4NI9A

Crystal structure of human interleukin 6 in complex with a modified nucleotide aptamer (somamer sl1025), form 2
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
171
structure length
144
Chain Sequence
PHRQPLTSSERIDKQIRYILDGISALRKETNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine/dna
molecule keywords SOMAmer SL1025
publication title Crystal structure of interleukin-6 in complex with a modified nucleic Acid ligand.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 144
sequence length 171
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-11-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1250.10 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; Growth Hormone; Chain: A; 4ni9A00
3L5WI 1PVHB 2LMSA 3EW3A 1LQSL 3SE4B 1LKIA 3UX9A 1BGEA 1LK3A 1PW6A 1Y6ML 1PY2A 1RCBA 2O27A 3BPNA 1HIJA 3DGCL 1EKUA 5D28B 2H24A 1ALUA 3BPOA 1D9GA 1Z92A 1AX8A 1FG9A 2IL6A 1ITFA 1INRA 2B8YA 2D9QA 1RHGA 5FHXA 2Q98A 3VA2A 3B5KA 1P9MB 3LB6B 3NCEA 3LB6A 4J4LC 4NI9A 1QVNA 1ITLA 3NCFA 3WCYI 1M49A 2LAGA 5LQBA 2Q7NB 1WU3I 4GRWA 1HGUA 1HUWA 3MZGA 1V7NV 1EVSA 5D70A 1HULA 2B5IA 3NPZA 1I1RB 1EMRA 4PS4A 2B8ZA 2CYKA 1EERA 1Z7CA 2INTA 1IJZA 1SCFA 3S9DA 3D48P 3Q1SI 1CNT1 2O26A 1KF9A 4I77Z 4ZS7A 1IK0A 1M4RA 4YPGC 1RFBA 3OQ3A 4O9HA 2HYMB 1M4AA 1BBNA 3DUHC 4YQXA 1CD9A 3PIWA 5D22A 3UEZE 1M48A 1Y6KL 3INKC 1NBPA 1HIKA 4RS1A 1RW5A 2D48A 1B5LA 3QWRB 3QAZA 1N1FA 1F45B 2B91A 1YKBA 2ILKA 1IRLA 5C7XA 5L6YC 5D72A 3BPLA 4MHLA 3G9VB 5D71A 1GNCA 1BUYA 1AXIA 3D87A 3HHRA 4Z5RD 1HWGA 3BESL 2KZ1A 3PIVA 1A7MA 1AU1A 1F6FA 1FYHA 3SE3B 3UF5A 2L3OA 4ZF7A 4NI7A 3L5XA 1PGRA 1D9CA 1ILKA 3DLQI 5E4EA 1ITIA 2GMFA 3QB7A 1IL6A 3UF2A 1CN4C 3NCBA 3G6DA 1GA3A 1BP3A 3EJJA 4O6KA 1BGCA 2ERJD 5KNHI 1Y6NL 4NEMA 4FA8E 1HZIA 1CSGA 3HMXB 1J7VL 3QB1A 5FUCA 1HWHA 1BGDA 4NEJA 1BCNA 1A22A 1ITMA 1CYLA 2E9WC 1EXZA 1M4CA 3NCCA 3QT2C 4DOHA 3N0PA 1VLKA 2B8XA 4YUEC 1M4BA 1M47A 4X51A 1ETEA 4CNIC 2B90A 1V7MV 4NKQC 1IARA 4WRLB 3D85C 2L3YA 3N06A 4YDYI 1JLIA 2B8UA
