4NI9A

Crystal structure of human interleukin 6 in complex with a modified nucleotide aptamer (somamer sl1025), form 2
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
171
structure length
144
Chain Sequence
b'PHRQPLTSSERIDKQIRYILDGISALRKETNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SOMAmer SL1025
publication title Crystal structure of interleukin-6 in complex with a modified nucleic Acid ligand.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/dna
total genus 46
structure length 144
sequence length 171
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-11-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1250.10 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; Growth Hormone; Chain: A; 4ni9A00
1CD9A 4Z5RD 2Q98A 1M49A 1IL6A 3EJJA 2B90A 2GMFA 1HUWA 4NEJA 1CSGA 5FHXA 1CYLA 4YPGC 5D71A 2KZ1A 3SE4B 3Q1SI 1IJZA 3S9DA 2D9QA 2ERJD 3NCEA 3DLQI 3B5KA 1KF9A 3NPZA 3N06A 1AXIA 2B8XA 2LAGA 2IL6A 2B8UA 1FYHA 1IK0A 3SE3B 3QB7A 1BCNA 1ILKA 2B8YA 1BGEA 3QAZA 1GNCA 1BGCA 1I1RB 3DUHC 1BP3A 1BUYA 4RS1A 1N1FA 4NI7A 1WU3I 2B8ZA 1PGRA 1CNT1 2INTA 1V7MV 3BESL 1Z7CA 4CNIC 4ZS7A 1RFBA 1D9GA 1ITMA 4YUEC 1LQSL 1D9CA 4YDYI 2CYKA 1ALUA 1EMRA 3L5XA 4MHLA 1B5LA 4NKQC 2Q7NB 1AX8A 1Y6KL 1RHGA 5D28B 3EW3A 1PVHB 1ITFA 4YQXA 3BPNA 1HWGA 2O26A 1M4CA 3PIVA 1A7MA 3INKC 2D48A 3PIWA 3DGCL 3HMXB 5C7XA 3D87A 1EXZA 1HZIA 3OQ3A 1J7VL 4GRWA 4WRLB 3BPOA 5D72A 1M48A 1Y6NL 2L3OA 1LKIA 1V7NV 5LQBA 3LB6A 2O27A 3G6DA 3NCFA 4PS4A 3QT2C 1JLIA 1SCFA 1HULA 1F45B 1QVNA 2B91A 2H24A 5D70A 3WCYI 2HYMB 3G9VB 4O6KA 1NBPA 1GA3A 2L3YA 1ETEA 3BPLA 1FG9A 1YKBA 1LK3A 3LB6B 3QWRB 5FUCA 5KNHI 1IARA 1EERA 1M4RA 4DOHA 4FA8E 1IRLA 3NCBA 1HIJA 5D22A 1EKUA 1RCBA 3UF5A 2LMSA 1A22A 5E4EA 2E9WC 1ITIA 1F6FA 1EVSA 3VA2A 3L5WI 4NI9A 4NEMA 3N0PA 3MZGA 3NCCA 3D85C 2ILKA 3UEZE 1PW6A 3QB1A 3HHRA 3UF2A 1BBNA 1AU1A 1M4AA 1P9MB 1HIKA 1M4BA 4O9HA 1BGDA 1ITLA 1M47A 1Z92A 1INRA 1HGUA 4J4LC 3UX9A 4ZF7A 5L6YC 1RW5A 4X51A 1VLKA 4I77Z 3D48P 1CN4C 1Y6ML 2B5IA 1HWHA 1PY2A
