3AEBC

Crystal structure of porcine heart mitochondrial complex ii bound with n-(3-phenoxy-phenyl)-2-trifluoromethyl-benzamide
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with N-(3-Phenoxy-phenyl)-2-trifluoromethyl-benzamide
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 51
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3aebC01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3aebC02
2FBWC 5C3JC 1NENC 2FBWD 5C3JD 2BS4C 1ZOYC 3AEED 1KFYD 1KF6D 1YQ3C 1L0VC 2WDVC 3AE9D 3VR8D 1L0VD 3SFEC 2WDVD 4YT0C 3VR9C 3AE8C 3SFED 3VR9D 3AE8D 3SFDD 3VRBC 3AE4D 3P4SC 1ZP0C 3VRAC 1K05A 3AEAD 3ABVC 4KX6C 2WDQC 2WU2C 3VRAD 4YTMC 3AE5C 4KX6D 2WDRC 2WU2D 1OW6A 4YTMD 3AE5D 3S9OA 2WDRD 1NEND 3CIRC 4YSZC 1NEKC 1ZOYD 3CIRD 1PV3A 4YSZD 1OW8A 3P4QC 4YSYC 1YQ3D 3B71A 1QLBC 3P4QD 3AE1C 4YT0D 5C2TC 3AE1D 4YTPC 1E7PC 3VRBD 1YQ4C 4YXDC 3P4PC 1YQ4D 1OW7A 1ZP0D 3P4SD 3ABVD 2WDQD 3AE2C 4YSXC 2ACZC 2WU5C 1K04A 2WU5D 2WQYC 1NEKD 3AEGC 2WP9C 2H89C 3AEFC 4YSYD 3AECC 3AE6C 2B76C 3AE6D 2H88C 2BS2C 2B76D 5C2TD 2H88D 4YTPD 4YXDD 3AEEC 3P4PD 1KFYC 1KTMA 1KF6C 2BS3C 3AEDC 3AEBC 3AE9C 3VR8C 3AEDD 3AEBD 3AE2D 2G3AA 4YSXD 2ACZD 3SFDC 3P4RC 4YTNC 2WQYD 2WS3C 3AE3C 3AEGD 3AE7C 3P4RD 4YTND 2WS3D 2WP9D 2H89D 3AE3D 3AEFD 3AE4C 3AE7D 3AEAC 3AECD
chains in the Genus database with same CATH superfamily
3L71D 1LWUB 1SFCA 4MN4C 3SWYA 4D6TJ 1M1JA 1ZOYC 1TU3F 2HFED 3VR8D 2YO3A 3K5BA 3KXDA 1BE3D 3VTPC 3GW6A 2J59M 2M3BA 3AE5C 4C7RA 1OW6A 4BRYA 1NH4A 3C9IA 3R4YA 1L4AC 4EOTA 1PFIA 2NPSB 3L74D 2Y9YA 1FU1A 3U59A 2ACZC 2WPQA 3H1KG 2LR2A 3Q5PA 1RHZB 4IFFA 3HE5B 1YHQP 2BCCJ 2V7QH 1BGYD 2WSSH 3VP8A 1RF1C 2YIUC 1BCCJ 3NMDA 5CBNA 1FZCB 2GM4A 3LIDA 4UB8H 4L76A 1KF6C 2ZXXA 2YKQA 2HPCA 1S1CX 2BASA 1Q7YQ 3AEDD 1AA0A 3P32A 4YSXD 2CK3H 4DOJA 2I1KA 4PD4D 2WS3C 3KZIH 1WT6A 3AECD 1M57D 3RK2D 1LTGC 1BCCD 2MKVA 2WMMA 2AXTE 1URQC 5GTIH 2QJKB 3WU2H 3L73E 1W2BO 2K3RA 1NTMK 2W6BA 1KQFB 1GW3A 1PPJE 1KFMA 5K5GB 3NFQA 1X8YA 3QWOC 2M0BA 4H0LC 2JO1A 1FZGA 2HG5D 1NTZD 5EFWB 1SQPK 2FFDB 3V5BA 3PLNA 1SQVJ 4PJ0H 5TISE 3V2RA 2PAJA 4L75A 3VRBD 5AVUB 1IFJA 1VPCA 3HUSA 1HTLC 4H13B 1FOSE 1K04A 5AVRB 2JDIH 2D2CC 3HRNA 5APWA 2SPZA 2H88C 1RE4C 2KSEA 1YTZT 4YTPD 4JPZB 3L70E 2IFNA 1IFMA 1J1DB 1SFCC 3KYQA 2QEXP 3ITKA 3AE2D 1M1JC 1N2DC 1VF5C 3IF4A 3PJSK 3VMXA 2QJYB 2R3SA 3L73G 2WQYD 1JOCA 3CCMP 2V4HA 4HJGH 2H89D 3AEAC 1T3JA 1N7SB 1JTHB 3MUDA 2N1TD 1LTJB 3RBXA 2BEQD 3RK2B 1VQ8P 1N73A 4YPCA 1FZBA 3B8EB 1L0VC 1NTKJ 1USEA 2W27A 3HE4B 2WWWA 3L73J 5B5EE 1NU1K 1YI2P 3AE8C 2PGDA 2FXOA 3L72J 4W80A 1L4AB 3O8ZA 2IPPA 1JNMA 5BVZA 3P4SC 4R4LA 1EZVD 3CPWO 2H8PD 3N4XA 3CCRP 1CSBA 1SQQK 3EWKA 1EDIA 4XA4A 2P58A 4CPGA 1N86A 1RE3A 3ZDMA 3IFMA 3CC2P 2YXRB 2QM8A 1VL2A 3HD7D 3M9HA 2KS1B 3G9RA 4H44D 4ZMDA 3VMAA 1A02J 4FJVA 1GL2D 3P7KA 4W7ZA 1AFOA 1YJWP 1ZXGA 2I8DA 1KILD 2B76C 1VDFA 1S5LE 1KYOH 1PGJA 1WMKA 4DDGA 1H0TA 2N9YB 5C39A 3AEBC 3L70J 1HVVA 3FWLA 1EDLA 1MV8A 3RGUA 2G3AA 2W6AA 3P8CE 1LP1A 2XNXA 1S72P 3AE4C 5CCHD 1G2CA 1DEEG 3KPEA 3H1IG 3TK1A 2KZJA 2P1JA 3AE9D 1L0NK 1CI6A 2FYNB 1PIXA 5KLVJ 3GMAA 3LW5H 3OAKA 1MUUA 3L35A 4I7ZC 1QGKB 1SQXG 1ZP0C 3CX5D 1IFPA 3CXHH 2FYUE 3S9OA 1FOSF 3L37A 1NWQA 3B5NA 2WPVB 1R5LA 2Z5IA 3CXHI 1QLBC 1TFFA 5AW1B 4C7NB 5BU5A 2YXQB 4N78E 1J1EC 1SQBK 5CMZA 1NTMD 3II6A 5CHXA 2OTJP 3F5HA 3KDPB 1S9KD 4H44B 2KLVA 2KLUA 3FXEA 2WU5D 1FAVA 1M1KQ 1NEKD 2R44A 3O6QA 4I6LA 4Y99B 1SQPD 1T6AA 1OVUA 3V2NA 1DH3A 1VF5B 3GLMA 1AJYA 3AEEC 2JP3A 2E42A 3OW2O 1EC5A 2FXMA 3MUDC 2XKMA 2DW3A 1VQPP 4HKZH 1N73C 1VQ7P 1P84H 3AE3C 3WUUA 1HUCA 5KKZB 3JC22 1HJBA 2KB7P 1P84I 1X9VA 2W6JH 2QRXA 1U7MA 2M8RA 1KB9H 1KFYD 4N3YB 1HH0A 1YYCA 1BE3E 1GMJA 2FYUG 3TYYA 2YO2A 3L75J 3VR9C 2NZ2A 1JB0J 