chains in the Genus database with same CATH superfamily
3L5WI 3EW3A 1LQSL 4LEPA 1BGEA 1RCBA 5TS9A 3BPNA 5A2NA 4BXXD 3DGCL 5D28B 4NN6A 4ZWBA 4BY1D 5IYBD 3BPOA 1ALUA 1Z92A 4LDSA 1AX8A 2IL6A 3PO3D 1INRA 2B8YA 4DKEA 1RHGA 1WCMD 3WDOA 4EXNA 3LB6B 2C35A 2R92D 4BBSD 3NCFA 4NN5A 4GRWA 4A3BD 3S9DA 1IK0A 4A3GD 1BBNA 3PO2D 1Y6KL 3INKC 2D48A 3QWRB 2ILKA 4GBZA 3D87A 5D6KA 3PIVA 1A7MA 3SE3B 4ZF7A 4QIQA 4DKFA 3OG6A 3QB7A 1IL6A 1CN4C 1Y14A 5EQGA 4O6KA 1BGCA 2ERJD 5KNHI 4A3MD 4DKCA 4A3JD 4NEJA 1BCNA 5C4XD 3N0PA 2B8XA 4X51A 2O6IA 1V7MV 2L3YA 4BY7D 2LMSA 5IP7D 1LKIA 1Y6ML 1PY2A 5GXBA 2H24A 3H0GD 1D9GA 1FG9A 1ITFA 4IU9A 5D59A 3HOYD 1P9MB 3LB6A 2Y5YA 1QVNA 1ITLA 3WCYI 2LAGA 2Q7NB 4JA3A 1HUWA 3MZGA 1V7NV 1EVSA 2B5IA 1I1RB 2B8ZA 2CYKA 1Z7CA 2INTA 1IJZA 3D48P 2O26A 1KF9A 4I77Z 4YPGC 1RFBA 4O9HA 5FLMD 3DUHC 1CD9A 3UEZE 4LRLA 4PYPA 1HIKA 4ZWCA 3QAZA 4YBQA 1N1FA 1F45B 2B91A 4YB9D 1IRLA 3OG4A 5C7XA 1GNCA 4MHLA 5D71A 3HHRA 4Z5RD 4Q65A 1HWGA 3BESL 4TPGA 3UF5A 1FYHA 2L3OA 4A3ID 4TPHA 1PGRA 5IYDD 1D9CA 3DLQI 3UF2A 3EJJA 4FA8E 3DI3A 1HWHA 3IRHA 4A3DD 4D2BA 4IKVA 3NCCA 3QT2C 4DOHA 4D2DA 1VLKA 2JA6D 4DKDA 1ETEA 2OQPA 4CNIC 1IARA 4WRLB 3N06A 4YDYI 2VUMD 2V8NA 1PVHB 3SE4B 4A3FD 5C3ED 4A3LD 1LK3A 1HIJA 1EKUA 4XNJA 4ZW9A 5FHXA 4XNIA 5C65A 2Q98A 3HOWD 3B5KA 3HOUD 3NCEA 4J4LC 3AYHA 4U4VA 4TPJA 1HGUA 3NPZA 5C44D 5EQHA 1EERA 4UVMA 1SCFA 1CNT1 4ZS7A 3OQ3A 4A3ED 1M4AA 4YQXA 3O7QA 2XUTA 1M48A 4NN7A 1NBPA 4RS1A 1PV7A 4W6VA 2Q14A 4IKYA 3BPLA 1AXIA 2KZ1A 2R93D 1F6FA 3O7PA 4APSA 4NI7A 3HHCA 3L5XA 5D58A 3H3VE 4A93D 4J05A 5IYCD 1ILKA 2Z3QA 1ITIA 2GMFA 1GA3A 3G6DA 1Y6NL 4NEMA 1HZIA 1J7VL 3QB1A 5EQIA 2CFPA 1ITMA 1CYLA 2E9WC 4U4WA 1EXZA 4EXPA 4YUEC 1Y1VD 1PV6A 2B90A 4NKQC 4A3CD 4JREA 4OAAA 2B8UA 2PSMA 2JA5D 3UX9A 1PW6A 2Z3RA 3HOXD 2O27A 4IKZA 1PW4A 4U4TA 2D9QA 4GS7A 3VA2A 3HOVD 4NI9A 1M49A 5LQBA 1WU3I 5D70A 2JA7D 1HULA 1EMRA 3I4MD 4PS4A 4IKXA 5A2OA 2R7ZD 4IU8A 2B63D 3Q1SI 1M4RA 2HYMB 4ZYRA 3HOZD 3PIWA 5D22A 2CFQA 1RW5A 1B5LA 4GC0A 4D2CA 1Y1WD 1YKBA 5L6YC 5D72A 3G9VB 4IKWA 1BUYA 4BBRD 5IP9D 2JA8D 3DI2A 3FKID 1AU1A 4GBYA 5E4EA 3NCBA 1BP3A 3TGXB 1CSGA 3HMXB 5FUCA 4A3KD 1BGDA 2XQBA 1A22A 4JR9A 1M4CA 4OH3A 1M4BA 1M47A 3I4ND 3D85C 1JLIA
