1ITIA

The high resolution three-dimensional solution structure of human interleukin-4 determined by multi-dimensional heteronuclear magnetic resonance spectroscopy
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
133
structure length
133
Chain Sequence
EAEAHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKDTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEADQSTLENFLERLKTIMREKYSKCSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords INTERLEUKIN-4
publication title The high-resolution, three-dimensional solution structure of human interleukin-4 determined by multidimensional heteronuclear magnetic resonance spectroscopy.
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 1993-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00727 IL4 Interleukin 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1250.10 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; Growth Hormone; Chain: A; 1itiA00
4WRLB 3INKC 3UF2A 3SE3B 1INRA 4YDYI 1N1FA 1HULA 4NI7A 1M48A 5LQBA 3PIWA 1M49A 1BGEA 4CNIC 1KF9A 1CD9A 2O26A 3BPOA 1Y6KL 1AXIA 3G9VB 4NEMA 1AX8A 2D9QA 3NCFA 2O27A 3D48P 1PVHB 4ZS7A 1ALUA 3BPNA 1QVNA 1M47A 1V7NV 2ERJD 3UEZE 1RFBA 1HIKA 3QAZA 3DGCL 3QB7A 1D9CA 3D87A 2B8ZA 4MHLA 4RS1A 1RCBA 1SCFA 4NKQC 3HHRA 2ILKA 5D72A 1AU1A 2B5IA 1BGDA 1ITFA 1CYLA 1RHGA 1Y6NL 4O6KA 1WU3I 3QB1A 1FYHA 1IJZA 4YQXA 5KNHI 3QWRB 1BGCA 1A7MA 1M4RA 3PIVA 4NI9A 3NCEA 3WCYI 4FA8E 1Y6ML 1RW5A 1ITLA 1PY2A 2B91A 2Q98A 1A22A 2L3YA 1J7VL 3G6DA 2B8YA 1F6FA 1NBPA 1CNT1 4NEJA 2HYMB 1ITMA 4I77Z 3BPLA 1EVSA 1HGUA 5D70A 5FHXA 1HIJA 2D48A 2L3OA 3SE4B 3NCBA 1V7MV 3N0PA 5D28B 1BP3A 3VA2A 1EXZA 1ITIA 3LB6A 2KZ1A 1LQSL 2B8XA 1IK0A 4J4LC 1ETEA 5D71A 4PS4A 3NCCA 2GMFA 3OQ3A 2INTA 3EW3A 1GA3A 1B5LA 5E4EA 1LKIA 2E9WC 3BESL 2LMSA 3B5KA 5FUCA 1BUYA 1I1RB 4GRWA 1LK3A 1FG9A 4ZF7A 1EMRA 3N06A 3S9DA 1HZIA 3UX9A 3NPZA 3QT2C 1BCNA 3D85C 1CN4C 3DLQI 3L5XA 1GNCA 4DOHA 1D9GA 2IL6A 2B90A 3MZGA 2H24A 3UF5A 1EKUA 1P9MB 1IL6A 4X51A 1F45B 1CSGA 3L5WI 1JLIA 1EERA 3Q1SI 1M4AA 1IRLA 1ILKA 1YKBA 4O9HA 1HUWA 1VLKA 3EJJA 1M4BA 2Q7NB 5C7XA 1Z92A 1PGRA 3LB6B 1BBNA 4YUEC 5D22A 1Z7CA 2LAGA 5L6YC 1M4CA 3DUHC 2B8UA 4Z5RD 2CYKA 1PW6A 1HWGA 1HWHA 1IARA 4YPGC 3HMXB