3RL0B 1KB9I 4WY4A 3HTKA 4D6TE 1LNQA 4YTMC 1JY2N 3H32A 2QM7A 1NEND 3CIRC 3OJAB 1FE6A 1LT9A 4B86A 1G1IA 2Q6QA 1M90Q 4YT0D 1DEBA 3L74E 1E7PC 2HPCB 1NU1D 4YXDC 1DIPA 3BVHA 5KLIB 3TSIA 1RY3A 3IR9A 4Y28J 2ZXEB 1FZAA 2WSEJ 2YMKA 1T2KC 3CWBG 2IDBA 4JYCA 1AV1A 2NPSD 1HJ0A 1SQQD 2BS2C 2XDJA 3BRVB 2ZJSE 4W7YA 1KORA 2GUSA 3RK3D 3VR8C 1YTZI 3IAOA 4PD4E 3VMYA 2BCCE 3MP7B 2WT7A 1BE3G 3AEGD 2Q9IA 4YTND 1BCCE 2WP9D 2E43A 4GIFA 3L71J 3FX0A 1GU5A 1S5LX 3A0BE 3V2PA 1M8OB 2P67A 4D6TG 1EQ7A 4R4MA 4LLHA 4DHJA 4GODA 1BE3J 1JCCA 1DD4A 2MJZA 2YNYA 5KJ7A 3SFED 2Z5HA 4TLFA 3HUSB 3A3YB 1K05A 3VRAD 2AXTH 3L74G 3BASA 1NTZE 2WDRD 2KOGA 3U1AA 4YSZD 3CCUP 2JJLA 2WPSA 5APUA 2JEEA 1AVOA 3NXSA 4AUWA 4I2LC 4WBAA 2LXCB 4OGQB 1L0ND 1MZ9A 4OH8B 5CCGD 1G1JA 3L74J 1GL2A 3E1RA 1OW7A 2WSFJ 5AVWB 3UIAA 4YSXC 3B4SA 4AYCA 2Y0EA 1R5SA 3H1JD 1SQVE 2H43A 2KNCB 2GA1A 2ZFYA 1WRGA 4TT3H 1BGYJ 2IX7C 3AECC 2LXBA 4O9BA 2BCCG 1FDOA 3R2PA 1NVOA 3AE6D 5TISH 1LJ2A 1L0LD 1BCCG 4H13D 3P4PD 1SQBD 2B87A 5CCHA 3RK3B 2E76B 3EFGA 2R5BA 3AE7C 2L5GB 1JY2P 4WY4C 1H8AA 1LTBC 4PV1C 2E75B 5CBOA 5AW7B 1KC8Q 1NTZG 1NAFA 1QEXA 2KP8A 1LT9C 1L2PA 3VRBC 1N7SD 5KAFE 2W90A 3PTZA 3VYIA 3RBZA 1OXZA 3AE5D 5AW8B 1NTKE 1BSHA 1IZNB 3T97A 3C8VA 1NTZJ 2YKPA 5KAIE 1QL1A 2W83C 1L4AD 3L72E 5B5EH 3AE1C 1ZV8A 1P84D 3OA7A 1SQVG 1XTGB 3V4QA 4YTPC 4OWFA 3TNUA 2ZFCA 2ZT9B 3H1KD 2KXPB 2O01N 1GTWA 3AE2C 1KB9D 2WQYC 2H89C 2CPBA 4JBZA 3TGUJ 1FBMA 1IFDA 1SP4A 4C46A 2ZVNB 5C2TD 3EQ2A 3M9QA 4XFJA 1HGZA 2WSCJ 5AVQB 3Q1MA 1SQXK 2J58A 1QVFO 1Y8AA 1KD1Q 3W68A 4U3FD 4EYYQ 1GK4A 1KQLA 2A45G 2QJPC 3TGUD 2WS3D 1YIJP 5KJ7C 3B5NB 1S5LH 2M5AA 5AVTB 2FBWC 1VQOP 3H1LD 1DX7A 1LWUA 5CJ4A 4U7JA 3GHGA 1NTKG 1VQ9P 1GZLA 2O1JA 2O01H 3CX5E 2OTLP 3L72G 1JY3N 1PPJG 1M56D 2WU2C 5APYA 3V2QA 4HH2A 5AVYB 1GL2C 1DD3A 5KLVE 2E5YA 3D6ZA 4KJMA 1X0TA 2FY8A 3C1LA 3G3ZA 2I1JA 2QG4A 4DHZA 4HYTB 5APVA 2IYOA 1LTTC 1FDIA 2OARA 2E74C 1SQPE 1S4XA 5CCHC 1EDKA 5AW6B 2H88D 3V6IA 2FYUK 2JWAA 2WSEH 3N7NA 4K3AA 1RF1B 2YIUB 5GTHE 3CC4P 3AE9C 4WY4B 1FZCA 3L70G 2W8ZA 4PV1B 3HTKB 1W5CE 1JM0A 1FJKA 1VF5D 1GDTA 3D70A 3H32B 1OVRA 1U57A 2OYIA 1VQNP 1JUNA 1URQB 1FC2C 1KYOI 2WDVC 1S2EA 5AW2B 1L0VD 4LDTA 3Q5RA 3AE8D 5KLVG 2V7QJ 3LIEA 2QE7H 2IBZE 4N6JA 2HR3A 4ASVA 1M7LA 1PL5A 2A06E 2CPSA 2Q5UA 3VOPA 1NEKC 3L75E 3RL0D 3P4QC 1KQGB 1YQ3D 4H0LB 5CCGA 1NAYA 2UWJE 4WWIA 1NU1E 2FFDA 3GF3A 1NTMJ 3E1IA 1USDA 5E79E 1A02F 3ABVD 2WDQD 1IK9A 1E79H 1LT1A 1QLED 3I5CA 2O3JA 1KFNA 5AW4B 1VQMP 3A0HE 1SQPJ 5AVZB 2B76D 2HODB 3USSA 2D2CB 1HF9A 2QJPB 3CCLP 1KFYC 5AVXB 2BS3C 4GOFA 3VN0A 3BCCD 3AEBD 1H89A 3GF7A 4RKUJ 1LWUC 3P4RC 1SFCB 1SS1A 2NRGA 3AEFD 3GHGC 3PHLA 1M1JB 4ZNCA 1JY3P 3WUTA 3H1ID 1MKMA 1OWAA 5APXA 5C3JC 1NENC 3M0DA 2BS4C 1RQVA 2IBZG 1N7SA 1BDDA 1LTJA 4PD4H 2A06G 4YT0C 1VQLP 1OX3A 1SQXD 2PRRA 1N8RQ 3L75G 3SFDD 3L71E 1K9MQ 4BRYB 2P10A 3HE4A 4PD4I 3CCJP 1NU1G 4KX6C 4EI2A 1LTIC 3A0BH 2QVAA 3M06A 3FGAD 1GU4A 1OMIA 4IL6E 4M3LA 1L0NE 1IFNA 1J2JB 5AVVB 5B66E 1Q86Q 2E74B 1RH5B 1YQ4C 1NU1J 1K8AQ 3MHVA 3L36A 2WTYA 2K9JA 3AEGC 1GD2E 4OGQD 2WP9C 1FZCC 4YSYD 1FZFA 2ZAEB 1L0LE 4DCKA 2C9NY 1JEKA 1SQQJ 3MGNA 1KV4A 3JCUE 4I1LA 4WVZA 3CI9A 1NTZK 1E5WA 1IJDB 2Q7CA 1UIXA 1PP9J 2K37A 1OIPA 1BGYE 2OYHA 2OYIC 3AE3D 2QJKC 2ZYDA 1S3JA 3L71G 2WSCH 3CCQP 1IC2A 1JY3O 4A7PA 1FDMA 1SQVK 5L8RJ 2FYUD 1ZR2A 1PP9D 2E76D 4LC1A 1EDJA 2E5TA 4OVNF 3VR9D 2N1TA 4I6MC 5APTA 5CCGC 4ZKPA 4N78D 3CMAP 2E75D 3BRTB 2OYOA 2K1AA 3MIWA 4I7ZB 2FFDC 4YTMD 1KN7A 4DJGA 3CIRD 2JR8A 2P2UA 1OW8A 1T3UA 2A45H 3B71A 2C0WA 5KAFH 1L0NJ 1R8EA 3H1HD 3P4PC 4UB6E 4GOEA 1L0LG 2A45I 1KYOD 3FXDA 4C7NA 1J1EB 2C0XA 3CWBD 3CD6P 4KHXA 2ZYAA 3RL0g 3H1JJ 5KAIH 1T2KD 3HD7A 1XTCC 3CLQA 3LW5J 1BGYG 1J1DC 1IFIA 1L0LJ 