chains in the Genus database with same CATH topology
3L5WI 2PSMA 1PVHB 4BY7D 2LMSA 2JA5D 3EW3A 1LQSL 5IP7D 3SE4B 1LKIA 4A3FD 5C3ED 3UX9A 1BGEA 1LK3A 1PW6A 1Y6ML 2Z3RA 1PY2A 1RCBA 2O27A 5TS9A 3BPNA 3HOXD 4BXXD 1HIJA 3DGCL 1EKUA 5D28B 4NN6A 4A3LD 4BY1D 5IYBD 2H24A 1ALUA 3BPOA 3H0GD 1D9GA 1Z92A 1AX8A 1FG9A 2IL6A 1ITFA 3PO3D 1INRA 2B8YA 4DKEA 2D9QA 1RHGA 4GS7A 5FHXA 3HOYD 2Q98A 1WCMD 3VA2A 3HOVD 3HOWD 4EXNA 3B5KA 1P9MB 3LB6B 2C35A 3HOUD 3NCEA 3LB6A 4J4LC 2R92D 4NI9A 1QVNA 1ITLA 3NCFA 4NN5A 3WCYI 4BBSD 1M49A 2LAGA 5LQBA 3AYHA 2Q7NB 1WU3I 4GRWA 1HGUA 1HUWA 3MZGA 1V7NV 1EVSA 5D70A 2JA7D 1HULA 2B5IA 3NPZA 1I1RB 1EMRA 5C44D 4A3BD 3I4MD 4PS4A 2B8ZA 2CYKA 1EERA 1Z7CA 2INTA 1IJZA 2R7ZD 1SCFA 3S9DA 3D48P 2B63D 3Q1SI 1CNT1 2O26A 1KF9A 4I77Z 4ZS7A 1IK0A 1M4RA 4YPGC 1RFBA 4A3GD 3OQ3A 4O9HA 2HYMB 5FLMD 4A3ED 1M4AA 1BBNA 3PO2D 3HOZD 3DUHC 4YQXA 1CD9A 3PIWA 5D22A 3UEZE 1M48A 1Y6KL 4LRLA 4NN7A 3INKC 1NBPA 1HIKA 4RS1A 1RW5A 2D48A 1B5LA 3QWRB 3QAZA 1N1FA 1F45B 2B91A 1Y1WD 1YKBA 2ILKA 1IRLA 3OG4A 2Q14A 5C7XA 5L6YC 5D72A 3BPLA 4MHLA 3G9VB 5D71A 1GNCA 1BUYA 1AXIA 3D87A 3HHRA 4Z5RD 4BBRD 5IP9D 2JA8D 1HWGA 3BESL 2KZ1A 3DI2A 3FKID 3PIVA 1A7MA 2R93D 1AU1A 1F6FA 1FYHA 3SE3B 3UF5A 2L3OA 4DKFA 4ZF7A 4NI7A 4A3ID 3HHCA 1PGRA 3L5XA 1D9CA 5IYDD 3H3VE 3OG6A 4A93D 5IYCD 1ILKA 2Z3QA 3DLQI 5E4EA 1ITIA 2GMFA 3QB7A 1IL6A 3UF2A 1CN4C 3NCBA 1Y14A 3G6DA 1BP3A 3EJJA 1GA3A 4O6KA 1BGCA 2ERJD 5KNHI 4A3MD 1Y6NL 4NEMA 4DKCA 4FA8E 3TGXB 1HZIA 3DI3A 1CSGA 3HMXB 1J7VL 3QB1A 5FUCA 1HWHA 3IRHA 4A3JD 4A3KD 4A3DD 1BGDA 4NEJA 2XQBA 1BCNA 1A22A 1ITMA 1CYLA 2E9WC 1EXZA 1M4CA 3NCCA 5C4XD 3QT2C 4DOHA 3N0PA 4EXPA 1VLKA 2B8XA 4YUEC 2JA6D 1M4BA 1M47A 4X51A 1Y1VD 4DKDA 1ETEA 2O6IA 2OQPA 4CNIC 2B90A 3I4ND 1V7MV 4NKQC 4A3CD 1IARA 4WRLB 3D85C 2L3YA 