chains in the Genus database with same CATH superfamily
2V8NA 1INRA 1M48A 5LQBA 1KF9A 1CD9A 3BPOA 1AXIA 4IKWA 4NEMA 3NCFA 2O27A 3D48P 3TGXB 4D2BA 4A3GD 3BPNA 1QVNA 2JA6D 1RCBA 4NKQC 2ILKA 2R93D 1Y6NL 1WU3I 1IJZA 4YQXA 3PIVA 3NCEA 3WCYI 2Q98A 2VUMD 4LDSA 1A22A 1F6FA 4NEJA 2HYMB 4I77Z 3BPLA 5FHXA 2L3OA 3DI3A 1V7MV 4NN6A 5D28B 1BP3A 4TPGA 4D2DA 1LQSL 4J4LC 1ETEA 4PYPA 4D2CA 4GS7A 4TPJA 2GMFA 1GA3A 4IU9A 5C65A 1I1RB 1EMRA 5GXBA 3N06A 1HZIA 3NPZA 2CFPA 4A3DD 4U4VA 4LEPA 3HOZD 1D9GA 3UF5A 1EKUA 4NN7A 3OG4A 1M4AA 4IKXA 5C44D 3HOYD 4Q65A 3EJJA 1M4BA 5C7XA 4A93D 1Z92A 3LB6B 2Q14A 4LRLA 5D22A 2B8UA 2Z3QA 4QIQA 1IARA 3INKC 5EQGA 1HULA 4NI7A 5D6KA 4BXXD 3G9VB 3IRHA 1AX8A 1ALUA 3PO3D 4XNJA 1V7NV 2ERJD 1RFBA 3QAZA 4EXPA 2B8ZA 3HOXD 3HHRA 4A3ED 1BGDA 1RHGA 4BBRD 4O6KA 1FYHA 3QWRB 1M4RA 4NI9A 1ITLA 1PY2A 2B91A 1J7VL 2B8YA 3HHCA 5D70A 1HIJA 2D48A 3AYHA 3VA2A 1EXZA 4ZW9A 3H0GD 1IK0A 2R7ZD 4A3MD 2PSMA 5D71A 4PS4A 4YB9D 3OQ3A 4DKFA 5IYDD 5E4EA 3BESL 3FKID 4GRWA 4YBQA 4ZF7A 5D59A 3S9DA 1Y14A 3I4MD 3UX9A 4DKDA 1BCNA 3D85C 4GBZA 1CN4C 3L5XA 1GNCA 4ZWCA 4APSA 1WCMD 5TS9A 2H24A 4IKZA 4X51A 1F45B 3L5WI 4BY7D 5D58A 1EERA 3Q1SI 3HOUD 1IRLA 1YKBA 5A2OA 4YUEC 2LAGA 1M4CA 4OAAA 4A3CD 2CYKA 1ILKA 1HWHA 4YPGC 3HOVD 4IKVA 3SE3B 4YDYI 1N1FA 3PIWA 4CNIC 4ZYRA 2O26A 4IKYA 3O7QA 4ZS7A 3UEZE 3DGCL 3QB7A 5IP9D 4JA3A 4MHLA 1AU1A 2B5IA 1ITFA 2B63D 4UVMA 5KNHI 4DKCA 4EXNA 4FA8E 1Y6ML 1RW5A 2Z3RA 2L3YA 1CNT1 2Y5YA 5A2NA 1EVSA 1HGUA 2CFQA 3N0PA 5C3ED 2KZ1A 2OQPA 3DI2A 4DKEA 3NCCA 4JREA 3EW3A 4NN5A 1LKIA 3I4ND 3O7PA 2E9WC 5FUCA 4GBYA 4BBSD 3DLQI 4U4TA 1IL6A 4J05A 2Q7NB 1PW4A 1PGRA 1BBNA 1Z7CA 3DUHC 4Z5RD 3MZGA 1Y1WD 4WRLB 3WDOA 3UF2A 5C4XD 1M49A 1BGEA 4XNIA 1Y6KL 2D9QA 2JA5D 1PVHB 2R92D 2JA7D 5IP7D 4BY1D 1M47A 1HIKA 1D9CA 1PV7A 3D87A 4RS1A 5FLMD 1SCFA 5D72A 4TPHA 1CYLA 