2ZT9D 3Q5SA 2K9YA 1NTKK 3GHGB 1SQBJ 5DJUB 3PRJA 2QJYC 1VQ6P 3AEDC 1KILA 2J5UA 3M0DC 3M0AA 4U3FE 2H7HA 3H6PA 4ZKUA 4BXLA 3TGUE 4RJTA 3W67A 1N7SC 2LKMA 1LTJC 3RK2C 1N73B 1JMMA 1NO4A 2POHA 3H1LE 3S1KA 3U1CA 4GKGA 2KSJA 4D6TD 2IZ0A 2O1KA 1JCDA 1K73Q 1ZRTD 3CXHD 2YKOA 3A7OA 5AVSB 1ZR4A 2OTKE 4EIJA 4YXWH 3B5ND 3GG2A 4GDOA 1QVGO 2IYPA 1GW4A 3VONA 1Z56A 1ZOYD 1OFCX 1PV3A 1LGHB 2FYZA 1CW5A 5C2TC 4GT1A 5H2FE 3CCVP 1EZVE 1Q2NA 3CX5H 3H1KJ 2BEZF 3VMZA 3CX5I 2QA4P 4Z1MH 1Y9BA 1JMBA 2YMYA 3I55P 4IL6X 2BCCD 5CJ0A 1H0TB 3SWFA 1CZQA 4U3FG 4QMAA 2OYHC 3TGUG 2OYIB 2PFXA 4KT0J 1LP1B 4JYBA 1Q81Q 3D6YA 3H1LG 3CMEP 1HGVA 5KLVK 1NYHA 3MD0A 2ITAA 1G2CB 1OVVA 2QSIA 2R32A 1BDCA 2ACZD 1KILE 1AQ5A 1YBKA 4U3FJ 5TJHA 3AE7D 1QX8A 2JKVA 2RN0A 2N1TC 1HWTC 3MTUE 2AEJA 2VRSA 1ZLLA 2K88A 1CI6B 4WY4D 3H1LJ 2FYNC 4PV1D 5GTHH 1KF6D 1NJIQ 1FZEA 3VP9A 1KQSO 2RMZA 3CL3D 1MFZA 1NKNA 1QL2A 4ASWA 4AQRD 1EZVG 1URQD 4DDIA 3L4FA 1NKZB 3CCSP 1JY2O 2G8YA 4JQ0D 1SQVD 2XZRA 3AE1D 3HD7C 3I56P 4H44C 2PP6A 2FKWB 4UB8E 3O6QB 2HLOA 2WVRA 4Y99C 4H0LD 4EDFA 3Q2YA 2IBZI 1KILC 3KZIE 1ZN5A 4K35A 3G6EP 2M3EA 4XE5B 1NTME 4DZOA 5KTBA 2KNCA 3IN6A 2HYNA 5E79H 5GTIE 1RQUA 1S9KE 1KTMA 3BCCE 5AW0B 3NTNA 3WU2E 1KMIZ 2OGUA 2NPSA 2GUVA 5KKZC 3P8MC 1OZHA 1YITP 2KUBA 3H1IE 2D2CD 3A0HH 5AW9B 1AQTA 2Q3IA 5KJ7D 3HE5A 1FS0E 2FBWD 2KZIA 1YJNP 3RL0C 2Q1KA 1YQ3C 1SFCD 1NTKD 1SQXE 3A2AA 3L73D 1H88A 4PJ0E 2RH0A 4HB1A 3L72D 3PP5A 3EFFK 1PPJD 2KYVA 2K9JB 1ZMEC 3AEAD 3SWKA 3ABVC 2WDQC 2N9BA 1NOHA 1LT9B 2AEMA 2WU2D 2AXCA 4RESB 1W2EA 1Q90D 2P7JA 5KLIC 2OQQA 4DT0A 2WZ7A 1PGOA 4IFDK 1NTMG 1T8ZA 4NPDA 2OYHB 3P4SD 3G71P 1MFTA 2KI7B 2WU5C 5DJTB 3BCCG 4WB4A 1VQ5P 2KK7A 2IZ1A 3M9BA 4IL6H 3SSUA 2E74D 3AEFC 1EXJA 1PGPA 1HBWA 5B66H 1SQPG 3KQGA 5AW5B 3Q3DA 3JSVC 2WT7B 2N1TB 3L70D 1JO5A 3BCCJ 4RO0A 2QIWA 3M91A 1LTSC 1SVFA 3SFDC 1SQQE 1X79B 3TF5A 3QH9A 1SLQA 2B9BA 3JCUH 3H1IJ 2WSFH 4DHIB 3RK3E 1PP9E 4IFMA 3FWNA 3HUSC 2Y0CA 3S4RA 3TDKA 4LGDE 1L0LK 2WDVD 1U7JA 1RF0A 5KLVD 1D7MA 4L74A 1SQXJ 3AE4D 1VQKP 2R5DA 3HD7B 2AEFA 1X22A 4OGQC 1JTHA 2L91A 4YSYC 1YJ9P 4NPFX 3P4QD 1GL2B 3H1HE 1ZW0A 1UIIA 2XU6A 3H25A 1KYOE 1KILB 5APQA 3CWBE 1ZP0D 1L4AA 1N7LA 4NPEA 2FXPA 2NPSC 4L73A 1BSNA 1Y47A 2B87B 5BU8B 1SQQG 2O01J 1IK7A 4UB6H 2WPRA 1PZQA 3CCEP 2IFMA 2XV5A 3RK3C 3CC7P 2E76C 3H1JE 1PP9G 5APSA 2KS1A 3PH0A 2JWDA 2KIKA 4BWNA 1RF1A 4YTNC 3P8CD 3P4RD 2E75C 1RE3C 1SQBE 3A5TA 1ZRTE 2Y9ZA 3CXHE 2IBZD 5C3JD 3AEED 2FYUJ 3F89A 2A06D 1VQ4P 3SFEC 2B89A 3L75D 3MZWB 1URQA 2C9LY 2Z4EA 3T97B 3VRAC 2ZVOB 3H1HG 3BATA 4IOIH 4KX6D 2WDRC 1FJPA 5M1BA 2WITA 1LTAC 4YSZC 1AVYA 2R3CA 2ZYGA 2B88A 3D71A 3TNUB 1PGQA 3WMM0 2ZT9C 4JF7A 2RKLA 3H1HJ 1L0NG 1YQ4D 5AW3B 2Q3EA 3CWBJ 1NHLA 1Q82Q 3V4WA 1EXIA 1P84E 3H1JG 3WUVA 2XNDH 3AE6C 1IO4A 1KZUB 5H2FH 4H13C 3KHUA 1NGMB 4YXDD 3H1KE 3E7KA 2Y0DA 1KB9E 1SQBG 2HODA 1EZVI 3B5NC 1RE4A 2M5AB 3G4SP 1GK6A 1RF0C
chains in the Genus database with same CATH topology
1MKMA 2MKVA 1S5LX 1ZRTE 2FBWC 5C3JC 3RK3E 1NENC 2BEQD 2FBWD 4PV1C 1U57A 2E75B 2FYNC 2BS4C 1RQVA 1ZOYC 5C3JD 3AEED 4PV1D 1KFYD 5L8RJ 1KF6D 1TU3F 1YQ3C 1GMJA 2E76D 1L0VC 2WDVC 3AE9D 4R4MA 3VR8D 1L0VD 4U7JA 3SFEC 2WDVD 4YT0C 1PIXA 3VR9C 1KQFB 3AE8C 1DD4A 2NZ2A 3GMAA 3Q5RA 3SFED 1JB0J 3VR9D 4GDOA 3AE8D 3SFDD 4I7ZC 2V7QJ 3VRBC 2P10A 3AE4D 3T97B 1ZP0C 2E75D 1ZMEC 1K05A 3AEAD 3P4SC 3ABVC 4R4LA 3VRAC 4KX6C 2WDQC 2WU2C 3VRAD 4YTMC 3AE5C 4I7ZB 4KX6D 2WDRC 2WU2D 1OW6A 4YTMD 3AE5D 4H0LC 3S9OA 2WDRD 1PL5A 1NEND 5M1BA 3CIRC 2WPVB 2JO1A 4YSZC 1NEKC 3C8VA 1ZOYD 3R4YA 3FGAD 3CIRD 1PV3A 1DD3A 2G8YA 3EWKA 4OGQC 4YSZD 1OMIA 1OW8A 1Q90D 1KQGB 3P4QC 1YQ3D 4YSYC 4H0LB 3B71A 3D6ZA 1QLBC 3P4QD 3D71A 5KLIC 3AE1C 4YT0D 2OQQA 5C2TC 3AE1D 4YTPC 2ZT9C 4OGQB 