chains in the Genus database with same CATH superfamily
1CD9A 4A3KD 2Q98A 3DI3A 1IL6A 1CSGA 4YPGC 3SE4B 1IJZA 1Y14A 4GBYA 3PO2D 3B5KA 3I4ND 1KF9A 4D2CA 4BBSD 4BXXD 1IK0A 2B8UA 1FYHA 3SE3B 3QB7A 3QAZA 1BGCA 4NI7A 5FLMD 1WU3I 3IRHA 1CNT1 4A3JD 4ZW9A 1V7MV 3HOYD 4CNIC 1RFBA 1ITMA 4DKCA 1ALUA 3L5XA 4J05A 3DI2A 2Q7NB 1Y6KL 4NN6A 1RHGA 1ITFA 1HWGA 1A7MA 5C7XA 2D48A 2JA8D 1HZIA 1M48A 1V7NV 5IYBD 4DKFA 2CFQA 1JLIA 1SCFA 2H24A 3WCYI 2HYMB 3G9VB 1GA3A 1NBPA 5IP9D 2L3YA 5C4XD 4OAAA 4IKZA 3H0GD 4JA3A 3UF5A 5D59A 1EVSA 3HOZD 3L5WI 1Y1WD 3O7PA 3NCCA 4A3BD 3HHRA 1BBNA 1P9MB 1M4BA 4O9HA 1BGDA 1ITLA 1M47A 4U4VA 1RW5A 4I77Z 3I4MD 3D48P 1CN4C 4GS7A 4YUEC 1PY2A 3FKID 5C65A 4Z5RD 2B90A 2GMFA 1HUWA 4NEJA 3OG6A 4A3DD 4BY7D 2ERJD 3NCEA 3DLQI 5EQGA 5C3ED 4ZYRA 1BCNA 3HOXD 1BGEA 1GNCA 4LEPA 1I1RB 5D6KA 2B63D 3DUHC 4A3FD 1BP3A 2C35A 1N1FA 5C44D 4OH3A 3BESL 4ZS7A 5TS9A 1LQSL 4JREA 1EMRA 1B5LA 5EQHA 3HOVD 5D28B 1PVHB 1M4CA 4IU9A 3DGCL 1EXZA 4NN5A 2L3OA 5IP7D 2O27A 3G6DA 4PS4A 4DKEA 1QVNA 1F45B 1ETEA 1FG9A 3LB6B 3QWRB 5KNHI 1IARA 1M4RA 4DOHA 4A3ED 5A2OA 5EQIA 1EKUA 1RCBA 4EXPA 2LMSA 2E9WC 1ITIA 1F6FA 2Z3RA 3TGXB 4NEMA 4EXNA 3D85C 3QB1A 4YBQA 1HIKA 1PW4A 2Q14A 4GRWA 4BY1D 5A2NA 4Q65A 3EJJA 1CYLA 2D9QA 2Z3QA 4TPJA 3NPZA 1AXIA 2LAGA 2IL6A 1ILKA 5D58A 4A3MD 4RS1A 4GC0A 4PYPA 1D9GA 1D9CA 2CYKA 1AX8A 2CFPA 3EW3A 3BPNA 5IYDD 2O26A 3PIVA 3PIWA 5GXBA 3HMXB 3WDOA 3OQ3A 4W6VA 3BPOA 1Y6NL 2R7ZD 1LKIA 3LB6A 3HOWD 3NCFA 4IU8A 4D2DA 1HULA 2B91A 4UVMA 4FA8E 1IRLA 3OG4A 4A3ID 3NCBA 1HIJA 1PV6A 5D22A 3O7QA 1A22A 1WCMD 1Y1VD 3N0PA 2ILKA 3UEZE 1PW6A 3UF2A 1INRA 4LDSA 4NN7A 2Y5YA 5L6YC 4X51A 1VLKA 4ZWCA 1Y6ML 2B5IA 2XQBA 2R93D 1M49A 2JA7D 4A3CD 5FHXA 5D71A 2KZ1A 3Q1SI 3S9DA 4LRLA 3H3VE 3N06A 4TPHA 2B8XA 4TPGA 1PV7A 4GBZA 2V8NA 2B8YA 2O6IA 4YB9D 3HOUD 1BUYA 3PO3D 4XNIA 2B8ZA 1PGRA 2INTA 1Z7CA 2OQPA 3HHCA 4YDYI 4XNJA 4MHLA 4NKQC 4ZWBA 4YQXA 2VUMD 2PSMA 4U4TA 3INKC 5IYCD 3D87A 4BBRD 1J7VL 4WRLB 4DKDA 5D72A 3QT2C 4IKYA 5D70A 4O6KA 4APSA 3BPLA 3AYHA 4QIQA 2JA5D 1YKBA 1LK3A 4A3GD 5FUCA 1EERA 4U4WA 4JR9A 2R92D 5E4EA 4IKVA 3VA2A 2XUTA 4NI9A 4A3LD 3MZGA 4IKXA 2JA6D 1M4AA 1AU1A 1Z92A 1HGUA 4J4LC 3UX9A 4ZF7A 4IKWA 4A93D 4D2BA 5LQBA 1HWHA