4IU8A 5EQHA 3QB1A 1BGCA 1A7MA 4A3ID 2XUTA 3G6DA 4GC0A 4JR9A 4U4WA 1NBPA 3OG6A 2O6IA 1ITMA 3HOWD 2C35A 3PO2D 3SE4B 3NCBA 1ITIA 3LB6A 2B8XA 1Y1VD 4ZWBA 4W6VA 2INTA 5IYCD 1B5LA 1PV6A 2XQBA 2JA8D 3H3VE 2LMSA 3B5KA 1BUYA 4A3JD 5EQIA 1LK3A 1FG9A 3QT2C 4DOHA 2IL6A 5IYBD 2B90A 1P9MB 4OH3A 1CSGA 4A3BD 4A3FD 4A3KD 1JLIA 4O9HA 1HUWA 1VLKA 4A3LD 5L6YC 1PW6A 1HWGA 3HMXB
chains in the Genus database with same CATH topology
4WRLB 3INKC 3UF2A 3SE3B 1INRA 4YDYI 1N1FA 1HULA 4NI7A 1M48A 5LQBA 5C4XD 3PIWA 1M49A 1BGEA 4CNIC 1KF9A 1CD9A 2O26A 4BXXD 3BPOA 1Y6KL 1AXIA 3G9VB 3IRHA 4NEMA 1AX8A 2D9QA 3NCFA 2O27A 3D48P 2JA5D 1PVHB 3TGXB 4ZS7A 2R92D 4A3GD 2JA7D 1ALUA 5IP7D 3PO3D 3BPNA 1QVNA 1M47A 1V7NV 2ERJD 3UEZE 4BY1D 1RFBA 1HIKA 3QAZA 3DGCL 3QB7A 5IP9D 4EXPA 1D9CA 2JA6D 3D87A 2B8ZA 4MHLA 4RS1A 1RCBA 5FLMD 1SCFA 4NKQC 3HHRA 3HOXD 2ILKA 5D72A 4A3ED 1AU1A 2B5IA 1BGDA 1ITFA 1CYLA 2R93D 1RHGA 4BBRD 1Y6NL 2B63D 4O6KA 1WU3I 3QB1A 1FYHA 1IJZA 4YQXA 4DKCA 4EXNA 5KNHI 3QWRB 1BGCA 1A7MA 1M4RA 3PIVA 4NI9A 3NCEA 3WCYI 4FA8E 1Y6ML 1RW5A 1ITLA 1PY2A 2Z3RA 4A3ID 2B91A 2Q98A 2VUMD 3HOVD 1A22A 2L3YA 1J7VL 3G6DA 2B8YA 1F6FA 1NBPA 1CNT1 3OG6A 4NEJA 2HYMB 2O6IA 1ITMA 3HHCA 4I77Z 3BPLA 1EVSA 1HGUA 5D70A 3HOWD 5FHXA 1HIJA 2D48A 2L3OA 2C35A 3AYHA 3PO2D 3DI3A 3SE4B 3NCBA 1V7MV 3N0PA 4NN6A 5D28B 5C3ED 1BP3A 3VA2A 1EXZA 1ITIA 3LB6A 3H0GD 2KZ1A 1LQSL 2B8XA 1IK0A 4J4LC 1Y1VD 2R7ZD 1ETEA 2OQPA 4A3MD 2PSMA 3DI2A 5D71A 4GS7A 4PS4A 4DKEA 3NCCA 2GMFA 3OQ3A 4DKFA 2INTA 5IYCD 3EW3A 5IYDD 1B5LA 4NN5A 2XQBA 5E4EA 2JA8D 1GA3A 1LKIA 3I4ND 2E9WC 3BESL 3H3VE 2LMSA 3B5KA 5FUCA 1BUYA 3FKID 4BBSD 4A3JD 1I1RB 4GRWA 1LK3A 1FG9A 4ZF7A 1EMRA 3N06A 3S9DA 3I4MD 1Y14A 1HZIA 3UX9A 3NPZA 4DKDA 4A3DD 3QT2C 1BCNA 3D85C 1CN4C 3DLQI 3L5XA 3HOZD 4DOHA 1GNCA 1D9GA 2IL6A 1WCMD 5TS9A 5IYBD 2B90A 3MZGA 2H24A 3UF5A 1EKUA 1P9MB 1IL6A 4X51A 1F45B 4NN7A 1CSGA 3L5WI 4A3BD 4A3FD 3OG4A 4A3KD 4BY7D 1JLIA 1EERA 3Q1SI 1M4AA 3HOUD 1IRLA 1ILKA 5C44D 3HOYD 1YKBA 4O9HA 1HUWA 1VLKA 3EJJA 1M4BA 4A3LD 2Q7NB 5C7XA 4A93D 