2E74B 1E7PC 3H25A 3GF3A 1R8EA 3VRBD 1YQ4C 4YXDC 4H44C 1DIPA 3P4PC 1VL2A 3G9RA 1YQ4D 4H44D 1OW7A 2WSFJ 1ZP0D 3P4SD 4Y28J 3ABVD 2ZT9B 2WDQD 2WSEJ 3AE2C 4H13B 4H44B 2BEZF 4YSXC 2ACZC 2WU5C 1FDIA 2YMKA 4H0LD 1K04A 2WU5D 3RL0g 4Z1MH 2WQYC 3Q5PA 1Y9BA 3Q2YA 2E74C 3AEGC 1EXIA 1NEKD 2FXPA 4OGQD 2WP9C 2H89C 2E74D 2IDBA 2D2CC 3AEFC 3O6QA 4IL6X 4TT3H 4YSYD 3AECC 3AE6C 1EXJA 3LW5J 1FDOA 1HJ0A 2B76C 3AE6D 2H88C 2BS2C 1VF5B 2B76D 5C2TD 2YIUC 2H88D 4YTPD 1WMKA 1IK7A 2O01J 2ZT9D 3GLMA 3IN6A 4H13C 2D2CB 4KT0J 3Q3DA 3Q5SA 1AJYA 1HF9A 4H13D 4XFJA 1NGMB 2K9YA 1KORA 3AEEC 3P4PD 2JP3A 1KFYC 1RQUA 4YXDD 1KTMA 3D6YA 1KF6C 2WSCJ 2BS3C 2QJYC 1UIXA 2E76C 3AEBC 3AEDC 1KMIZ 3Q1MA 1S1CX 3AE9C 3VR8C 2J5UA 1NYHA 3AEBD 3AEDD 3IAOA 3AE2D 2G3AA 2QIWA 2QSIA 3GF7A 4RKUJ 5KKZC 4YSXD 4PV1B 2ACZD 1VF5C 1KILE 3SFDC 3P4RC 4YTNC 1VF5D 2E76B 2WQYD 3AE3C 2WS3C 3AEGD 3AE7C 3P4RD 4YTND 2WS3D 2WP9D 2QJPC 2H89D 3D70A 2D2CD 3AE4C 3AE3D 3AE7D 3AEFD 2E75C 3AEAC 2QJKC 3AECD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FBW C;  5C3J C;  1NEN C;  2FBW D;  5C3J D;  2BS4 C;  1ZOY C;  3AEE D;  1KFY D;  1KF6 D;  1YQ3 C;  1L0V C;  2WDV C;  3AE9 D;  3VR8 D;  1L0V D;  3SFE C;  2WDV D;  4YT0 C;  3VR9 C;  3AE8 C;  3SFE D;  3VR9 D;  3AE8 D;  3SFD D;  3VRB C;  3AE4 D;  3P4S C;  1ZP0 C;  3VRA C;  1K05 A;  3AEA D;  3ABV C;  4KX6 C;  2WDQ C;  2WU2 C;  3VRA D;  4YTM C;  3AE5 C;  4KX6 D;  2WDR C;  2WU2 D;  1OW6 A;  4YTM D;  3AE5 D;  3S9O A;  2WDR D;  1NEN D;  3CIR C;  4YSZ C;  1NEK C;  1ZOY D;  3CIR D;  1PV3 A;  4YSZ D;  1OW8 A;  3P4Q C;  4YSY C;  1YQ3 D;  3B71 A;  1QLB C;  3P4Q D;  3AE1 C;  4YT0 D;  5C2T C;  3AE1 D;  4YTP C;  1E7P C;  3VRB D;  1YQ4 C;  4YXD C;  3P4P C;  1YQ4 D;  1OW7 A;  1ZP0 D;  3P4S D;  3ABV D;  2WDQ D;  3AE2 C;  4YSX C;  2ACZ C;  2WU5 C;  1K04 A;  2WU5 D;  2WQY C;  1NEK D;  3AEG C;  2WP9 C;  2H89 C;  3AEF C;  4YSY D;  3AEC C;  3AE6 C;  2B76 C;  3AE6 D;  2H88 C;  2BS2 C;  2B76 D;  5C2T D;  2H88 D;  4YTP D;  4YXD D;  3AEE C;  3P4P D;  1KFY C;  1KTM A;  1KF6 C;  2BS3 C;  3AED C;  3AEB C;  3AE9 C;  3VR8 C;  3AED D;  3AEB D;  3AE2 D;  2G3A A;  4YSX D;  2ACZ D;  3SFD C;  3P4R C;  4YTN C;  2WQY D;  2WS3 C;  3AE3 C;  3AEG D;  3AE7 C;  3P4R D;  4YTN D;  2WS3 D;  2WP9 D;  2H89 D;  3AE3 D;  3AEF D;  3AE4 C;  3AE7 D;  3AEA C;  3AEC D; 
#chains in the Genus database with same CATH topology
 3L71 D;  1LWU B;  1SFC A;  4MN4 C;  3SWY A;  4D6T J;  1M1J A;  1ZOY C;  1TU3 F;  2HFE D;  3VR8 D;  2YO3 A;  3K5B A;  3KXD A;  1BE3 D;  3VTP C;  3GW6 A;  2J59 M;  2M3B A;  3AE5 C;  4C7R A;  1OW6 A;  4BRY A;  1NH4 A;  3C9I A;  3R4Y A;  1L4A C;  4EOT A;  1PFI A;  2NPS B;  3L74 D;  2Y9Y A;  1FU1 A;  3U59 A;  2ACZ C;  2WPQ A;  3H1K G;  2LR2 A;  3Q5P A;  1RHZ B;  4IFF A;  3HE5 B;  1YHQ P;  2BCC J;  2V7Q H;  1BGY D;  2WSS H;  3VP8 A;  1RF1 C;  2YIU C;  1BCC J;  3NMD A;  5CBN A;  1FZC B;  2GM4 A;  3LID A;  4UB8 H;  4L76 A;  1KF6 C;  2ZXX A;  2YKQ A;  2HPC A;  1S1C X;  2BAS A;  1Q7Y Q;  3AED D;  1AA0 A;  3P32 A;  4YSX D;  2CK3 H;  4DOJ A;  2I1K A;  4PD4 D;  2WS3 C;  3KZI H;  1WT6 A;  3AEC D;  1M57 D;  3RK2 D;  1LTG C;  1BCC D;  2MKV A;  2WMM A;  2AXT E;  1URQ C;  5GTI H;  2QJK B;  3WU2 H;  3L73 E;  1W2B O;  2K3R A;  1NTM K;  2W6B A;  1KQF B;  1GW3 A;  1PPJ E;  1KFM A;  5K5G B;  3NFQ A;  1X8Y A;  3QWO C;  2M0B A;  4H0L C;  2JO1 A;  1FZG A;  2HG5 D;  1NTZ D;  5EFW B;  1SQP K;  2FFD B;  3V5B A;  3PLN A;  1SQV J;  4PJ0 H;  5TIS E;  3V2R A;  2PAJ A;  4L75 A;  3VRB D;  5AVU B;  1IFJ A;  1VPC A;  3HUS A;  1HTL C;  4H13 B;  1FOS E;  1K04 A;  5AVR B;  2JDI H;  2D2C C;  3HRN A;  5APW A;  2SPZ A;  2H88 C;  1RE4 C;  2KSE A;  1YTZ T;  4YTP D;  4JPZ B;  3L70 E;  2IFN