chains in the Genus database with same CATH topology
1CD9A 4A3KD 4Z5RD 2Q98A 4BY1D 1M49A 3DI3A 1IL6A 3EJJA 2JA7D 2B90A 4A3CD 2GMFA 1HUWA 4NEJA 1CSGA 5FHXA 1CYLA 4YPGC 5D71A 2KZ1A 3OG6A 3SE4B 4A3DD 3Q1SI 1IJZA 3S9DA 4BY7D 2D9QA 2ERJD 1Y14A 3NCEA 2Z3QA 3DLQI 3B5KA 4LRLA 3PO2D 3H3VE 3I4ND 5C3ED 1KF9A 4BBSD 3NPZA 3N06A 1AXIA 2B8XA 2LAGA 4BXXD 2IL6A 2B8UA 1FYHA 1IK0A 3SE3B 3QB7A 1BCNA 1ILKA 3HOXD 2B8YA 1BGEA 2O6IA 3QAZA 1BGCA 1I1RB 4A3MD 2B63D 1GNCA 3DUHC 4A3FD 3HOUD 1BP3A 2C35A 1BUYA 4RS1A 1N1FA 4NI7A 5FLMD 3PO3D 1WU3I 3IRHA 2B8ZA 5C44D 1PGRA 1CNT1 2INTA 4A3JD 1V7MV 3BESL 3HOYD 1Z7CA 4CNIC 4ZS7A 1RFBA 1D9GA 2OQPA 3HHCA 1ITMA 5TS9A 4YUEC 4DKCA 1LQSL 1D9CA 4YDYI 2CYKA 1ALUA 1EMRA 3L5XA 4MHLA 1B5LA 4NKQC 2R93D 3DI2A 2Q7NB 1AX8A 1Y6KL 4NN6A 3HOVD 1RHGA 5D28B 3EW3A 1PVHB 1ITFA 4YQXA 2VUMD 3BPNA 2PSMA 5IYDD 1HWGA 2O26A 1M4CA 3PIVA 1A7MA 3INKC 2D48A 3PIWA 3DGCL 3HMXB 5C7XA 5IYCD 3D87A 1EXZA 4BBRD 2JA8D 1HZIA 3OQ3A 1J7VL 4GRWA 4NN5A 4WRLB 3BPOA 4DKDA 5D72A 1M48A 1Y6NL 2L3OA 5IP7D 2R7ZD 1LKIA 1V7NV 5LQBA 3LB6A 5IYBD 2O27A 3HOWD 3G6DA 3NCFA 4DKFA 4PS4A 3QT2C 4DKEA 1JLIA 1SCFA 1HULA 1F45B 1QVNA 2B91A 2H24A 5D70A 3WCYI 2HYMB 3G9VB 4O6KA 1NBPA 5IP9D 1GA3A 2L3YA 1ETEA 3BPLA 5C4XD 3AYHA 1FG9A 2JA5D 1YKBA 1LK3A 3LB6B 3QWRB 4A3GD 5FUCA 5KNHI 1IARA 1EERA 1M4RA 4DOHA 4A3ED 3H0GD 4FA8E 1IRLA 3OG4A 2R92D 4A3ID 3NCBA 1HIJA 5D22A 1EKUA 1RCBA 3UF5A 2LMSA 1A22A 4EXPA 1WCMD 1Y1VD 5E4EA 2E9WC 1ITIA 1F6FA 1EVSA 2Z3RA 3VA2A 3HOZD 3L5WI 3TGXB 1Y1WD 4NI9A 4NEMA 3N0PA 4A3LD 3MZGA 3NCCA 3D85C 4EXNA 2ILKA 3UEZE 1PW6A 4A3BD 3QB1A 3HHRA 3UF2A 2JA6D 1BBNA 1AU1A 1M4AA 1P9MB 1HIKA 1M4BA 4O9HA 1BGDA 1ITLA 1M47A 1Z92A 1INRA 1HGUA 4J4LC 3UX9A 4ZF7A 4NN7A 5L6YC 1RW5A 4X51A 1VLKA 4A93D 4I77Z 3I4MD 3D48P 1CN4C 2Q14A 4GS7A 1Y6ML 2B5IA 2XQBA 1HWHA 1PY2A 3FKID