1Z92A 1PGRA 3LB6B 2Q14A 4LRLA 1BBNA 4YUEC 5D22A 1Z7CA 2LAGA 5L6YC 1M4CA 3DUHC 2B8UA 4A3CD 4Z5RD 2CYKA 1PW6A 1HWGA 1HWHA 1IARA 2Z3QA 4YPGC 3HMXB 1Y1WD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WRL B;  3INK C;  3UF2 A;  3SE3 B;  1INR A;  4YDY I;  1N1F A;  1HUL A;  4NI7 A;  1M48 A;  5LQB A;  3PIW A;  1M49 A;  1BGE A;  4CNI C;  1KF9 A;  1CD9 A;  2O26 A;  3BPO A;  1Y6K L;  1AXI A;  3G9V B;  4NEM A;  1AX8 A;  2D9Q A;  3NCF A;  2O27 A;  3D48 P;  1PVH B;  4ZS7 A;  1ALU A;  3BPN A;  1QVN A;  1M47 A;  1V7N V;  2ERJ D;  3UEZ E;  1RFB A;  1HIK A;  3QAZ A;  3DGC L;  3QB7 A;  1D9C A;  3D87 A;  2B8Z A;  4MHL A;  4RS1 A;  1RCB A;  1SCF A;  4NKQ C;  3HHR A;  2ILK A;  5D72 A;  1AU1 A;  2B5I A;  1BGD A;  1ITF A;  1CYL A;  1RHG A;  1Y6N L;  4O6K A;  1WU3 I;  3QB1 A;  1FYH A;  1IJZ A;  4YQX A;  5KNH I;  3QWR B;  1BGC A;  1A7M A;  1M4R A;  3PIV A;  4NI9 A;  3NCE A;  3WCY I;  4FA8 E;  1Y6M L;  1RW5 A;  1ITL A;  1PY2 A;  2B91 A;  2Q98 A;  1A22 A;  2L3Y A;  1J7V L;  3G6D A;  2B8Y A;  1F6F A;  1NBP A;  1CNT 1;  4NEJ A;  2HYM B;  1ITM A;  4I77 Z;  3BPL A;  1EVS A;  1HGU A;  5D70 A;  5FHX A;  1HIJ A;  2D48 A;  2L3O A;  3SE4 B;  3NCB A;  1V7M V;  3N0P A;  5D28 B;  1BP3 A;  3VA2 A;  1EXZ A;  1ITI A;  3LB6 A;  2KZ1 A;  1LQS L;  2B8X A;  1IK0 A;  4J4L C;  1ETE A;  5D71 A;  4PS4 A;  3NCC A;  2GMF A;  3OQ3 A;  2INT A;  3EW3 A;  1GA3 A;  1B5L A;  5E4E A;  1LKI A;  2E9W C;  3BES L;  2LMS A;  3B5K A;  5FUC A;  1BUY A;  1I1R B;  4GRW A;  1LK3 A;  1FG9 A;  4ZF7 A;  1EMR A;  3N06 A;  3S9D A;  1HZI A;  3UX9 A;  3NPZ A;  3QT2 C;  1BCN A;  3D85 C;  1CN4 C;  3DLQ I;  3L5X A;  1GNC A;  4DOH A;  1D9G A;  2IL6 A;  2B90 A;  3MZG A;  2H24 A;  3UF5 A;  1EKU A;  1P9M B;  1IL6 A;  4X51 A;  1F45 B;  1CSG A;  3L5W I;  1JLI A;  1EER A;  3Q1S I;  1M4A A;  1IRL A;  1ILK A;  1YKB A;  4O9H A;  1HUW A;  1VLK A;  3EJJ A;  1M4B A;  2Q7N B;  5C7X A;  1Z92 A;  1PGR A;  3LB6 B;  1BBN A;  4YUE C;  5D22 A;  1Z7C A;  2LAG A;  5L6Y C;  1M4C A;  3DUH C;  2B8U A;  4Z5R D;  2CYK A;  1PW6 A;  1HWG A;  1HWH A;  1IAR A;  4YPG C;  3HMX B; 