A;  1IFM A;  1J1D B;  1SFC C;  3KYQ A;  2QEX P;  3ITK A;  3AE2 D;  1M1J C;  1N2D C;  1VF5 C;  3IF4 A;  3PJS K;  3VMX A;  2QJY B;  2R3S A;  3L73 G;  2WQY D;  1JOC A;  3CCM P;  2V4H A;  4HJG H;  2H89 D;  3AEA C;  1T3J A;  1N7S B;  1JTH B;  3MUD A;  2N1T D;  1LTJ B;  3RBX A;  2BEQ D;  3RK2 B;  1VQ8 P;  1N73 A;  4YPC A;  1FZB A;  3B8E B;  1L0V C;  1NTK J;  1USE A;  2W27 A;  3HE4 B;  2WWW A;  3L73 J;  5B5E E;  1NU1 K;  1YI2 P;  3AE8 C;  2PGD A;  2FXO A;  3L72 J;  4W80 A;  1L4A B;  3O8Z A;  2IPP A;  1JNM A;  5BVZ A;  3P4S C;  4R4L A;  1EZV D;  3CPW O;  2H8P D;  3N4X A;  3CCR P;  1CSB A;  1SQQ K;  3EWK A;  1EDI A;  4XA4 A;  2P58 A;  4CPG A;  1N86 A;  1RE3 A;  3ZDM A;  3IFM A;  3CC2 P;  2YXR B;  2QM8 A;  1VL2 A;  3HD7 D;  3M9H A;  2KS1 B;  3G9R A;  4H44 D;  4ZMD A;  3VMA A;  1A02 J;  4FJV A;  1GL2 D;  3P7K A;  4W7Z A;  1AFO A;  1YJW P;  1ZXG A;  2I8D A;  1KIL D;  2B76 C;  1VDF A;  1S5L E;  1KYO H;  1PGJ A;  1WMK A;  4DDG A;  1H0T A;  2N9Y B;  5C39 A;  3AEB C;  3L70 J;  1HVV A;  3FWL A;  1EDL A;  1MV8 A;  3RGU A;  2G3A A;  2W6A A;  3P8C E;  1LP1 A;  2XNX A;  1S72 P;  3AE4 C;  5CCH D;  1G2C A;  1DEE G;  3KPE A;  3H1I G;  3TK1 A;  2KZJ A;  2P1J A;  3AE9 D;  1L0N K;  1CI6 A;  2FYN B;  1PIX A;  5KLV J;  3GMA A;  3LW5 H;  3OAK A;  1MUU A;  3L35 A;  4I7Z C;  1QGK B;  1SQX G;  1ZP0 C;  3CX5 D;  1IFP A;  3CXH H;  2FYU E;  3S9O A;  1FOS F;  3L37 A;  1NWQ A;  3B5N A;  2WPV B;  1R5L A;  2Z5I A;  3CXH I;  1QLB C;  1TFF A;  5AW1 B;  4C7N B;  5BU5 A;  2YXQ B;  4N78 E;  1J1E C;  1SQB K;  5CMZ A;  1NTM D;  3II6 A;  5CHX A;  2OTJ P;  3F5H A;  3KDP B;  1S9K D;  4H44 B;  2KLV A;  2KLU A;  3FXE A;  2WU5 D;  1FAV A;  1M1K Q;  1NEK D;  2R44 A;  3O6Q A;  4I6L A;  4Y99 B;  1SQP D;  1T6A A;  1OVU A;  3V2N A;  1DH3 A;  1VF5 B;  3GLM A;  1AJY A;  3AEE C;  2JP3 A;  2E42 A;  3OW2 O;  1EC5 A;  2FXM A;  3MUD C;  2XKM A;  2DW3 A;  1VQP P;  4HKZ H;  1N73 C;  1VQ7 P;  1P84 H;  3AE3 C;  3WUU A;  1HUC A;  5KKZ B;  3JC2 2;  1HJB A;  2KB7 P;  1P84 I;  1X9V A;  2W6J H;  2QRX A;  1U7M A;  2M8R A;  1KB9 H;  1KFY D;  4N3Y B;  1HH0 A;  1YYC A;  1BE3 E;  1GMJ A;  2FYU G;  3TYY A;  2YO2 A;  3L75 J;  3VR9 C;  2NZ2 A;  1JB0 J;  3RL0 B;  1KB9 I;  4WY4 A;  3HTK A;  4D6T E;  1LNQ A;  4YTM C;  1JY2 N;  3H32 A;  2QM7 A;  1NEN D;  3CIR C;  3OJA B;  1FE6 A;  1LT9 A;  4B86 A;  1G1I A;  2Q6Q A;  1M90 Q;  4YT0 D;  1DEB A;  3L74 E;  1E7P C;  2HPC B;  1NU1 D;  4YXD C;  1DIP A;  3BVH A;  5KLI B;  3TSI A;  1RY3 A;  3IR9 A;  4Y28 J;  2ZXE B;  1FZA A;  2WSE J;  2YMK A;  1T2K C;  3CWB G;  2IDB A;  4JYC A;  1AV1 A;  2NPS D;  1HJ0 A;  1SQQ D;  2BS2 C;  2XDJ A;  3BRV B;  2ZJS E;  4W7Y A;  1KOR A;  2GUS A;  3RK3 D;  3VR8 C;  1YTZ I;  3IAO A;  4PD4 E;  3VMY A;  2BCC E;  3MP7 B;  2WT7 A;  1BE3 G;  3AEG D;  2Q9I A;  4YTN D;  1BCC E;  2WP9 D;  2E43 A;  4GIF A;  3L71 J;  3FX0 A;  1GU5 A;  1S5L X;  3A0B E;  3V2P A;  1M8O B;  2P67 A;  4D6T G;  1EQ7 A;  4R4M A;  4LLH A;  4DHJ A;  4GOD A;  1BE3 J;  1JCC A;  1DD4 A;  2MJZ A;  2YNY A;  5KJ7 A;  3SFE D;  2Z5H A;  4TLF A;  3HUS B;  3A3Y B;  1K05 A;  3VRA D;  2AXT H;  3L74 G;  3BAS A;  1NTZ E;  2WDR D;  2KOG A;  3U1A A;  4YSZ D;  3CCU P;  2JJL A;  2WPS A;  5APU A;  2JEE A;  1AVO A;  3NXS A;  4AUW A;  4I2L C;  4WBA A;  2LXC B;  4OGQ B;  1L0N D;  1MZ9 A;  4OH8 B;  5CCG D;  1G1J A;  3L74 J;  1GL2 A;  3E1R A;  1OW7 A;  2WSF J;  5AVW B;  3UIA A;  4YSX C;  3B4S A;  4AYC A;  2Y0E A;  1R5S A;  3H1J D;  1SQV E;  2H43 A;  2KNC B;  2GA1 A;  2ZFY A;  1WRG A;  4TT3 H;  1BGY J;  2IX7 C;  3AEC C;  2LXB A;  4O9B A;  2BCC G;  1FDO A;  3R2P A;  1NVO A;  3AE6 D;  5TIS H;  1LJ2 A;  1L0L D;  1BCC G;  4H13 D;  3P4P D;  1SQB D;  2B87 