3N06A 4YDYI 1JLIA 2B8UA 2VUMD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L5W I;  1PVH B;  2LMS A;  3EW3 A;  1LQS L;  3SE4 B;  1LKI A;  3UX9 A;  1BGE A;  1LK3 A;  1PW6 A;  1Y6M L;  1PY2 A;  1RCB A;  2O27 A;  3BPN A;  1HIJ A;  3DGC L;  1EKU A;  5D28 B;  2H24 A;  1ALU A;  3BPO A;  1D9G A;  1Z92 A;  1AX8 A;  1FG9 A;  2IL6 A;  1ITF A;  1INR A;  2B8Y A;  2D9Q A;  1RHG A;  5FHX A;  2Q98 A;  3VA2 A;  3B5K A;  1P9M B;  3LB6 B;  3NCE A;  3LB6 A;  4J4L C;  4NI9 A;  1QVN A;  1ITL A;  3NCF A;  3WCY I;  1M49 A;  2LAG A;  5LQB A;  2Q7N B;  1WU3 I;  4GRW A;  1HGU A;  1HUW A;  3MZG A;  1V7N V;  1EVS A;  5D70 A;  1HUL A;  2B5I A;  3NPZ A;  1I1R B;  1EMR A;  4PS4 A;  2B8Z A;  2CYK A;  1EER A;  1Z7C A;  2INT A;  1IJZ A;  1SCF A;  3S9D A;  3D48 P;  3Q1S I;  1CNT 1;  2O26 A;  1KF9 A;  4I77 Z;  4ZS7 A;  1IK0 A;  1M4R A;  4YPG C;  1RFB A;  3OQ3 A;  4O9H A;  2HYM B;  1M4A A;  1BBN A;  3DUH C;  4YQX A;  1CD9 A;  3PIW A;  5D22 A;  3UEZ E;  1M48 A;  1Y6K L;  3INK C;  1NBP A;  1HIK A;  4RS1 A;  1RW5 A;  2D48 A;  1B5L A;  3QWR B;  3QAZ A;  1N1F A;  1F45 B;  2B91 A;  1YKB A;  2ILK A;  1IRL A;  5C7X A;  5L6Y C;  5D72 A;  3BPL A;  4MHL A;  3G9V B;  5D71 A;  1GNC A;  1BUY A;  1AXI A;  3D87 A;  3HHR A;  4Z5R D;  1HWG A;  3BES L;  2KZ1 A;  3PIV A;  1A7M A;  1AU1 A;  1F6F A;  1FYH A;  3SE3 B;  3UF5 A;  2L3O A;  4ZF7 A;  4NI7 A;  3L5X A;  1PGR A;  1D9C A;  1ILK A;  3DLQ I;  5E4E A;  1ITI A;  2GMF A;  3QB7 A;  1IL6 A;  3UF2 A;  1CN4 C;  3NCB A;  3G6D A;  1GA3 A;  1BP3 A;  3EJJ A;  4O6K A;  1BGC A;  2ERJ D;  5KNH I;  1Y6N L;  4NEM A;  4FA8 E;  1HZI A;  1CSG A;  3HMX B;  1J7V L;  3QB1 A;  5FUC A;  1HWH A;  1BGD A;  4NEJ A;  1BCN A;  1A22 A;  1ITM A;  1CYL A;  2E9W C;  1EXZ A;  1M4C A;  3NCC A;  3QT2 C;  4DOH A;  3N0P A;  1VLK A;  2B8X A;  4YUE C;  1M4B A;  1M47 A;  4X51 A;  1ETE A;  4CNI C;  2B90 A;  1V7M V;  4NKQ C;  1IAR A;  4WRL B;  3D85 C;  2L3Y A;  3N06 A;  4YDY I;  1JLI A;  2B8U A; 
#chains in the Genus database with same CATH topology
