2LMSA 3QB7A 1I1RB 4RS1A 4A3LD 1FYHA 2H24A 4EXNA 1BUYA 2JA7D 3DI2A 1ETEA 2B91A 4NN6A 1M4BA 3D87A 1RW5A 1HGUA 4O6KA 3HOWD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z5R D;  1RFB A;  4MHL A;  2L3Y A;  3EW3 A;  3S9D A;  3BPN A;  1Y6K L;  3UF5 A;  1P9M B;  4FA8 E;  1M4C A;  3QWR B;  1PGR A;  3N0P A;  4YPG C;  1HUW A;  4ZF7 A;  1IK0 A;  4NEJ A;  2ERJ D;  5E4E A;  3NCF A;  1INR A;  5D22 A;  1ITM A;  3NCC A;  2E9W C;  5D28 B;  1CYL A;  4NEM A;  5FHX A;  1GNC A;  1HIK A;  1EXZ A;  1F6F A;  1PY2 A;  3G9V B;  2ILK A;  1BGC A;  2B5I A;  3B5K A;  1AX8 A;  1CN4 C;  1NBP A;  3LB6 A;  3BES L;  4X51 A;  4NI7 A;  1RCB A;  1Z92 A;  1BGD A;  4GRW A;  1FG9 A;  1J7V L;  1CD9 A;  3Q1S I;  1M4A A;  3PIW A;  4NKQ C;  3G6D A;  3PIV A;  1Y6N L;  3N06 A;  3VA2 A;  1EKU A;  1HUL A;  2B8X A;  3OQ3 A;  1IL6 A;  2D9Q A;  1JLI A;  2D48 A;  1M4R A;  4O9H A;  1BCN A;  3D48 P;  3DLQ I;  3SE4 B;  1GA3 A;  3UEZ E;  1BP3 A;  1BBN A;  3NCB A;  1PVH B;  1LK3 A;  2IL6 A;  3QB1 A;  1IJZ A;  1V7M V;  5C7X A;  1M47 A;  3UX9 A;  2CYK A;  3EJJ A;  1Y6M L;  1V7N V;  1EVS A;  1EER A;  4CNI C;  3INK C;  1D9C A;  3LB6 B;  1N1F A;  2INT A;  1RHG A;  4YQX A;  1A7M A;  1IRL A;  3SE3 B;  1QVN A;  1ITF A;  1CSG A;  1CNT 1;  3D85 C;  2Q98 A;  3MZG A;  2GMF A;  2L3O A;  3QAZ A;  3BPL A;  2O26 A;  5D72 A;  1HIJ A;  3HMX B;  1LKI A;  4NI9 A;  2B8Y A;  1ITI A;  1WU3 I;  1Z7C A;  4PS4 A;  1HWH A;  3DUH C;  2LAG A;  3NCE A;  1ITL A;  5D70 A;  3QT2 C;  4J4L C;  1ALU A;  1HWG A;  2B90 A;  1VLK A;  1AU1 A;  4YDY I;  1ILK A;  3DGC L;  2HYM B;  1A22 A;  1HZI A;  5LQB A;  3NPZ A;  5FUC A;  1SCF A;  1BGE A;  1F45 B;  3WCY I;  5KNH I;  4YUE C;  2Q7N B;  5L6Y C;  3BPO A;  1LQS L;  1EMR A;  1PW6 A;  4WRL B;  1YKB A;  1M48 A;  4DOH A;  1IAR A;  1B5L A;  2B8Z A;  2B8U A;  1D9G A;  3L5W I;  3HHR A;  1KF9 A;  3L5X A;  3UF2 A;  2KZ1 A;  4ZS7 A;  4I77 Z;  1AXI A;  2O27 A;  1M49 A;  5D71 A;  2LMS A;  3QB7 A;  1I1R B;  4RS1 A;  1FYH A;  2H24 A;  1BUY A;  1ETE A;  2B91 A;  1M4B A;  3D87 A;  1RW5 A;  1HGU A;  4O6K A; 
