3AEBC

Crystal structure of porcine heart mitochondrial complex ii bound with n-(3-phenoxy-phenyl)-2-trifluoromethyl-benzamide
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of porcine heart mitochondrial complex II bound with N-(3-Phenoxy-phenyl)-2-trifluoromethyl-benzamide
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
total genus 51
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3aebC01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3aebC02
2BS3C 1OW7A 4YSXC 3AEFD 1KF6D 3AE5D 3AE3D 2ACZC 4YT0C 3CIRC 2FBWC 3AECD 3SFDD 2B76C 4YTNC 3AE1C 3VR8D 2WDQD 5C2TD 2WP9D 3CIRD 2WDVC 2WDRC 3AE2D 3VR8C 1ZP0D 5C3JC 3VRBD 1KTMA 1K04A 2H88D 3AECC 2FBWD 3P4PD 1QLBC 2WS3C 4YTMC 3VR9D 2B76D 4YXDD 3SFEC 2WU5C 3P4SC 3S9OA 1L0VC 3AE8D 3B71A 1ZP0C 1YQ4D 1YQ3C 3AE7C 3SFED 3AEBD 2H88C 3P4PC 2WDQC 1NEND 3VRAC 3AE5C 4YSZC 4YT0D 3AEDD 3ABVD 5C2TC 3AE8C 3AE1D 3AEAC 3AEBC 3VR9C 1NEKC 3P4QC 3AEGD 4YTPC 1KFYD 3AEED 1L0VD 3AEGC 4YTPD 3AE9D 4YSYC 4YTND 3AEDC 3AEEC 1OW8A 1OW6A 1NENC 4KX6C 3VRAD 3P4RC 1E7PC 1NEKD 2WS3D 1KF6C 4YTMD 4YSXD 2WQYD 4YXDC 2ACZD 1PV3A 3AEFC 3AEAD 3AE6D 2WU5D 3P4SD 2BS4C 2WQYC 3P4QD 2WP9C 1K05A 3AE4C 2WU2C 3P4RD 2BS2C 5C3JD 3AE9C 4YSYD 3VRBC 2WU2D 3AE4D 4YSZD 2WDRD 2WDVD 3ABVC 1ZOYC 2H89C 3SFDC 1YQ4C 3AE3C 1ZOYD 1YQ3D 3AE7D 1KFYC 2H89D 3AE6C 2G3AA 4KX6D 3AE2C
chains in the Genus database with same CATH superfamily
2QJKB 1RF1C 2OYIB 1VQKP 1VQ9P 1L4AA 3L75D 4DCKA 1FDIA 3FWLA 2WPQA 3HTKA 2KYVA 3B8EB 2H88D 2WU5C 4EDFA 2R44A 3G6EP 1GK4A 5AW9B 1KD1Q 5BU5A 1M1KQ 3TNUB 3SWKA 2R5BA 3CXHD 4YPCA 2O1KA 1Y47A 1R8EA 1JMBA 3CWBD 3D70A 1QLED 3H1HD 3B5NB 2M3EA 1FDMA 1LTJB 3AEGD 5KJ7D 3W68A 2QA4P 1YJWP 1G2CA 1ZR4A 1PPJE 1QL2A 2OQQA 1HGVA 1EQ7A 1EDJA 1AV1A 1G1IA 1X9VA 