A;  5CCH A;  3RK3 B;  2E76 B;  3EFG A;  2R5B A;  3AE7 C;  2L5G B;  1JY2 P;  4WY4 C;  1H8A A;  1LTB C;  4PV1 C;  2E75 B;  5CBO A;  5AW7 B;  1KC8 Q;  1NTZ G;  1NAF A;  1QEX A;  2KP8 A;  1LT9 C;  1L2P A;  3VRB C;  1N7S D;  5KAF E;  2W90 A;  3PTZ A;  3VYI A;  3RBZ A;  1OXZ A;  3AE5 D;  5AW8 B;  1NTK E;  1BSH A;  1IZN B;  3T97 A;  3C8V A;  1NTZ J;  2YKP A;  5KAI E;  1QL1 A;  2W83 C;  1L4A D;  3L72 E;  5B5E H;  3AE1 C;  1ZV8 A;  1P84 D;  3OA7 A;  1SQV G;  1XTG B;  3V4Q A;  4YTP C;  4OWF A;  3TNU A;  2ZFC A;  2ZT9 B;  3H1K D;  2KXP B;  2O01 N;  1GTW A;  3AE2 C;  1KB9 D;  2WQY C;  2H89 C;  2CPB A;  4JBZ A;  3TGU J;  1FBM A;  1IFD A;  1SP4 A;  4C46 A;  2ZVN B;  5C2T D;  3EQ2 A;  3M9Q A;  4XFJ A;  1HGZ A;  2WSC J;  5AVQ B;  3Q1M A;  1SQX K;  2J58 A;  1QVF O;  1Y8A A;  1KD1 Q;  3W68 A;  4U3F D;  4EYY Q;  1GK4 A;  1KQL A;  2A45 G;  2QJP C;  3TGU D;  2WS3 D;  1YIJ P;  5KJ7 C;  3B5N B;  1S5L H;  2M5A A;  5AVT B;  2FBW C;  1VQO P;  3H1L D;  1DX7 A;  1LWU A;  5CJ4 A;  4U7J A;  3GHG A;  1NTK G;  1VQ9 P;  1GZL A;  2O1J A;  2O01 H;  3CX5 E;  2OTL P;  3L72 G;  1JY3 N;  1PPJ G;  1M56 D;  2WU2 C;  5APY A;  3V2Q A;  4HH2 A;  5AVY B;  1GL2 C;  1DD3 A;  5KLV E;  2E5Y A;  3D6Z A;  4KJM A;  1X0T A;  2FY8 A;  3C1L A;  3G3Z A;  2I1J A;  2QG4 A;  4DHZ A;  4HYT B;  5APV A;  2IYO A;  1LTT C;  1FDI A;  2OAR A;  2E74 C;  1SQP E;  1S4X A;  5CCH C;  1EDK A;  5AW6 B;  2H88 D;  3V6I A;  2FYU K;  2JWA A;  2WSE H;  3N7N A;  4K3A A;  1RF1 B;  2YIU B;  5GTH E;  3CC4 P;  3AE9 C;  4WY4 B;  1FZC A;  3L70 G;  2W8Z A;  4PV1 B;  3HTK B;  1W5C E;  1JM0 A;  1FJK A;  1VF5 D;  1GDT A;  3D70 A;  3H32 B;  1OVR A;  1U57 A;  2OYI A;  1VQN P;  1JUN A;  1URQ B;  1FC2 C;  1KYO I;  2WDV C;  1S2E A;  5AW2 B;  1L0V D;  4LDT A;  3Q5R A;  3AE8 D;  5KLV G;  2V7Q J;  3LIE A;  2QE7 H;  2IBZ E;  4N6J A;  2HR3 A;  4ASV A;  1M7L A;  1PL5 A;  2A06 E;  2CPS A;  2Q5U A;  3VOP A;  1NEK C;  3L75 E;  3RL0 D;  3P4Q C;  1KQG B;  1YQ3 D;  4H0L B;  5CCG A;  1NAY A;  2UWJ E;  4WWI A;  1NU1 E;  2FFD A;  3GF3 A;  1NTM J;  3E1I A;  1USD A;  5E79 E;  1A02 F;  3ABV D;  2WDQ D;  1IK9 A;  1E79 H;  1LT1 A;  1QLE D;  3I5C A;  2O3J A;  1KFN A;  5AW4 B;  1VQM P;  3A0H E;  1SQP J;  5AVZ B;  2B76 D;  2HOD B;  3USS A;  2D2C B;  1HF9 A;  2QJP B;  3CCL P;  1KFY C;  5AVX B;  2BS3 C;  4GOF A;  3VN0 A;  3BCC D;  3AEB D;  1H89 A;  3GF7 A;  4RKU J;  1LWU C;  3P4R C;  1SFC B;  1SS1 A;  2NRG A;  3AEF D;  3GHG C;  3PHL A;  1M1J B;  4ZNC A;  1JY3 P;  3WUT A;  3H1I D;  1MKM A;  1OWA A;  5APX A;  5C3J C;  1NEN C;  3M0D A;  2BS4 C;  1RQV A;  2IBZ G;  1N7S A;  1BDD A;  1LTJ A;  4PD4 H;  2A06 G;  4YT0 C;  1VQL P;  1OX3 A;  1SQX D;  2PRR A;  1N8R Q;  3L75 G;  3SFD D;  3L71 E;  1K9M Q;  4BRY B;  2P10 A;  3HE4 A;  4PD4 I;  3CCJ P;  1NU1 G;  4KX6 C;  4EI2 A;  1LTI C;  3A0B H;  2QVA A;  3M06 A;  3FGA D;  1GU4 A;  1OMI A;  4IL6 E;  4M3L A;  1L0N E;  1IFN A;  1J2J B;  5AVV B;  5B66 E;  1Q86 Q;  2E74 B;  1RH5 B;  1YQ4 C;  1NU1 J;  1K8A Q;  3MHV A;  3L36 A;  2WTY A;  2K9J A;  3AEG C;  1GD2 E;  4OGQ D;  2WP9 C;  1FZC C;  4YSY D;  1FZF A;  2ZAE B;  1L0L E;  4DCK A;  2C9N Y;  1JEK A;  1SQQ J;  3MGN A;  1KV4 A;  3JCU E;  4I1L A;  4WVZ A;  3CI9 A;  1NTZ K;  1E5W A;  1IJD B;  2Q7C A;  1UIX A;  1PP9 J;  2K37 A;  1OIP A;  1BGY E;  2OYH A;  2OYI C;  3AE3 D;  2QJK C;  2ZYD A;  1S3J A;  3L71 G;  2WSC H;  3CCQ P;  1IC2 A;  1JY3 O;  4A7P A;  1FDM A;  1SQV K;  5L8R J;  2FYU D;  1ZR2 A;  1PP9 D;  2E76 D;  4LC1 A;  1EDJ A;  2E5T A;  4OVN F;  3VR9 D;  2N1T A;  4I6M C;  5APT A;  5CCG C;  4ZKP A;  4N78 D;  3CMA P;  2E75 D;  3BRT B;  2OYO A;  2K1A A;  3MIW A;  4I7Z B;  2FFD C;  4YTM D;  1KN7 A;  4DJG A;  3CIR