#chains in the Genus database with same CATH topology
 2V8N A;  1INR A;  1M48 A;  5LQB A;  1KF9 A;  1CD9 A;  3BPO A;  1AXI A;  4IKW A;  4NEM A;  3NCF A;  2O27 A;  3D48 P;  3TGX B;  4D2B A;  4A3G D;  3BPN A;  1QVN A;  2JA6 D;  1RCB A;  4NKQ C;  2ILK A;  2R93 D;  1Y6N L;  1WU3 I;  1IJZ A;  4YQX A;  3PIV A;  3NCE A;  3WCY I;  2Q98 A;  2VUM D;  4LDS A;  1A22 A;  1F6F A;  4NEJ A;  2HYM B;  4I77 Z;  3BPL A;  5FHX A;  2L3O A;  3DI3 A;  1V7M V;  4NN6 A;  5D28 B;  1BP3 A;  4TPG A;  4D2D A;  1LQS L;  4J4L C;  1ETE A;  4PYP A;  4D2C A;  4GS7 A;  4TPJ A;  2GMF A;  1GA3 A;  4IU9 A;  5C65 A;  1I1R B;  1EMR A;  5GXB A;  3N06 A;  1HZI A;  3NPZ A;  2CFP A;  4A3D D;  4U4V A;  4LEP A;  3HOZ D;  1D9G A;  3UF5 A;  1EKU A;  4NN7 A;  3OG4 A;  1M4A A;  4IKX A;  5C44 D;  3HOY D;  4Q65 A;  3EJJ A;  1M4B A;  5C7X A;  4A93 D;  1Z92 A;  3LB6 B;  2Q14 A;  4LRL A;  5D22 A;  2B8U A;  2Z3Q A;  4QIQ A;  1IAR A;  3INK C;  5EQG A;  1HUL A;  4NI7 A;  5D6K A;  4BXX D;  3G9V B;  3IRH A;  1AX8 A;  1ALU A;  3PO3 D;  4XNJ A;  1V7N V;  2ERJ D;  1RFB A;  3QAZ A;  4EXP A;  2B8Z A;  3HOX D;  3HHR A;  4A3E D;  1BGD A;  1RHG A;  4BBR D;  4O6K A;  1FYH A;  3QWR B;  1M4R A;  4NI9 A;  1ITL A;  1PY2 A;  2B91 A;  1J7V L;  2B8Y A;  3HHC A;  5D70 A;  1HIJ A;  2D48 A;  3AYH A;  3VA2 A;  1EXZ A;  4ZW9 A;  3H0G D;  1IK0 A;  2R7Z D;  4A3M D;  2PSM A;  5D71 A;  4PS4 A;  4YB9 D;  3OQ3 A;  4DKF A;  5IYD D;  5E4E A;  3BES L;  3FKI D;  4GRW A;  4YBQ A;  4ZF7 A;  5D59 A;  3S9D A;  1Y14 A;  3I4M D;  3UX9 A;  4DKD A;  1BCN A;  3D85 C;  4GBZ A;  1CN4 C;  3L5X A;  1GNC A;  4ZWC A;  4APS A;  1WCM D;  5TS9 A;  2H24 A;  4IKZ A;  4X51 A;  1F45 B;  3L5W I;  4BY7 D;  5D58 A;  1EER A;  3Q1S I;  3HOU D;  1IRL A;  1YKB A;  5A2O A;  4YUE C;  2LAG A;  1M4C A;  4OAA A;  4A3C D;  2CYK A;  1ILK A;  1HWH A;  4YPG C;  3HOV D;  4IKV A;  3SE3 B;  4YDY I;  1N1F A;  3PIW A;  4CNI C;  4ZYR A;  2O26 A;  4IKY A;  3O7Q A;  4ZS7 A;  3UEZ E;  3DGC