2KZIA 5AW1B 1NU1K 5CJ0A 1WMKA 3E1RA 3D71A 1N73B 1NGMB 1PP9D 2ZYDA 3V6IA 5KLIB 5CBNA 3L71J 1P84D 3PLNA 2HODB 3GLMA 2E74B 1KQLA 4DDGA 3PHLA 2K1AA 1EDIA 2H89C 3L74J 1EDKA 3WUUA 2KXPB 3A5TA 1SQPE 1YJNP 3M0DC 1T8ZA 2N1TA 3CIRC 2QEXP 4UB8E 2IYPA 5APQA 2WP9D 1NU1E 1ZP0D 1FZCC 2Y9ZA 4IL6E 1RE3C 3CC4P 2KIKA 3L72G 1L4AC 2YIUB 3CCRP 1KQSO 1ZP0C 2RN0A 1SVFA 1D7MA 3AEBD 2V4HA 3MHVA 1VF5C 2KS1B 2WDQC 2FYUG 3CCEP 2QM7A 1YITP 1T2KD 4PD4D 3AE1D 3AEBC 1JY3N 3WU2E 4D6TJ 3H1JG 3RL0C 1L0VD 4C7RA 3IF4A 1R5SA 2OARA 1PPJG 3P8CD 1HWTC 4L76A 1GL2D 1NU1G 1FOSF 3Q5SA 2FYNC 3RK3C 1SQQD 3RK2B 2WSSH 1FOSE 4DJGA 3H1JE 1AQ5A 2OYHB 3U59A 2C0WA 1KYOI 1KILE 4WY4B 2SPZA 4GODA 3LW5H 2ZXEB 4LC1A 1JO5A 1G2CB 3SFDC 1L0NJ 3GHGC 4OGQB 3MP7B 2WPVB 3VTPC 2BS3C 3S1KA 3KZIH 3CX5E 1SQPK 1JCDA 1HF9A 3L35A 1T2KC 2WDRC 1RF0C 3CD6P 3C1LA 1SQQE 3B4SA 4TT3H 2V7QJ 1G1JA 4ZNCA 2KI7B 2LKMA 1U7MA 1QL1A 1L0VC 1U57A 3AE8D 1LGHB 3H1HE 3SFED 2BCCG 1Q7YQ 3R2PA 1R5LA 2D2CB 3F89A 2CPSA 4I2LC 3CPWO 1SQVE 3BRVB 4IFDK 3PTZA 5B5EE 2M5AB 4CPGA 4YTPC 1QVGO 3V4QA 4Y28J 3R4YA 2WT7B 2OGUA 1IFIA 3M06A 3Q1MA 5CCHA 5H2FE 3L4FA 2QIWA 2Q1KA 1UIIA 3L74D 1JB0J 3B5NA 3G3ZA 2IZ0A 4U7JA 3MGNA 1L0ND 5BVZA 3RL0g 1RQUA 4D6TG 2BS4C 2QJYC 3MZWB 3H1IG 1M56D 2BS2C 3HE5A 4RESB 3SWYA 2WDRD 3KYQA 1S1CX 3EQ2A 1NU1J 1FZCB 4HKZH 1NTMD 3AE3C 3JC22 3M0AA 3VMZA 1SQBJ 2YIUC 5KAIE 2FBWC 1OVVA 4W7YA 3G4SP 1NTKE 2WSEJ 1LNQA 1GK6A 2FYUE 4U3FG 3VR8C 2GUSA 1IK9A 4GIFA 2FBWD 2AEMA 4YXDD 1ZR2A 1BE3E 2GA1A 1CW5A 1URQD 2E75C 1S9KD 5APWA 2WSCH 3P7KA 3AEDD 3BATA 1QVFO 1ZN5A 1S3JA 3P32A 3I55P 3CMAP 3MTUE 5KKZC 4HH2A 3RK2C 1MKMA 1NTZD 4GOEA 2Q7CA 1EC5A 2YKOA 2C0XA 3WU2H 4WY4C 3MUDA 5BU8B 1VQMP 2O01N 3U1CA 1SQXG 4HB1A 3E7KA 1PGJA 4H0LD 4DHIB 2L91A 1FJKA 3LW5J 1J1EB 1Y9BA 3V2NA 2KNCB 