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CD9 A;  4Z5R D;  2Q98 A;  1M49 A;  1IL6 A;  3EJJ A;  2B90 A;  2GMF A;  1HUW A;  4NEJ A;  1CSG A;  5FHX A;  1CYL A;  4YPG C;  5D71 A;  2KZ1 A;  3SE4 B;  3Q1S I;  1IJZ A;  3S9D A;  2D9Q A;  2ERJ D;  3NCE A;  3DLQ I;  3B5K A;  1KF9 A;  3NPZ A;  3N06 A;  1AXI A;  2B8X A;  2LAG A;  2IL6 A;  2B8U A;  1FYH A;  1IK0 A;  3SE3 B;  3QB7 A;  1BCN A;  1ILK A;  2B8Y A;  1BGE A;  3QAZ A;  1GNC A;  1BGC A;  1I1R B;  3DUH C;  1BP3 A;  1BUY A;  4RS1 A;  1N1F A;  4NI7 A;  1WU3 I;  2B8Z A;  1PGR A;  1CNT 1;  2INT A;  1V7M V;  3BES L;  1Z7C A;  4CNI C;  4ZS7 A;  1RFB A;  1D9G A;  1ITM A;  4YUE C;  1LQS L;  1D9C A;  4YDY I;  2CYK A;  1ALU A;  1EMR A;  3L5X A;  4MHL A;  1B5L A;  4NKQ C;  2Q7N B;  1AX8 A;  1Y6K L;  1RHG A;  5D28 B;  3EW3 A;  1PVH B;  1ITF A;  4YQX A;  3BPN A;  1HWG A;  2O26 A;  1M4C A;  3PIV A;  1A7M A;  3INK C;  2D48 A;  3PIW A;  3DGC L;  3HMX B;  5C7X A;  3D87 A;  1EXZ A;  1HZI A;  3OQ3 A;  1J7V L;  4GRW A;  4WRL B;  3BPO A;  5D72 A;  1M48 A;  1Y6N L;  2L3O A;  1LKI A;  1V7N V;  5LQB A;  3LB6 A;  2O27 A;  3G6D A;  3NCF A;  4PS4 A;  3QT2 C;  1JLI A;  1SCF A;  1HUL A;  1F45 B;  1QVN A;  2B91 A;  2H24 A;  5D70 A;  3WCY I;  2HYM B;  3G9V B;  4O6K A;  1NBP A;  1GA3 A;  2L3Y A;  1ETE A;  3BPL A;  1FG9 A;  1YKB A;  1LK3 A;  3LB6 B;  3QWR B;  5FUC A;  5KNH I;  1IAR A;  1EER A;  1M4R A;  4DOH A;  4FA8 E;  1IRL A;  3NCB A;  1HIJ A;  5D22 A;  1EKU A;  1RCB A;  3UF5 A;  2LMS A;  1A22 A;  5E4E A;  2E9W C;  1ITI A;  1F6F A;  1EVS A;  3VA2 A;  3L5W I;  4NI9 A;  4NEM A;  3N0P A;  3MZG A;  3NCC A;  3D85 C;  2ILK A;  3UEZ E;  1PW6 A;  3QB1 A;  3HHR A;  3UF2 A;  1BBN A;  1AU1 A;  1M4A A;  1P9M B;  1HIK A;  1M4B A;  4O9H A;  1BGD A;  1ITL A;  1M47 A;  1Z92 A;  1INR A;  1HGU A;  4J4L C;  3UX9 A;  4ZF7 A;  5L6Y C;  1RW5 A;  4X51 A;  1VLK A;  4I77 Z;  3D48 P;  1CN4 C;  1Y6M L;  2B5I A;  1HWH A;  1PY2 A; 
