The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
44
|
sequence length |
119
|
structure length |
119
|
Chain Sequence |
MINPNPKRSDEPVFWGLFGAGGMWSAIIAPVMILLVGILLPLGLFPGDALSYERVLAFAQSFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWVFYGLAAILTVVTLIGVVTI
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystallographic studies of the Escherichia coli quinol-fumarate reductase with inhibitors bound to the
quinol-binding site.
pubmed doi rcsb |
molecule tags |
Oxidoreductase
|
source organism |
Escherichia coli
|
molecule keywords |
FUMARATE REDUCTASE FLAVOPROTEIN
|
total genus |
44
|
structure length |
119
|
sequence length |
119
|
chains with identical sequence |
P
|
ec nomenclature | |
pdb deposition date | 2001-11-19 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
D | PF02313 | Fumarate_red_D | Fumarate reductase subunit D |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Up-down Bundle | 3 helical TM bundles of succinate and fumarate reductases | Fumarate reductase/succinate dehydrogenase, transmembrane subunit |
#chains in the Genus database with same CATH superfamily 3AE9 D; 3P4Q D; 3AEA D; 3SFE D; 3AEF C; 4YTM D; 2BS4 C; 2WDQ C; 3AE2 D; 3CIR C; 2WP9 D; 3AE3 C; 3VRB D; 1NEN C; 4YTN D; 4YTP C; 2BS2 C; 3AE4 D; 3VRA D; 3AE9 C; 3P4Q C; 3VR8 D; 1ZOY D; 3AEA C; 3SFE C; 2H88 D; 4KX6 D; 2WDR C; 2WU2 D; 1YQ3 D; 4YTM C; 2WP9 C; 3VRB C; 1L0V D; 4YSY D; 4YTN C; 4YXD C; 2B76 D; 3VR9 D; 3P4R D; 3VRA C; 1NEK D; 1KF6 D; 3VR8 C; 1ZOY C; 2FBW D; 2H88 C; 2WU2 C; 1YQ4 D; 1YQ3 C; 2BS3 C; 3AE1 D; 4YSY C; 2ACZ D; 2B76 C; 5C2T D; 3VR9 C; 3P4R C; 3AE6 D; 1NEK C; 1KF6 C; 2FBW C; 1QLB C; 3AEE D; 3AE2 C; 1E7P C; 1YQ4 C; 2WDV D; 3AE1 C; 2WQY D; 3AE4 C; 5C3J D; 2WU5 D; 3P4S D; 4YSZ D; 2ACZ C; 2H89 D; 5C2T C; 3AE6 C; 2WS3 D; 4KX6 C; 3AEE C; 1KFY D; 3AE8 D; 1L0V C; 3AED D; 2WDV C; 2WDQ D; 3ABV D; 3AEB D; 3AEG D; 5C3J C; 2WU5 C; 2H89 C; 3AE7 D; 1ZP0 D; 3P4P D; 4YT0 D; 2WS3 C; 3AE5 D; 3AEC D; 1KFY C; 2WDR D; 3AE8 C; 3SFD D; 3AED C; 3ABV C; 3AEB C; 3AEG C; 4YSX D; 4YXD D; 3AE7 C; 1ZP0 C; 3P4P C; 4YT0 C; 3AE5 C; 3AEF D; 3AEC C; 3SFD C; 2WQY C; 3CIR D; 3AE3 D; 4YSZ C; 1NEN D; 3P4S C; 4YTP D; 4YSX C; #chains in the Genus database with same CATH topology 3AE9 D; 3P4Q D; 4DHZ A; 