#chains in the Genus database with same CATH topology
 4DKC A;  3S9D A;  1Y6K L;  1P9M B;  4FA8 E;  3QWR B;  4YPG C;  4A3F D;  4NEJ A;  3NCF A;  4DKD A;  5GXB A;  5FHX A;  1GNC A;  4A3G D;  4DKF A;  3HOZ D;  4X51 A;  4NI7 A;  5EQH A;  3BES L;  4BY1 D;  3HOU D;  3O7P A;  4NKQ C;  3G6D A;  3VA2 A;  1Y6N L;  3N06 A;  5D6K A;  4Q65 A;  1IL6 A;  2D9Q A;  4EXP A;  4OAA A;  5D58 A;  2CFP A;  1BBN A;  1LK3 A;  4TPG A;  3QB1 A;  5C7X A;  3I4M D;  4JA3 A;  4D2D A;  1V7N V;  1EVS A;  5IP7 D;  3LB6 B;  4YQX A;  3SE3 B;  3OG6 A;  3IRH A;  4BY7 D;  1CNT 1;  2GMF A;  3BPL A;  2O26 A;  4BXX D;  3I4N D;  2O6I A;  4A3J D;  1ITI A;  3PO2 D;  4W6V A;  4PS4 A;  1HWH A;  3DUH C;  3QT2 C;  2B90 A;  2HYM B;  4A93 D;  5LQB A;  5D59 A;  3WCY I;  1F45 B;  1PV6 A;  1LQS L;  1EMR A;  4WRL B;  2B8U A;  1KF9 A;  2PSM A;  2KZ1 A;  1AXI A;  2LMS A;  4U4T A;  5EQI A;  1FYH A;  4A3L D;  1M4B A;  3HOW D;  1PV7 A;  4LRL A;  1RFB A;  3BPN A;  2JA6 D;  3H3V E;  4A3B D;  3N0P A;  1HUW A;  1IK0 A;  2ERJ D;  5D22 A;  1ITM A;  2OQP A;  5D28 B;  1CYL A;  3G9V B;  1EXZ A;  1F6F A;  1BGC A;  1AX8 A;  4IKV A;  3HOV D;  4A3E D;  1J7V L;  4ZWB A;  1Y1W D;  1EKU A;  2B8X A;  3OQ3 A;  4GBY A;  3DLQ I;  3SE4 B;  5C3E D;  4J05 A;  3NCB A;  2IL6 A;  1Y6M L;  2R93 D;  1D9C A;  1N1F A;  2INT A;  5IYC D;  3QAZ A;  5D72 A;  1Y1V D;  5IP9 D;  2R92 D;  1LKI A;  4NI9 A;  3HOX D;  4YB9 D;  4IU9 A;  4NN5 A;  4APS A;  2Q14 A;  1ALU A;  1HWG A;  3FKI D;  1ILK A;  3DGC L;  3NPZ A;  1SCF A;  1Y14 A;  3BPO A;  1PW6 A;  4DOH A;  4ZYR A;  4A3D D;  4U4V A;  4ZWC A;  3HHR A;  5C4X D;  3L5X A;  3TGX B;  4U4W A;  4ZS7 A;  2O27 A;  2H24 A;  4XNI A;  4MHL A;  2L3Y A;  3EW3 A;  3UF5 A;  1M4C A;  2C35 A;  2XUT A;  4GS7 A;  2CFQ A;  4YBQ A;  4NEM A;  4BBR D;  2ILK A;  1CN4 C;  1NBP A;  4GRW A;  3OG4 A;  1CD9 A;  1M4A A;  2Y5Y A;  5C44 D;  2D48 A;  2Z3R A;  3UEZ E;  3HHC A;  1PVH B;  1M47 A;  3UX9 A;  2CYK A;  3EJJ A;  4ZW9 A;  1RHG A;  4OH3 A;  