1AJYA 2RH0A 1JY2O 1SQVG 3GF7A 4OWFA 5AW3B 4DDIA 1BSHA 1NAFA 4YSZD 1HVVA 1VL2A 1ZOYC 1FS0E 4PD4E 1SQQJ 1YQ4C 1WRGA 5APYA 2Q6QA 2PP6A 4PV1C 3C8VA 2J5UA 3VR8D 3A3YB 5C39A 3AECD 2RMZA 4YTNC 2E5YA 3VMXA 2OYHA 1XTGB 3H1IJ 1DIPA 2MJZA 3L70E 4K3AA 5AVYB 1NTMK 5AW6B 4IFMA 2NPSD 3AECC 1KV4A 3CCUP 3A2AA 1RQVA 1SQQK 2QJKC 1RF1B 4DOJA 3AE7C 1SQBG 2WITA 1VDFA 2A06D 3H32B 2H8PD 3CCJP 4WWIA 2ITAA 2AXCA 1XTCC 3D6YA 3H6PA 3CC7P 2O3JA 1OMIA 3UIAA 1NTZG 3AE9D 2HR3A 3B5NC 2E75D 1L0LD 3L36A 5KJ7A 1FU1A 1KQGB 1LTJC 1QEXA 2ZVNB 4N3YB 4YSXD 1VQNP 2HPCA 4PD4I 2WTYA 1PIXA 3PRJA 1CZQA 1M7LA 1EZVE 2JWDA 4EI2A 1LT9A 5AVUB 1DD4A 2M3BA 2K3RA 2C9LY 1T6AA 2A45H 2PAJA 1N73C 1Z56A 1KC8Q 1VQPP 1BDDA 1P84H 3HE4A 4C46A 3L75E 1L4AD 2E74C 2K37A 3L71G 2E5TA 1NJIQ 2QM8A 1VF5D 2WDQD 1SQBK 1QX8A 3Q3DA 3L72E 1Y8AA 4GKGA 1NTKK 2Q3IA 3JCUE 4R4MA 3NFQA 5CCHC 4W7ZA 2AXTE 3TNUA 2FYZA 2RKLA 1OVUA 3KHUA 5AW0B 2P67A 1JTHB 2IX7C 4DT0A 4H0LC 1IFPA 1VPCA 2YNYA 2WSEH 1L4AB 3H1KG 1X0TA 5AW8B 1MUUA 2XV5A 2FFDB 5APTA 1VF5B 4XE5B 2IBZG 3RBXA 4JPZB 3A0BH 3S4RA 1GU5A 4N78E 1Q86Q 1OW6A 1L2PA 1CI6B 1E7PC 1GW4A 2ACZD 1HTLC 1JM0A 1SFCA 4JBZA 3V4WA 3H32A 3RGUA 1K05A 1URQA 3AE4C 5KJ7C 3CXHI 3AE9C 2QG4A 3GW6A 3GHGA 3WUVA 3RK3B 5B66E 3FX0A 5KLVG 3LIDA 3AE7D 1BGYD 1LP1A 1GMJA 1JCCA 1TFFA 1NO4A 1RHZB 1OW7A 4EIJA 3L70D 5EFWB 4TLFA 4YT0C 3L74E 3H1LE 4MN4C 2MKVA 2G8YA 1EXJA 2FKWB 4OGQC 2DW3A 1NTMJ 4NPDA 2QRXA 3S9OA 4U3FE 1SQBD 3VOPA 3FXEA 1HGZA 4LDTA 1YYCA 1OWAA 3EFFK 4PD4H 3TGUE 1JTHA 1S5LX 3A0HE 5AVQB 4Z1MH 4H13D 3AEGC 1J1DB 1KFNA 1RE3A 1TU3F 5TJHA 3CCVP 2OYOA 1N7SA 1KN7A 2IBZD 4A7PA 4WBAA 1NYHA 4HJGH 2W6JH 3P4SD 2KOGA 1JNMA 2B87A 3CI9A 4H44C 3LIEA 1QGKB 2A45I 3CMEP 1YI2P 1RH5B 3HUSB 1Q82Q 2P2UA 3H1ID 2Q3EA 1ZV8A 2H89D 1W2BO 3AE6C 2QJYB 