L;  3QB7 A;  5IP9 D;  4JA3 A;  4MHL A;  1AU1 A;  2B5I A;  1ITF A;  2B63 D;  4UVM A;  5KNH I;  4DKC A;  4EXN A;  4FA8 E;  1Y6M L;  1RW5 A;  2Z3R A;  2L3Y A;  1CNT 1;  2Y5Y A;  5A2N A;  1EVS A;  1HGU A;  2CFQ A;  3N0P A;  5C3E D;  2KZ1 A;  2OQP A;  3DI2 A;  4DKE A;  3NCC A;  4JRE A;  3EW3 A;  4NN5 A;  1LKI A;  3I4N D;  3O7P A;  2E9W C;  5FUC A;  4GBY A;  4BBS D;  3DLQ I;  4U4T A;  1IL6 A;  4J05 A;  2Q7N B;  1PW4 A;  1PGR A;  1BBN A;  1Z7C A;  3DUH C;  4Z5R D;  3MZG A;  1Y1W D;  4WRL B;  3WDO A;  3UF2 A;  5C4X D;  1M49 A;  1BGE A;  4XNI A;  1Y6K L;  2D9Q A;  2JA5 D;  1PVH B;  2R92 D;  2JA7 D;  5IP7 D;  4BY1 D;  1M47 A;  1HIK A;  1D9C A;  1PV7 A;  3D87 A;  4RS1 A;  5FLM D;  1SCF A;  5D72 A;  4TPH A;  1CYL A;  4IU8 A;  5EQH A;  3QB1 A;  1BGC A;  1A7M A;  4A3I D;  2XUT A;  3G6D A;  4GC0 A;  4JR9 A;  4U4W A;  1NBP A;  3OG6 A;  2O6I A;  1ITM A;  3HOW D;  2C35 A;  3PO2 D;  3SE4 B;  3NCB A;  1ITI A;  3LB6 A;  2B8X A;  1Y1V D;  4ZWB A;  4W6V A;  2INT A;  5IYC D;  1B5L A;  1PV6 A;  2XQB A;  2JA8 D;  3H3V E;  2LMS A;  3B5K A;  1BUY A;  4A3J D;  5EQI A;  1LK3 A;  1FG9 A;  3QT2 C;  4DOH A;  2IL6 A;  5IYB D;  2B90 A;  1P9M B;  4OH3 A;  1CSG A;  4A3B D;  4A3F D;  4A3K D;  1JLI A;  4O9H A;  1HUW A;  1VLK A;  4A3L D;  5L6Y C;  1PW6 A;  1HWG A;  3HMX B; 
#chains in the Genus database with same CATH homology
 4WRL B;  3INK C;  3UF2 A;  3SE3 B;  1INR A;  4YDY I;  1N1F A;  1HUL A;  4NI7 A;  1M48 A;  5LQB A;  5C4X D;  3PIW A;  1M49 A;  1BGE A;  4CNI C;  1KF9 A;  1CD9 A;  2O26 A;  4BXX D;  3BPO A;  1Y6K L;  1AXI A;  3G9V B;  3IRH A;  4NEM A;  1AX8 A;  2D9Q A;  3NCF A;  2O27 A;  3D48 P;  2JA5 D;  1PVH B;  3TGX B;  4ZS7 A;  2R92 D;  4A3G D;  2JA7 D;  1ALU A;  5IP7 D;  3PO3 D;  3BPN A;  1QVN A;  1M47 A;  1V7N V;  2ERJ D;  3UEZ E;  4BY1 D;  1RFB A;  1HIK A;  3QAZ A;  3DGC L;  3QB7 A;  5IP9 D;  4EXP A;  1D9C A;  2JA6 D;  3D87 A;  2B8Z A;  4MHL A;  4RS1 A;  1RCB A;  5FLM D;  1SCF A;  4NKQ C;  3HHR A;  3HOX D;  2ILK A;  5D72 A;  4A3E D;  1AU1 