4TPH A;  1CSG A;  2Z3Q A;  4GC0 A;  3D85 C;  2Q98 A;  3MZG A;  3DI3 A;  4PYP A;  1HIJ A;  3HMX B;  3PO3 D;  2B8Y A;  5EQG A;  1WU3 I;  1Z7C A;  3O7Q A;  5IYB D;  4J4L C;  4LEP A;  1A22 A;  4IKX A;  4XNJ A;  4DKE A;  4IKW A;  2JA8 D;  5KNH I;  4YUE C;  5L6Y C;  4IU8 A;  1YKB A;  1M48 A;  1B5L A;  1D9G A;  3UF2 A;  4I77 Z;  4JR9 A;  5D71 A;  3QB7 A;  4RS1 A;  4EXN A;  1BUY A;  3DI2 A;  1PW4 A;  1ETE A;  5A2O A;  4D2B A;  4IKZ A;  5A2N A;  1HGU A;  3AYH A;  4Z5R D;  4JRE A;  4A3K D;  1PGR A;  4A3M D;  5IYD D;  4ZF7 A;  2JA5 D;  3H0G D;  5E4E A;  1INR A;  3NCC A;  4QIQ A;  2E9W C;  2XQB A;  1HIK A;  1PY2 A;  2B5I A;  3B5K A;  3LB6 A;  1RCB A;  1Z92 A;  1BGD A;  1FG9 A;  3Q1S I;  3PIW A;  3PIV A;  5TS9 A;  4NN7 A;  1HUL A;  1JLI A;  1M4R A;  4O9H A;  1BCN A;  3D48 P;  1GA3 A;  4D2C A;  1BP3 A;  1WCM D;  1IJZ A;  1V7M V;  5C65 A;  2V8N A;  4GBZ A;  5FLM D;  1EER A;  4CNI C;  4UVM A;  3INK C;  1A7M A;  1IRL A;  1QVN A;  1ITF A;  2L3O A;  2B63 D;  3HOY D;  4A3C D;  2VUM D;  2LAG A;  4TPJ A;  3NCE A;  1ITL A;  5D70 A;  1VLK A;  1AU1 A;  4YDY I;  1HZI A;  5FUC A;  1BGE A;  4A3I D;  2Q7N B;  3WDO A;  2R7Z D;  1IAR A;  2B8Z A;  3L5W I;  1M49 A;  4BBS D;  1I1R B;  2JA7 D;  4LDS A;  2B91 A;  4IKY A;  4NN6 A;  3D87 A;  1RW5 A;  4O6K A; 
#chains in the Genus database with same CATH homology
 3AYH A;  4DKC A;  4LRL A;  4Z5R D;  1RFB A;  4MHL A;  2L3Y A;  3EW3 A;  3S9D A;  3BPN A;  1Y6K L;  3UF5 A;  1P9M B;  4FA8 E;  1M4C A;  2C35 A;  3QWR B;  2JA6 D;  3H3V E;  4A3K D;  4GS7 A;  1PGR A;  3N0P A;  4YPG C;  4A3F D;  5IYD D;  1HUW A;  4A3M D;  4A3B D;  4ZF7 A;  2JA5 D;  1IK0 A;  3H0G D;  2ERJ D;  4NEJ A;  3NCF A;  5E4E A;  1INR A;  5D22 A;  1ITM A;  3NCC A;  2OQP A;  4DKD A;  2E9W C;  5D28 B;  1CYL A;  4NEM A;  5FHX A;  1GNC A;  4A3G D;  2XQB A;  4BBR D;  4DKF A;  1HIK A;  1EXZ A;  1F6F A;  1PY2 A;  3G9V B;  2ILK A;  3HOZ D;  1BGC A;  2B5I A;  3B5K A;  1AX8 A;  1CN4 C;  1NBP A;  3LB6 A;  3BES L;  4X51 A;  4NI7 A;  4BY1 D;  1RCB