5KLVD 2JKVA 1PP9G 3OJAB 3CL3D 3L73J 3FWNA 2XU6A 2Q5UA 3KQGA 3O6QA 4NPFX 1L0NE 2W90A 1FZGA 5E79E 1M57D 3M9HA 4H0LB 2H43A 3O8ZA 3NXSA 1OFCX 1DEBA 2OTJP 3HE4B 3O6QB 1KORA 4C7NB 1GL2B 3ZDMA 2K9JB 1LTJA 4I6MC 3KXDA 3L70J 1N7SC 1NTZE 1K9MQ 3BCCJ 3AEAC 2WVRA 2XKMA 2KLUA 1S72P 1GL2A 1L0LJ 1JY2P 2QSIA 2W83C 1E79H 1VQLP 2Q9IA 1PFIA 2AEFA 2O01J 1ZXGA 2N1TB 3AEEC 3GMAA 1DH3A 2FYUD 1BE3D 5TISH 2KLVA 2YO3A 1JY3O 4N78D 2WQYD 2YO2A 3AE6D 5CCGC 1S5LE 1SQVK 1H88A 1L0NK 2GM4A 2FFDA 5APVA 2WWWA 2XZRA 1JY2N 3QWOC 4PJ0E 2YMYA 3D6ZA 2R32A 1KILA 1NTKD 1IK7A 3M91A 4YSXC 3AEFD 2ACZC 4U3FJ 1SFCB 2N1TD 1HUCA 5E79H 1KMIZ 3L37A 4ZKUA 2M5AA 2Y0EA 1NAYA 4PJ0H 2B76D 2K9YA 4H13C 1SQQG 2HPCB 1YQ3C 1N8RQ 1ZRTE 3CX5H 2YKQA 2ZT9C 5CBOA 1S5LH 1KILD 3QH9A 4YSZC 1S2EA 3A0HH 3RBZA 3SWFA 1BE3J 3RL0D 3P4QC 1AVOA 4I1LA 1HJBA 1NTZK 1YHQP 4YTPD 2W8ZA 1JMMA 1LP1B 5KTBA 2JWAA 1VQ8P 1KB9I 1BCCG 2J59M 3Q5PA 2VRSA 3HUSC 2AEJA 3H1LD 4YTMD 3L70G 1KF6C 4BXLA 2WU5D 1LT9C 3PJSK 2JO1A 1ZRTD 1E5WA 1L0LG 4DZOA 3K5BA 1AA0A 3RK2D 2WU2C 3L73D 1PGOA 2W6BA 5DJTB 1FZEA 1LT1A 1VQ5P 2B89A 1U7JA 3L71E 2N9BA 5B66H 1LTGC 3L74G 1T3UA 3BRTB 5KLVE 2OTKE 3F5HA 4H44D 3OAKA 2FYUK 2OYIA 2BEQD 4BWNA 1PGQA 4FJVA 2JR8A 1QLBC 4LGDE 3BCCE 3SFEC 3HTKB 2LXBA 1M1JA 3A0BE 1RF0A 2JEEA 3VRAC 2KSEA 2N1TC 2FYUJ 4W80A 1CSBA 1EZVI 2WZ7A 2ZAEB 2Z5IA 3HRNA 4I7ZB 3VR9C 1IJDB 1T3JA 1SQXK 1KQFB 3TDKA 5CHXA 2ZXXA 2QJPB 1LWUB 5AVWB 3H1JJ 2Y0DA 1JY3P 1EXIA 2AXTH 1IFJA 2PGDA 3CX5I 1OW8A 3M0DA 1LWUA 1PGPA 2LR2A 1USEA 3BCCD 4KT0J 1NEKD 5AW4B 2WS3D 4RKUJ 3AEFC 1N7SD 5APSA 4Y99C 2ZVOB 1N2DC 2FFDC 4U3FD 1SFCC 4GDOA 3VRBC 4IL6H 1W5CE 4WY4D 1FZAA 2QVAA 5KAFE 1RF1A 3HD7B 4UB8H 2I1KA 3A7OA 1MFZA 1FDOA 1ZOYD 1YQ3D 1ZLLA 4H13B 1SQXD 5AW2B 2JDIH 4RO0A 1IFDA 5C2TD 1Q81Q 4HYTB 5CMZA 