D;  2JR8 A;  2P2U A;  1OW8 A;  1T3U A;  2A45 H;  3B71 A;  2C0W A;  5KAF H;  1L0N J;  1R8E A;  3H1H D;  3P4P C;  4UB6 E;  4GOE A;  1L0L G;  2A45 I;  1KYO D;  3FXD A;  4C7N A;  1J1E B;  2C0X A;  3CWB D;  3CD6 P;  4KHX A;  2ZYA A;  3RL0 g;  3H1J J;  5KAI H;  1T2K D;  3HD7 A;  1XTC C;  3CLQ A;  3LW5 J;  1BGY G;  1J1D C;  1IFI A;  1L0L J;  2ZT9 D;  3Q5S A;  2K9Y A;  1NTK K;  3GHG B;  1SQB J;  5DJU B;  3PRJ A;  2QJY C;  1VQ6 P;  3AED C;  1KIL A;  2J5U A;  3M0D C;  3M0A A;  4U3F E;  2H7H A;  3H6P A;  4ZKU A;  4BXL A;  3TGU E;  4RJT A;  3W67 A;  1N7S C;  2LKM A;  1LTJ C;  3RK2 C;  1N73 B;  1JMM A;  1NO4 A;  2POH A;  3H1L E;  3S1K A;  3U1C A;  4GKG A;  2KSJ A;  4D6T D;  2IZ0 A;  2O1K A;  1JCD A;  1K73 Q;  1ZRT D;  3CXH D;  2YKO A;  3A7O A;  5AVS B;  1ZR4 A;  2OTK E;  4EIJ A;  4YXW H;  3B5N D;  3GG2 A;  4GDO A;  1QVG O;  2IYP A;  1GW4 A;  3VON A;  1Z56 A;  1ZOY D;  1OFC X;  1PV3 A;  1LGH B;  2FYZ A;  1CW5 A;  5C2T C;  4GT1 A;  5H2F E;  3CCV P;  1EZV E;  1Q2N A;  3CX5 H;  3H1K J;  2BEZ F;  3VMZ A;  3CX5 I;  2QA4 P;  4Z1M H;  1Y9B A;  1JMB A;  2YMY A;  3I55 P;  4IL6 X;  2BCC D;  5CJ0 A;  1H0T B;  3SWF A;  1CZQ A;  4U3F G;  4QMA A;  2OYH C;  3TGU G;  2OYI B;  2PFX A;  4KT0 J;  1LP1 B;  4JYB A;  1Q81 Q;  3D6Y A;  3H1L G;  3CME P;  1HGV A;  5KLV K;  1NYH A;  3MD0 A;  2ITA A;  1G2C B;  1OVV A;  2QSI A;  2R32 A;  1BDC A;  2ACZ D;  1KIL E;  1AQ5 A;  1YBK A;  4U3F J;  5TJH A;  3AE7 D;  1QX8 A;  2JKV A;  2RN0 A;  2N1T C;  1HWT C;  3MTU E;  2AEJ A;  2VRS A;  1ZLL A;  2K88 A;  1CI6 B;  4WY4 D;  3H1L J;  2FYN C;  4PV1 D;  5GTH H;  1KF6 D;  1NJI Q;  1FZE A;  3VP9 A;  1KQS O;  2RMZ A;  3CL3 D;  1MFZ A;  1NKN A;  1QL2 A;  4ASW A;  4AQR D;  1EZV G;  1URQ D;  4DDI A;  3L4F A;  1NKZ B;  3CCS P;  1JY2 O;  2G8Y A;  4JQ0 D;  1SQV D;  2XZR A;  3AE1 D;  3HD7 C;  3I56 P;  4H44 C;  2PP6 A;  2FKW B;  4UB8 E;  3O6Q B;  2HLO A;  2WVR A;  4Y99 C;  4H0L D;  4EDF A;  3Q2Y A;  2IBZ I;  1KIL C;  3KZI E;  1ZN5 A;  4K35 A;  3G6E P;  2M3E A;  4XE5 B;  1NTM E;  4DZO A;  5KTB A;  2KNC A;  3IN6 A;  2HYN A;  5E79 H;  5GTI E;  1RQU A;  1S9K E;  1KTM A;  3BCC E;  5AW0 B;  3NTN A;  3WU2 E;  1KMI Z;  2OGU A;  2NPS A;  2GUV A;  5KKZ C;  3P8M C;  1OZH A;  1YIT P;  2KUB A;  3H1I E;  2D2C D;  3A0H H;  5AW9 B;  1AQT A;  2Q3I A;  5KJ7 D;  3HE5 A;  1FS0 E;  2FBW D;  2KZI A;  1YJN P;  3RL0 C;  2Q1K A;  1YQ3 C;  1SFC D;  1NTK D;  1SQX E;  3A2A A;  3L73 D;  1H88 A;  4PJ0 E;  2RH0 A;  4HB1 A;  3L72 D;  3PP5 A;  3EFF K;  1PPJ D;  2KYV A;  2K9J B;  1ZME C;  3AEA D;  3SWK A;  3ABV C;  2WDQ C;  2N9B A;  1NOH A;  1LT9 B;  2AEM A;  2WU2 D;  2AXC A;  4RES B;  1W2E A;  1Q90 D;  2P7J A;  5KLI C;  2OQQ A;  4DT0 A;  2WZ7 A;  1PGO A;  4IFD K;  1NTM G;  1T8Z A;  4NPD A;  2OYH B;  3P4S D;  3G71 P;  1MFT A;  2KI7 B;  2WU5 C;  5DJT B;  3BCC G;  4WB4 A;  1VQ5 P;  2KK7 A;  2IZ1 A;  3M9B A;  4IL6 H;  3SSU A;  2E74 D;  3AEF C;  1EXJ A;  1PGP A;  1HBW A;  5B66 H;  1SQP G;  3KQG A;  5AW5 B;  3Q3D A;  3JSV C;  2WT7 B;  2N1T B;  3L70 D;  1JO5 A;  3BCC J;  4RO0 A;  2QIW A;  3M91 A;  1LTS C;  1SVF A;  3SFD C;  1SQQ E;  1X79 B;  3TF5 A;  3QH9 A;  1SLQ A;  2B9B A;  3JCU H;  3H1I J;  2WSF H;  4DHI B;  3RK3 E;  1PP9 E;  4IFM A;  3FWN A;  3HUS C;  2Y0C A;  3S4R A;  3TDK A;  4LGD E;  1L0L K;  2WDV D;  1U7J A;  1RF0 A;  5KLV D;  1D7M A;  4L74 A;  1SQX J;  3AE4 D;  1VQK P;  2R5D A;  3HD7 B;  2AEF A;  1X22 A;  4OGQ C;  1JTH A;  2L91 A;  4YSY C;  1YJ9 P;  4NPF X;  3P4Q D;  1GL2 B;  3H1H E;  1ZW0 A;  1UII A;  2XU6 A;  3H25 A;  1KYO E;  1KIL B;  5APQ A;  3CWB E;  1ZP0 D;  1L4A A;  1N7L A;  4NPE A;  2FXP A;  2NPS C;  4L73 A;  1BSN A;  1Y47 A;  2B87 B;  5BU8 B;  1SQQ G;  2O01 J;  