#chains in the Genus database with same CATH topology
 1CD9 A;  4A3K D;  2Q98 A;  3DI3 A;  1IL6 A;  1CSG A;  4YPG C;  3SE4 B;  1IJZ A;  1Y14 A;  4GBY A;  3PO2 D;  3B5K A;  3I4N D;  1KF9 A;  4D2C A;  4BBS D;  4BXX D;  1IK0 A;  2B8U A;  1FYH A;  3SE3 B;  3QB7 A;  3QAZ A;  1BGC A;  4NI7 A;  5FLM D;  1WU3 I;  3IRH A;  1CNT 1;  4A3J D;  4ZW9 A;  1V7M V;  3HOY D;  4CNI C;  1RFB A;  1ITM A;  4DKC A;  1ALU A;  3L5X A;  4J05 A;  3DI2 A;  2Q7N B;  1Y6K L;  4NN6 A;  1RHG A;  1ITF A;  1HWG A;  1A7M A;  5C7X A;  2D48 A;  2JA8 D;  1HZI A;  1M48 A;  1V7N V;  5IYB D;  4DKF A;  2CFQ A;  1JLI A;  1SCF A;  2H24 A;  3WCY I;  2HYM B;  3G9V B;  1GA3 A;  1NBP A;  5IP9 D;  2L3Y A;  5C4X D;  4OAA A;  4IKZ A;  3H0G D;  4JA3 A;  3UF5 A;  5D59 A;  1EVS A;  3HOZ D;  3L5W I;  1Y1W D;  3O7P A;  3NCC A;  4A3B D;  3HHR A;  1BBN A;  1P9M B;  1M4B A;  4O9H A;  1BGD A;  1ITL A;  1M47 A;  4U4V A;  1RW5 A;  4I77 Z;  3I4M D;  3D48 P;  1CN4 C;  4GS7 A;  4YUE C;  1PY2 A;  3FKI D;  5C65 A;  4Z5R D;  2B90 A;  2GMF A;  1HUW A;  4NEJ A;  3OG6 A;  4A3D D;  4BY7 D;  2ERJ D;  3NCE A;  3DLQ I;  5EQG A;  5C3E D;  4ZYR A;  1BCN A;  3HOX D;  1BGE A;  1GNC A;  4LEP A;  1I1R B;  5D6K A;  2B63 D;  3DUH C;  4A3F D;  1BP3 A;  2C35 A;  1N1F A;  5C44 D;  4OH3 A;  3BES L;  4ZS7 A;  5TS9 A;  1LQS L;  4JRE A;  1EMR A;  1B5L A;  5EQH A;  3HOV D;  5D28 B;  1PVH B;  1M4C A;  4IU9 A;  3DGC L;  1EXZ A;  4NN5 A;  2L3O A;  5IP7 D;  2O27 A;  3G6D A;  4PS4 A;  4DKE A;  1QVN A;  1F45 B;  1ETE A;  1FG9 A;  3LB6 B;  3QWR B;  5KNH I;  1IAR A;  1M4R A;  4DOH A;  4A3E D;  5A2O A;  5EQI A;  1EKU A;  1RCB A;  4EXP A;  2LMS A;  2E9W C;  1ITI A;  1F6F A;  2Z3R A;  3TGX B;  4NEM A;  4EXN A;  3D85 C;  3QB1 A;  4YBQ A;  1HIK A;  1PW4 A;  2Q14 A;  4GRW A;  4BY1 D;  5A2N A;  4Q65 A;  3EJJ A;  1CYL A;  2D9Q A;  2Z3Q A;  4TPJ A;  3NPZ A;  1AXI A;  2LAG A;  2IL6 A;  1ILK A;  5D58 A;  4A3M D;  4RS1 A;  4GC0 A;  4PYP A;  1D9G A;  1D9C A;  2CYK A;  1AX8 A;  2CFP A;  3EW3 A;  3BPN A;  5IYD D;  2O26 