1GU4A 3CIRD 2HFED 4AUWA 2ZJSE 3CWBE 2IBZE 2QE7H 2BEZF 4OH8B 2K88A 3VR9D 1KB9E 3JSVC 2NPSC 2D2CD 5L8RJ 4XFJA 1YQ4D 4C7NA 4UB6H 1FAVA 3CLQA 1FE6A 1SQVD 4JQ0D 3TGUG 4ASVA 1GZLA 3L75G 1N86A 4NPEA 1SQPD 3P8CE 2UWJE 5GTIH 2CK3H 1LT9B 1YIJP 1SFCD 5CJ4A 1DX7A 2WT7A 2Z4EA 2V7QH 1KILC 3CWBG 4KX6C 1FC2C 1AVYA 1YTZT 3BASA 5KAIH 2WSFH 1J1DC 1NWQA 2P7JA 1SQBE 2E76D 2WSFJ 2M8RA 5C3JD 2YXRB 2N9YB 1SQPG 2Y9YA 1NTKJ 3ABVC 1Q2NA 3M9BA 1FBMA 3CCMP 3E1IA 3H1LJ 3V2PA 1LTBC 3FGAD 3PH0A 3CCLP 1GTWA 2G3AA 3P8MC 1N7LA 5AW5B 4H44B 3I5CA 3HD7A 4XA4A 3TYYA 1BGYE 2E43A 3HUSA 3USSA 1CI6A 2YKPA 1NVOA 3AE2D 3JCUH 1KTMA 1K04A 4WY4A 1URQB 2I8DA 3CXHE 1S9KE 4DHJA 4RJTA 1OIPA 3VONA 5K5GB 1SS1A 5B5EH 1PP9J 1HH0A 1S4XA 4WVZA 1DEEG 1AFOA 3WMM0 1BGYJ 3ITKA 5APXA 2IDBA 2WPSA 1HBWA 1W2EA 3VN0A 1BDCA 4OVNF 4GOFA 3NTNA 3GG2A 1KFYD 3AEED 1RE4A 3IR9A 2A06G 2IBZI 3NMDA 3Q2YA 2IZ1A 1GL2C 2ZYGA 4YSYC 1FZBA 1L0LK 5APUA 2E76C 1FZFA 1NOHA 4WB4A 1RY3A 2FXMA 2PRRA 2BCCD 4EYYQ 1PP9E 5AW7B 1FJPA 1N7SB 3Q5RA 3II6A 3VRAD 2ZYAA 4ZMDA 4IL6X 4IFFA 1SQVJ 3HD7C 4BRYB 1H8AA 1KZUB 4JYBA 3N4XA 3H1KD 1IC2A 2OYIC 4UB6E 4JF7A 3AE4D 2GUVA 1VQ6P 1JOCA 1AQTA 3HE5B 1M1JC 2KK7A 1K73Q 4I6LA 2KUBA 3AE2C 2YXQB 2YMKA 1VQ4P 3AE3D 4N6JA 2JP3A 2B76C 1VQOP 2ZT9D 3AE1C 3MD0A 3BVHA 1JUNA 2J58A 3N7NA 2Z5HA 5C3JC 2NPSA 2WPRA 1SQPJ 3CC2P 3H1LG 3L73E 3M9QA 3VP8A 2HLOA 2IFNA 1HJ0A 1KB9H 3BCCG 2ZFYA 1VQ7P 4YT0D 1NHLA 3TF5A 1KYOE 5GTHH 2CPBA 1KILB 1Q90D 3TSIA 2WSCJ 3IN6A 4L74A 2JJLA 1MV8A 2R5DA 2I1JA 3CX5D 1SP4A 2IPPA 2ZT9B 1MZ9A 4KHXA 4YTND 1NTZJ 1K8AQ 5KAFH 4M3LA 3W67A 1ZMEC 1DD3A 2B9BA 4D6TE 4GT1A 4K35A 1X79B 1L0LE 2W6AA 5H2FH 1BE3G 2KB7P 1YTZI 4L73A 1J2JB 1LTAC 4YSYD 1NKNA 2A06E 3TGUD 1UIXA 2P10A 2XNXA 1WT6A 1BSNA 3FXDA 3L72J 1BCCJ 1URQC 3V5BA 3V2RA 