2ZFY A; 3AEA D; 3SFE D; 3AEF C; 4YTM D; 2BS4 C; 2WDQ C; 3AE2 D; 3CIR C; 2WP9 D; 3AE3 C; 3VRB D; 1NEN C; 4YTN D; 4DDG A; 4YTP C; 2BS2 C; 3AE4 D; 3VRA D; 3AE9 C; 3P4Q C; 3VR8 D; 1ZOY D; 3AEA C; 3SFE C; 2H88 D; 4KX6 D; 2WDR C; 2WU2 D; 1YQ3 D; 4YTM C; 2WP9 C; 3VRB C; 1L0V D; 4YSY D; 4YTN C; 4YXD C; 2B76 D; 3VR9 D; 3P4R D; 3VON A; 3VRA C; 1NEK D; 1KF6 D; 3VR8 C; 1ZOY C; 2FBW D; 2H88 C; 2WU2 C; 1YQ4 D; 1YQ3 C; 2BS3 C; 3AE1 D; 4YSY C; 2ACZ D; 2B76 C; 5C2T D; 3VR9 C; 3P4R C; 3AE6 D; 1NEK C; 1KF6 C; 2FBW C; 1QLB C; 3AEE D; 3AE2 C; 1E7P C; 1YQ4 C; 2WDV D; 3AE1 C; 2WQY D; 3AE4 C; 5C3J D; 2WU5 D; 3P4S D; 4YSZ D; 2ACZ C; 2H89 D; 5C2T C; 3AE6 C; 2WS3 D; 4KX6 C; 4FJV A; 3AEE C; 1KFY D; 3AE8 D; 1L0V C; 3AED D; 2WDV C; 2WDQ D; 3ABV D; 3AEB D; 3AEG D; 5C3J C; 2WU5 C; 2H89 C; 3AE7 D; 1ZP0 D; 3P4P D; 4YT0 D; 2WS3 C; 3AE5 D; 4DHJ A; 4DDI A; 3AEC D; 4DHI B; 1KFY C; 2WDR D; 3AE8 C; 3SFD D; 3AED C; 3ABV C; 3AEB C; 3AEG C; 4YSX D; 4LDT A; 4YXD D; 3AE7 C; 1ZP0 C; 3P4P C; 4YT0 C; 3AE5 C; 4I6L A; 3AEF D; 3AEC C; 3SFD C; 2WQY C; 3CIR D; 3AE3 D; 1TFF A; 4YSZ C; 1NEN D; 3P4S C; 4YTP D; 4YSX C; #chains in the Genus database with same CATH homology 3AE9 D; 3P4Q D; 3AEA D; 3SFE D; 3AEF C; 4YTM D; 2BS4 C; 2WDQ C; 3AE2 D; 3CIR C; 2WP9 D; 3AE3 C; 3VRB D; 1NEN C; 4YTN D; 4YTP C; 2BS2 C; 3AE4 D; 3VRA D; 3AE9 C; 3P4Q C; 3VR8 D; 1ZOY D; 3AEA C; 3SFE C; 2H88 D; 4KX6 D; 2WDR C; 2WU2 D; 1YQ3 D; 4YTM C; 2WP9 C; 3VRB C; 1L0V D; 4YSY D; 4YTN C; 4YXD C; 2B76 D; 3VR9 D; 3P4R D; 3VRA C; 1NEK D; 1KF6 D; 3VR8 C; 1ZOY C; 2FBW D; 2H88 C; 2WU2 C; 1YQ4 D; 1YQ3 C; 2BS3 C; 3AE1 D; 4YSY C; 2ACZ D; 2B76 C; 5C2T D; 3VR9 C; 3P4R C; 3AE6 D; 1NEK C; 1KF6 C; 2FBW C; 1QLB C; 3AEE D; 3AE2 C; 1E7P C; 1YQ4 C; 2WDV D; 3AE1 C; 2WQY D; 3AE4 C; 5C3J D; 2WU5 D; 3P4S D; 4YSZ D; 2ACZ C; 2H89 D; 5C2T C; 3AE6 C; 2WS3 D; 4KX6 C; 3AEE C; 1KFY D; 3AE8 D; 1L0V C; 3AED D; 2WDV C; 2WDQ D; 3ABV D; 3AEB D; 3AEG D; 5C3J C; 2WU5 C; 2H89 C; 3AE7 D; 1ZP0 D; 3P4P D; 4YT0 D; 2WS3 C; 3AE5 D; 3AEC D; 1KFY C; 2WDR D; 3AE8 C; 3SFD D; 3AED C; 3ABV C; 3AEB C; 3AEG C; 4YSX D; 4YXD D; 3AE7 C; 1ZP0 C; 3P4P C; 4YT0 C; 3AE5 C; 3AEF D; 3AEC C; 3SFD C; 2WQY C; 3CIR D; 3AE3 D; 4YSZ C; 1NEN D; 3P4S C; 4YTP D; 4YSX C;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...