A;  1Z92 A;  3HOV D;  4A3E D;  1BGD A;  4GRW A;  1FG9 A;  3HOU D;  1J7V L;  1CD9 A;  3OG4 A;  1M4A A;  3PIW A;  3Q1S I;  3G6D A;  3PIV A;  1Y6N L;  3N06 A;  4NKQ C;  5TS9 A;  3VA2 A;  4NN7 A;  1Y1W D;  1EKU A;  5C44 D;  1HUL A;  2B8X A;  3OQ3 A;  1IL6 A;  2D9Q A;  1JLI A;  2D48 A;  4EXP A;  1M4R A;  4O9H A;  1BCN A;  3D48 P;  3DLQ I;  3SE4 B;  1GA3 A;  2Z3R A;  3UEZ E;  1BP3 A;  3HHC A;  1BBN A;  5C3E D;  1WCM D;  3NCB A;  1PVH B;  1LK3 A;  2IL6 A;  3QB1 A;  1IJZ A;  1V7M V;  5C7X A;  1M47 A;  3I4M D;  3UX9 A;  2CYK A;  3EJJ A;  1Y6M L;  5FLM D;  1V7N V;  2R93 D;  1EVS A;  1EER A;  4CNI C;  3INK C;  5IP7 D;  1D9C A;  3LB6 B;  1N1F A;  2INT A;  1RHG A;  4YQX A;  1A7M A;  1IRL A;  3SE3 B;  3OG6 A;  1QVN A;  1ITF A;  3IRH A;  1CSG A;  4BY7 D;  2Z3Q A;  1CNT 1;  3D85 C;  2Q98 A;  3MZG A;  2GMF A;  3DI3 A;  2L3O A;  5IYC D;  2B63 D;  3QAZ A;  3BPL A;  2O26 A;  5D72 A;  4BXX D;  1Y1V D;  3I4N D;  5IP9 D;  2R92 D;  1HIJ A;  3HOY D;  3HMX B;  1LKI A;  2O6I A;  4A3J D;  4NI9 A;  3PO3 D;  2B8Y A;  1ITI A;  3HOX D;  3PO2 D;  1WU3 I;  1Z7C A;  4A3C D;  2VUM D;  4PS4 A;  4NN5 A;  1HWH A;  3DUH C;  2Q14 A;  2LAG A;  5IYB D;  3NCE A;  1ITL A;  5D70 A;  3QT2 C;  4J4L C;  1ALU A;  1HWG A;  3FKI D;  2B90 A;  1VLK A;  1AU1 A;  4YDY I;  1ILK A;  3DGC L;  2HYM B;  4A93 D;  1A22 A;  1HZI A;  5LQB A;  3NPZ A;  5FUC A;  1SCF A;  1BGE A;  1F45 B;  3WCY I;  4DKE A;  4A3I D;  1Y14 A;  2JA8 D;  5KNH I;  4YUE C;  2Q7N B;  5L6Y C;  3BPO A;  1LQS L;  1EMR A;  2R7Z D;  1PW6 A;  4WRL B;  1YKB A;  1M48 A;  4DOH A;  4A3D D;  1IAR A;  1B5L A;  2B8Z A;  2B8U A;  1D9G A;  3L5W I;  3HHR A;  5C4X D;  1KF9 A;  2PSM A;  3L5X A;  2KZ1 A;  3TGX B;  3UF2 A;  4I77 Z;  4ZS7 A;  1AXI A;  2O27 A;  1M49 A;  5D71 A;  4BBS D;  2LMS A;  3QB7 A;  1I1R B;  4RS1 A;  4A3L D;  1FYH A;  2H24 A;  4EXN A;  1BUY A;  2JA7 D;  3DI2 A;  1ETE A;  2B91 A;  4NN6 A;  1M4B A;  3D87 A;  1RW5 A;  1HGU A;  4O6K A;  3HOW D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...