A;  3PIV A;  3PIW A;  5GXB A;  3HMX B;  3WDO A;  3OQ3 A;  4W6V A;  3BPO A;  1Y6N L;  2R7Z D;  1LKI A;  3LB6 A;  3HOW D;  3NCF A;  4IU8 A;  4D2D A;  1HUL A;  2B91 A;  4UVM A;  4FA8 E;  1IRL A;  3OG4 A;  4A3I D;  3NCB A;  1HIJ A;  1PV6 A;  5D22 A;  3O7Q A;  1A22 A;  1WCM D;  1Y1V D;  3N0P A;  2ILK A;  3UEZ E;  1PW6 A;  3UF2 A;  1INR A;  4LDS A;  4NN7 A;  2Y5Y A;  5L6Y C;  4X51 A;  1VLK A;  4ZWC A;  1Y6M L;  2B5I A;  2XQB A;  2R93 D;  1M49 A;  2JA7 D;  4A3C D;  5FHX A;  5D71 A;  2KZ1 A;  3Q1S I;  3S9D A;  4LRL A;  3H3V E;  3N06 A;  4TPH A;  2B8X A;  4TPG A;  1PV7 A;  4GBZ A;  2V8N A;  2B8Y A;  2O6I A;  4YB9 D;  3HOU D;  1BUY A;  3PO3 D;  4XNI A;  2B8Z A;  1PGR A;  2INT A;  1Z7C A;  2OQP A;  3HHC A;  4YDY I;  4XNJ A;  4MHL A;  4NKQ C;  4ZWB A;  4YQX A;  2VUM D;  2PSM A;  4U4T A;  3INK C;  5IYC D;  3D87 A;  4BBR D;  1J7V L;  4WRL B;  4DKD A;  5D72 A;  3QT2 C;  4IKY A;  5D70 A;  4O6K A;  4APS A;  3BPL A;  3AYH A;  4QIQ A;  2JA5 D;  1YKB A;  1LK3 A;  4A3G D;  5FUC A;  1EER A;  4U4W A;  4JR9 A;  2R92 D;  5E4E A;  4IKV A;  3VA2 A;  2XUT A;  4NI9 A;  4A3L D;  3MZG A;  4IKX A;  2JA6 D;  1M4A A;  1AU1 A;  1Z92 A;  1HGU A;  4J4L C;  3UX9 A;  4ZF7 A;  4IKW A;  4A93 D;  4D2B A;  5LQB A;  1HWH A; 
#chains in the Genus database with same CATH homology
 1CD9 A;  4A3K D;  4Z5R D;  2Q98 A;  4BY1 D;  1M49 A;  3DI3 A;  1IL6 A;  3EJJ A;  2JA7 D;  2B90 A;  4A3C D;  2GMF A;  1HUW A;  4NEJ A;  1CSG A;  5FHX A;  1CYL A;  4YPG C;  5D71 A;  2KZ1 A;  3OG6 A;  3SE4 B;  4A3D D;  3Q1S I;  1IJZ A;  3S9D A;  4BY7 D;  2D9Q A;  2ERJ D;  1Y14 A;  3NCE A;  2Z3Q A;  3DLQ I;  3B5K A;  4LRL A;  3PO2 D;  3H3V E;  3I4N D;  5C3E D;  1KF9 A;  4BBS D;  3NPZ A;  3N06 A;  1AXI A;  2B8X A;  2LAG A;  4BXX D;  2IL6 A;  2B8U A;  1FYH A;  1IK0 A;  3SE3 B;  3QB7 A;  1BCN A;  1ILK A;  3HOX D;  2B8Y A;  1BGE A;  2O6I A;  3QAZ A;  1BGC A;  1I1R B;  4A3M D;  2B63 D;  1GNC A;  3DUH C;  4A3F D;  3HOU D;  1BP3 A;  2C35 A;  1BUY A;  4RS1 A;  1N1F