A;  2B5I A;  1BGD A;  1ITF A;  1CYL A;  2R93 D;  1RHG A;  4BBR D;  1Y6N L;  2B63 D;  4O6K A;  1WU3 I;  3QB1 A;  1FYH A;  1IJZ A;  4YQX A;  4DKC A;  4EXN A;  5KNH I;  3QWR B;  1BGC A;  1A7M A;  1M4R A;  3PIV A;  4NI9 A;  3NCE A;  3WCY I;  4FA8 E;  1Y6M L;  1RW5 A;  1ITL A;  1PY2 A;  2Z3R A;  4A3I D;  2B91 A;  2Q98 A;  2VUM D;  3HOV D;  1A22 A;  2L3Y A;  1J7V L;  3G6D A;  2B8Y A;  1F6F A;  1NBP A;  1CNT 1;  3OG6 A;  4NEJ A;  2HYM B;  2O6I A;  1ITM A;  3HHC A;  4I77 Z;  3BPL A;  1EVS A;  1HGU A;  5D70 A;  3HOW D;  5FHX A;  1HIJ A;  2D48 A;  2L3O A;  2C35 A;  3AYH A;  3PO2 D;  3DI3 A;  3SE4 B;  3NCB A;  1V7M V;  3N0P A;  4NN6 A;  5D28 B;  5C3E D;  1BP3 A;  3VA2 A;  1EXZ A;  1ITI A;  3LB6 A;  3H0G D;  2KZ1 A;  1LQS L;  2B8X A;  1IK0 A;  4J4L C;  1Y1V D;  2R7Z D;  1ETE A;  2OQP A;  4A3M D;  2PSM A;  3DI2 A;  5D71 A;  4GS7 A;  4PS4 A;  4DKE A;  3NCC A;  2GMF A;  3OQ3 A;  4DKF A;  2INT A;  5IYC D;  3EW3 A;  5IYD D;  1B5L A;  4NN5 A;  2XQB A;  5E4E A;  2JA8 D;  1GA3 A;  1LKI A;  3I4N D;  2E9W C;  3BES L;  3H3V E;  2LMS A;  3B5K A;  5FUC A;  1BUY A;  3FKI D;  4BBS D;  4A3J D;  1I1R B;  4GRW A;  1LK3 A;  1FG9 A;  4ZF7 A;  1EMR A;  3N06 A;  3S9D A;  3I4M D;  1Y14 A;  1HZI A;  3UX9 A;  3NPZ A;  4DKD A;  4A3D D;  3QT2 C;  1BCN A;  3D85 C;  1CN4 C;  3DLQ I;  3L5X A;  3HOZ D;  4DOH A;  1GNC A;  1D9G A;  2IL6 A;  1WCM D;  5TS9 A;  5IYB D;  2B90 A;  3MZG A;  2H24 A;  3UF5 A;  1EKU A;  1P9M B;  1IL6 A;  4X51 A;  1F45 B;  4NN7 A;  1CSG A;  3L5W I;  4A3B D;  4A3F D;  3OG4 A;  4A3K D;  4BY7 D;  1JLI A;  1EER A;  3Q1S I;  1M4A A;  3HOU D;  1IRL A;  1ILK A;  5C44 D;  3HOY D;  1YKB A;  4O9H A;  1HUW A;  1VLK A;  3EJJ A;  1M4B A;  4A3L D;  2Q7N B;  5C7X A;  4A93 D;  1Z92 A;  1PGR A;  3LB6 B;  2Q14 A;  4LRL A;  1BBN A;  4YUE C;  5D22 A;  1Z7C A;  2LAG A;  5L6Y C;  1M4C A;  3DUH C;  2B8U A;  4A3C D;  4Z5R D;  2CYK A;  1PW6 A;  1HWG A;  1HWH A;  1IAR A;  2Z3Q A;  4YPG C;  3HMX B;  1Y1W D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...