 3L5W I;  3EW3 A;  1LQS L;  4LEP A;  1BGE A;  1RCB A;  5TS9 A;  3BPN A;  5A2N A;  4BXX D;  3DGC L;  5D28 B;  4NN6 A;  4ZWB A;  4BY1 D;  5IYB D;  3BPO A;  1ALU A;  1Z92 A;  4LDS A;  1AX8 A;  2IL6 A;  3PO3 D;  1INR A;  2B8Y A;  4DKE A;  1RHG A;  1WCM D;  3WDO A;  4EXN A;  3LB6 B;  2C35 A;  2R92 D;  4BBS D;  3NCF A;  4NN5 A;  4GRW A;  4A3B D;  3S9D A;  1IK0 A;  4A3G D;  1BBN A;  3PO2 D;  1Y6K L;  3INK C;  2D48 A;  3QWR B;  2ILK A;  4GBZ A;  3D87 A;  5D6K A;  3PIV A;  1A7M A;  3SE3 B;  4ZF7 A;  4QIQ A;  4DKF A;  3OG6 A;  3QB7 A;  1IL6 A;  1CN4 C;  1Y14 A;  5EQG A;  4O6K A;  1BGC A;  2ERJ D;  5KNH I;  4A3M D;  4DKC A;  4A3J D;  4NEJ A;  1BCN A;  5C4X D;  3N0P A;  2B8X A;  4X51 A;  2O6I A;  1V7M V;  2L3Y A;  4BY7 D;  2LMS A;  5IP7 D;  1LKI A;  1Y6M L;  1PY2 A;  5GXB A;  2H24 A;  3H0G D;  1D9G A;  1FG9 A;  1ITF A;  4IU9 A;  5D59 A;  3HOY D;  1P9M B;  3LB6 A;  2Y5Y A;  1QVN A;  1ITL A;  3WCY I;  2LAG A;  2Q7N B;  4JA3 A;  1HUW A;  3MZG A;  1V7N V;  1EVS A;  2B5I A;  1I1R B;  2B8Z A;  2CYK A;  1Z7C A;  2INT A;  1IJZ A;  3D48 P;  2O26 A;  1KF9 A;  4I77 Z;  4YPG C;  1RFB A;  4O9H A;  5FLM D;  3DUH C;  1CD9 A;  3UEZ E;  4LRL A;  4PYP A;  1HIK A;  4ZWC A;  3QAZ A;  4YBQ A;  1N1F A;  1F45 B;  2B91 A;  4YB9 D;  1IRL A;  3OG4 A;  5C7X A;  1GNC A;  4MHL A;  5D71 A;  3HHR A;  4Z5R D;  4Q65 A;  1HWG A;  3BES L;  4TPG A;  3UF5 A;  1FYH A;  2L3O A;  4A3I D;  4TPH A;  1PGR A;  5IYD D;  1D9C A;  3DLQ I;  3UF2 A;  3EJJ A;  4FA8 E;  3DI3 A;  1HWH A;  3IRH A;  4A3D D;  4D2B A;  4IKV A;  3NCC A;  3QT2 C;  4DOH A;  4D2D A;  1VLK A;  2JA6 D;  4DKD A;  1ETE A;  2OQP A;  4CNI C;  1IAR A;  4WRL B;  3N06 A;  4YDY I;  2VUM D;  2V8N A;  1PVH B;  3SE4 B;  4A3F D;  5C3E D;  4A3L D;  1LK3 A;  1HIJ A;  1EKU A;  4XNJ A;  4ZW9 A;  5FHX A;  4XNI A;  5C65 A;  2Q98 A;  3HOW D;  3B5K A;  3HOU D;  3NCE A;  4J4L C;  3AYH A;  4U4V A;  4TPJ A;  1HGU A;  3NPZ A;  5C44 D;  5EQH A;  1EER A;  4UVM A;  1SCF A;  