1IK7 A;  4UB6 H;  2WPR A;  1PZQ A;  3CCE P;  2IFM A;  2XV5 A;  3RK3 C;  3CC7 P;  2E76 C;  3H1J E;  1PP9 G;  5APS A;  2KS1 A;  3PH0 A;  2JWD A;  2KIK A;  4BWN A;  1RF1 A;  4YTN C;  3P8C D;  3P4R D;  2E75 C;  1RE3 C;  1SQB E;  3A5T A;  1ZRT E;  2Y9Z A;  3CXH E;  2IBZ D;  5C3J D;  3AEE D;  2FYU J;  3F89 A;  2A06 D;  1VQ4 P;  3SFE C;  2B89 A;  3L75 D;  3MZW B;  1URQ A;  2C9L Y;  2Z4E A;  3T97 B;  3VRA C;  2ZVO B;  3H1H G;  3BAT A;  4IOI H;  4KX6 D;  2WDR C;  1FJP A;  5M1B A;  2WIT A;  1LTA C;  4YSZ C;  1AVY A;  2R3C A;  2ZYG A;  2B88 A;  3D71 A;  3TNU B;  1PGQ A;  3WMM 0;  2ZT9 C;  4JF7 A;  2RKL A;  3H1H J;  1L0N G;  1YQ4 D;  5AW3 B;  2Q3E A;  3CWB J;  1NHL A;  1Q82 Q;  3V4W A;  1EXI A;  1P84 E;  3H1J G;  3WUV A;  2XND H;  3AE6 C;  1IO4 A;  1KZU B;  5H2F H;  4H13 C;  3KHU A;  1NGM B;  4YXD D;  3H1K E;  3E7K A;  2Y0D A;  1KB9 E;  1SQB G;  2HOD A;  1EZV I;  3B5N C;  1RE4 A;  2M5A B;  3G4S P;  1GK6 A;  1RF0 C; 
#chains in the Genus database with same CATH homology
 1MKM A;  2MKV A;  1S5L X;  1ZRT E;  2FBW C;  5C3J C;  3RK3 E;  1NEN C;  2BEQ D;  2FBW D;  4PV1 C;  1U57 A;  2E75 B;  2FYN C;  2BS4 C;  1RQV A;  1ZOY C;  5C3J D;  3AEE D;  4PV1 D;  1KFY D;  5L8R J;  1KF6 D;  1TU3 F;  1YQ3 C;  1GMJ A;  2E76 D;  1L0V C;  2WDV C;  3AE9 D;  4R4M A;  3VR8 D;  1L0V D;  4U7J A;  3SFE C;  2WDV D;  4YT0 C;  1PIX A;  3VR9 C;  1KQF B;  3AE8 C;  1DD4 A;  2NZ2 A;  3GMA A;  3Q5R A;  3SFE D;  1JB0 J;  3VR9 D;  4GDO A;  3AE8 D;  3SFD D;  4I7Z C;  2V7Q J;  3VRB C;  2P10 A;  3AE4 D;  3T97 B;  1ZP0 C;  2E75 D;  1ZME C;  1K05 A;  3AEA D;  3P4S C;  3ABV C;  4R4L A;  3VRA C;  4KX6 C;  2WDQ C;  2WU2 C;  3VRA D;  4YTM C;  3AE5 C;  4I7Z B;  4KX6 D;  2WDR C;  2WU2 D;  1OW6 A;  4YTM D;  3AE5 D;  4H0L C;  3S9O A;  2WDR D;  1PL5 A;  1NEN D;  5M1B A;  3CIR C;  2WPV B;  2JO1 A;  4YSZ C;  1NEK C;  3C8V A;  1ZOY D;  3R4Y A;  3FGA D;  3CIR D;  1PV3 A;  1DD3 A;  2G8Y A;  3EWK A;  4OGQ C;  4YSZ D;  1OMI A;  1OW8 A;  1Q90 D;  1KQG B;  3P4Q C;  1YQ3 D;  4YSY C;  4H0L B;  3B71 A;  3D6Z A;  1QLB C;  3P4Q D;  3D71 A;  5KLI C;  3AE1 C;  4YT0 D;  2OQQ A;  5C2T C;  3AE1 D;  4YTP C;  2ZT9 C;  4OGQ B;  2E74 B;  1E7P C;  3H25 A;  3GF3 A;  1R8E A;  3VRB D;  1YQ4 C;  4YXD C;  4H44 C;  1DIP A;  3P4P C;  1VL2 A;  3G9R A;  1YQ4 D;  4H44 D;  1OW7 A;  2WSF J;  1ZP0 D;  3P4S D;  4Y28 J;  3ABV D;  2ZT9 B;  2WDQ D;  2WSE J;  3AE2 C;  4H13 B;  4H44 B;  2BEZ F;  4YSX C;  2ACZ C;  2WU5 C;  1FDI A;  2YMK A;  4H0L D;  1K04 A;  2WU5 D;  3RL0 g;  4Z1M H;  2WQY C;  3Q5P A;  1Y9B A;  3Q2Y A;  2E74 C;  3AEG C;  1EXI A;  1NEK D;  2FXP A;  4OGQ D;  2WP9 C;  2H89 C;  2E74 D;  2IDB A;  2D2C C;  3AEF C;  3O6Q A;  4IL6 X;  4TT3 H;  4YSY D;  3AEC C;  3AE6 C;  1EXJ A;  3LW5 J;  1FDO A;  1HJ0 A;  2B76 C;  3AE6 D;  2H88 C;  2BS2 C;  1VF5 B;  2B76 D;  5C2T D;  2YIU C;  2H88 D;  4YTP D;  1WMK A;  1IK7 A;  2O01 J;  2ZT9 D;  3GLM A;  3IN6 A;  4H13 C;  2D2C B;  4KT0 J;  3Q3D A;  3Q5S A;  1AJY A;  1HF9 A;  4H13 D;  4XFJ A;  1NGM B;  2K9Y A;  1KOR A;  3AEE C;  3P4P D;  2JP3 A;  1KFY C;  1RQU A;  4YXD D;  1KTM A;  3D6Y A;  1KF6 C;  2WSC J;  2BS3 C;  2QJY C;  1UIX A;  2E76 C;  3AEB C;  3AED C;  1KMI Z;  3Q1M A;  1S1C X;  3AE9 C;  3VR8 C;  2J5U A;  1NYH A;  3AEB D;  3AED D;  3IAO A;  3AE2 D;  2G3A A;  2QIW A;  2QSI A;  3GF7 A;  4RKU J;  5KKZ C;  4YSX D;  4PV1 B;  2ACZ D;  1VF5 C;  1KIL E;  3SFD C;  3P4R C;  4YTN C;  1VF5 D;  2E76 B;  2WQY D;  3AE3 C;  2WS3 C;  3AEG D;  3AE7 C;  3P4R D;  4YTN D;  2WS3 D;  2WP9 D;  2QJP C;  2H89 D;  3D70 A;  2D2C D;  3AE4 C;  3AE3 D;  3AE7 D;  3AEF D;  2E75 C;  3AEA C;  2QJK C;  3AEC D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...