A;  4NI7 A;  5FLM D;  3PO3 D;  1WU3 I;  3IRH A;  2B8Z A;  5C44 D;  1PGR A;  1CNT 1;  2INT A;  4A3J D;  1V7M V;  3BES L;  3HOY D;  1Z7C A;  4CNI C;  4ZS7 A;  1RFB A;  1D9G A;  2OQP A;  3HHC A;  1ITM A;  5TS9 A;  4YUE C;  4DKC A;  1LQS L;  1D9C A;  4YDY I;  2CYK A;  1ALU A;  1EMR A;  3L5X A;  4MHL A;  1B5L A;  4NKQ C;  2R93 D;  3DI2 A;  2Q7N B;  1AX8 A;  1Y6K L;  4NN6 A;  3HOV D;  1RHG A;  5D28 B;  3EW3 A;  1PVH B;  1ITF A;  4YQX A;  2VUM D;  3BPN A;  2PSM A;  5IYD D;  1HWG A;  2O26 A;  1M4C A;  3PIV A;  1A7M A;  3INK C;  2D48 A;  3PIW A;  3DGC L;  3HMX B;  5C7X A;  5IYC D;  3D87 A;  1EXZ A;  4BBR D;  2JA8 D;  1HZI A;  3OQ3 A;  1J7V L;  4GRW A;  4NN5 A;  4WRL B;  3BPO A;  4DKD A;  5D72 A;  1M48 A;  1Y6N L;  2L3O A;  5IP7 D;  2R7Z D;  1LKI A;  1V7N V;  5LQB A;  3LB6 A;  5IYB D;  2O27 A;  3HOW D;  3G6D A;  3NCF A;  4DKF A;  4PS4 A;  3QT2 C;  4DKE A;  1JLI A;  1SCF A;  1HUL A;  1F45 B;  1QVN A;  2B91 A;  2H24 A;  5D70 A;  3WCY I;  2HYM B;  3G9V B;  4O6K A;  1NBP A;  5IP9 D;  1GA3 A;  2L3Y A;  1ETE A;  3BPL A;  5C4X D;  3AYH A;  1FG9 A;  2JA5 D;  1YKB A;  1LK3 A;  3LB6 B;  3QWR B;  4A3G D;  5FUC A;  5KNH I;  1IAR A;  1EER A;  1M4R A;  4DOH A;  4A3E D;  3H0G D;  4FA8 E;  1IRL A;  3OG4 A;  2R92 D;  4A3I D;  3NCB A;  1HIJ A;  5D22 A;  1EKU A;  1RCB A;  3UF5 A;  2LMS A;  1A22 A;  4EXP A;  1WCM D;  1Y1V D;  5E4E A;  2E9W C;  1ITI A;  1F6F A;  1EVS A;  2Z3R A;  3VA2 A;  3HOZ D;  3L5W I;  3TGX B;  1Y1W D;  4NI9 A;  4NEM A;  3N0P A;  4A3L D;  3MZG A;  3NCC A;  3D85 C;  4EXN A;  2ILK A;  3UEZ E;  1PW6 A;  4A3B D;  3QB1 A;  3HHR A;  3UF2 A;  2JA6 D;  1BBN A;  1AU1 A;  1M4A A;  1P9M B;  1HIK A;  1M4B A;  4O9H A;  1BGD A;  1ITL A;  1M47 A;  1Z92 A;  1INR A;  1HGU A;  4J4L C;  3UX9 A;  4ZF7 A;  4NN7 A;  5L6Y C;  1RW5 A;  4X51 A;  1VLK A;  4A93 D;  4I77 Z;  3I4M D;  3D48 P;  1CN4 C;  2Q14 A;  4GS7 A;  1Y6M L;  2B5I A;  2XQB A;  1HWH A;  1PY2 A;  3FKI D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...