1CNT 1;  4ZS7 A;  3OQ3 A;  4A3E D;  1M4A A;  4YQX A;  3O7Q A;  2XUT A;  1M48 A;  4NN7 A;  1NBP A;  4RS1 A;  1PV7 A;  4W6V A;  2Q14 A;  4IKY A;  3BPL A;  1AXI A;  2KZ1 A;  2R93 D;  1F6F A;  3O7P A;  4APS A;  4NI7 A;  3HHC A;  3L5X A;  5D58 A;  3H3V E;  4A93 D;  4J05 A;  5IYC D;  1ILK A;  2Z3Q A;  1ITI A;  2GMF A;  1GA3 A;  3G6D A;  1Y6N L;  4NEM A;  1HZI A;  1J7V L;  3QB1 A;  5EQI A;  2CFP A;  1ITM A;  1CYL A;  2E9W C;  4U4W A;  1EXZ A;  4EXP A;  4YUE C;  1Y1V D;  1PV6 A;  2B90 A;  4NKQ C;  4A3C D;  4JRE A;  4OAA A;  2B8U A;  2PSM A;  2JA5 D;  3UX9 A;  1PW6 A;  2Z3R A;  3HOX D;  2O27 A;  4IKZ A;  1PW4 A;  4U4T A;  2D9Q A;  4GS7 A;  3VA2 A;  3HOV D;  4NI9 A;  1M49 A;  5LQB A;  1WU3 I;  5D70 A;  2JA7 D;  1HUL A;  1EMR A;  3I4M D;  4PS4 A;  4IKX A;  5A2O A;  2R7Z D;  4IU8 A;  2B63 D;  3Q1S I;  1M4R A;  2HYM B;  4ZYR A;  3HOZ D;  3PIW A;  5D22 A;  2CFQ A;  1RW5 A;  1B5L A;  4GC0 A;  4D2C A;  1Y1W D;  1YKB A;  5L6Y C;  5D72 A;  3G9V B;  4IKW A;  1BUY A;  4BBR D;  5IP9 D;  2JA8 D;  3DI2 A;  3FKI D;  1AU1 A;  4GBY A;  5E4E A;  3NCB A;  1BP3 A;  3TGX B;  1CSG A;  3HMX B;  5FUC A;  4A3K D;  1BGD A;  2XQB A;  1A22 A;  4JR9 A;  1M4C A;  4OH3 A;  1M4B A;  1M47 A;  3I4N D;  3D85 C;  1JLI A; 
#chains in the Genus database with same CATH homology
 3L5W I;  2PSM A;  1PVH B;  4BY7 D;  2LMS A;  2JA5 D;  3EW3 A;  1LQS L;  5IP7 D;  3SE4 B;  1LKI A;  4A3F D;  5C3E D;  3UX9 A;  1BGE A;  1LK3 A;  1PW6 A;  1Y6M L;  2Z3R A;  1PY2 A;  1RCB A;  2O27 A;  5TS9 A;  3BPN A;  3HOX D;  4BXX D;  1HIJ A;  3DGC L;  1EKU A;  5D28 B;  4NN6 A;  4A3L D;  4BY1 D;  5IYB D;  2H24 A;  1ALU A;  3BPO A;  3H0G D;  1D9G A;  1Z92 A;  1AX8 A;  1FG9 A;  2IL6 A;  1ITF A;  3PO3 D;  1INR A;  2B8Y A;  4DKE A;  2D9Q A;  1RHG A;  4GS7 A;  5FHX A;  3HOY D;  2Q98 A;  1WCM D;  3VA2 A;  3HOV D;  3HOW D;  4EXN A;  3B5K A;  1P9M B;  3LB6 B;  2C35 A;  3HOU D;  3NCE A;  3LB6 A;  4J4L C;  2R92 D;  4NI9 A;  1QVN A;  1ITL A;  3NCF A;  4NN5 A;  3WCY I;  4BBS D;  1M49 A;  2LAG A;  5LQB A;  3AYH A;  2Q7N B;  1WU3 I;  4GRW A;  1HGU A;  1HUW A;  3MZG A;  1V7N V;  1EVS A;  5D70 A;  2JA7 D;  1HUL A;  2B5I A;  3NPZ A;  1I1R B;  1EMR A;  5C44 D;  4A3B D;  3I4M D;  4PS4 A;  2B8Z A;  2CYK A;  1EER A;  1Z7C A;  2INT A;  1IJZ A;  2R7Z D;  1SCF A;  3S9D A;  3D48 P;  2B63 D;  3Q1S I;  1CNT 1;  2O26 A;  1KF9 A;  4I77 Z;  4ZS7 A;  1IK0 A;  1M4R A;  4YPG C;  1RFB A;  4A3G D;  3OQ3 A;  4O9H A;  2HYM B;  5FLM D;  4A3E D;  1M4A A;  1BBN A;  3PO2 D;  3HOZ D;  3DUH C;  4YQX A;  1CD9 A;  3PIW A;  5D22 A;  3UEZ E;  1M48 A;  1Y6K L;  4LRL A;  4NN7 A;  3INK C;  1NBP A;  1HIK A;  4RS1 A;  1RW5 A;  2D48 A;  1B5L A;  3QWR B;  3QAZ A;  1N1F A;  1F45 B;  2B91 A;  1Y1W D;  1YKB A;  2ILK A;  1IRL A;  3OG4 A;  2Q14 A;  5C7X A;  5L6Y C;  5D72 A;  3BPL A;  4MHL A;  3G9V B;  5D71 A;  1GNC A;  1BUY A;  1AXI A;  3D87 A;  3HHR A;  4Z5R D;  4BBR D;  5IP9 D;  2JA8 D;  1HWG A;  3BES L;  2KZ1 A;  3DI2 A;  3FKI D;  3PIV A;  1A7M A;  2R93 D;  1AU1 A;  1F6F A;  1FYH A;  3SE3 B;  3UF5 A;  2L3O A;  4DKF A;  4ZF7 A;  4NI7 A;  4A3I D;  3HHC A;  1PGR A;  3L5X A;  1D9C A;  5IYD D;  3H3V E;  3OG6 A;  4A93 D;  5IYC D;  1ILK A;  2Z3Q A;  3DLQ I;  5E4E A;  1ITI A;  2GMF A;  3QB7 A;  1IL6 A;  3UF2 A;  1CN4 C;  3NCB A;  1Y14 A;  3G6D A;  1BP3 A;  3EJJ A;  1GA3 A;  4O6K A;  1BGC A;  2ERJ D;  5KNH I;  4A3M D;  1Y6N L;  4NEM A;  4DKC A;  4FA8 E;  3TGX B;  1HZI A;  3DI3 A;  1CSG A;  3HMX B;  1J7V L;  3QB1 A;  5FUC A;  1HWH A;  3IRH A;  4A3J D;  4A3K D;  4A3D D;  1BGD A;  4NEJ A;  2XQB A;  1BCN A;  1A22 A;  1ITM A;  1CYL A;  2E9W C;  1EXZ A;  1M4C A;  3NCC A;  5C4X D;  3QT2 C;  4DOH A;  3N0P A;  4EXP A;  1VLK A;  2B8X A;  4YUE C;  2JA6 D;  1M4B A;  1M47 A;  4X51 A;  1Y1V D;  4DKD A;  1ETE A;  2O6I A;  2OQP A;  4CNI C;  2B90 A;  3I4N D;  1V7M V;  4NKQ C;  4A3C D;  1IAR A;  4WRL B;  3D85 C;  2L3Y A;  3N06 A;  4YDY I;  1JLI A;  2B8U A;  2VUM D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...