3AE5D 4PV1D 3VMYA 1GW3A 5CCGA 3IAOA 4ASWA 2WDVC 2O1JA 3VRBD 3MIWA 2R3SA 2FXPA 4YTMC 2R3CA 3CCQP 1FZCA 3VMAA 1NKZB 3H1KE 1IFNA 2NZ2A 2C9NY 2OTLP 2H88C 1GDTA 3P4PC 5M1BA 1M90Q 1EZVD 1NEND 2E76B 1PZQA 2BCCJ 2E42A 5C2TC 2FYNB 1NEKC 2KS1A 3H1KJ 2W27A 5TISE 3B5ND 1L0NG 3H25A 4I7ZC 3H1HG 4OGQD 1LTSC 5AVVB 1M1JB 1N73A 3GHGB 2QJPC 3AEAD 1LWUC 3V2QA 5CCHD 4DHZA 2WQYC 3P4QD 3H1IE 1YBKA 3RK3D 1MFTA 2H7HA 5KLVJ 3L71D 2WDVD 4R4LA 2P58A 2KP8A 5DJUB 2O01H 1LTTC 4Y99B 1KF6D 3HD7D 2XNDH 3G9RA 2KNCA 1OX3A 2D2CC 1KB9D 2FY8A 2KZJA 1NTMG 3VYIA 2BASA 3P4PD 2WS3C 3PP5A 2M0BA 1USDA 3P4SC 2PFXA 2K9JA 1A02J 2ZFCA 1H89A 3KDPB 1X22A 2L5GB 4JYCA 2Y0CA 4O9BA 1IFMA 5GTIE 1SLQA 3AE8C 1NTME 1EDLA 3T97B 2POHA 2WMMA 2HODA 2NPSB 1KFMA 2IYOA 3EFGA 1P84I 1PL5A 2FXOA 1KYOH 2B87B 3EWKA 5GTHE 3KPEA 1IO4A 3TGUJ 4QMAA 3L72D 3L75J 4YXDC 1OXZA 1PV3A 3G71P 2HG5D 1BCCE 2WP9C 4KJMA 3TK1A 1P84E 1JEKA 4AYCA 2WU2D 1H0TB 3H1JD 1OVRA 1GD2E 1NH4A 5KLIC 3CWBJ 3H1HJ 4L75A 5AVRB 1PPJD 3VP9A 3SFDD 1X8YA 3CCSP 2KSJA 1LJ2A 2E75B 1SQXE 3L73G 3CXHH 4LLHA 4B86A 4ZKPA 2BCCE 1NTKG 4D6TD 2P1JA 5KKZB 5CCGD 3RK3E 4BRYA 3B71A 4AQRD 2B88A 3OW2O 5AVSB 3C9IA 3AE5C 1SQXJ 2A45G 3ABVD 5AVTB 1EZVG 1A02F 1OZHA 3I56P 4YXWH 4EOTA 1J1EC 5AVXB 2IFMA 1M8OB 3KZIE 3IFMA 1ZW0A 2LXCB 1RE4C 3AEDC 1IZNB 3WUTA 1LTIC 3U1AA 1NENC 3OA7A 1BGYG 3MUDC 1NU1D 2XDJA 3P4RC 2E74D 3RL0B 4PV1B 5AVZB 3T97A 3P4RD 1BCCD 3SSUA 2HYNA 1KYOD 5KLVK 3GF3A 4IOIH 2NRGA 1H0TA 1KFYC 2OYHC 4KX6D 1YJ9P
chains in the Genus database with same CATH topology
1IK7A 2BS3C 1OW7A 4H44B 4YSXC 3AEFD 2E74C 1KF6D 2YIUC 4PV1D 3AE3D 3AE5D 2ACZC 2JP3A 3CIRC 2FBWC 3AECD 4YT0C 2B76C 1HF9A 3SFDD 2E75B 2ZT9D 4YTNC 3G9RA 3AE1C 3VR8D 1VF5D 2WDQD 5C2TD 1DIPA 2WSEJ 1FDIA 1KMIZ 2WP9D 3CIRD 3IAOA 4H44D 2D2CC 3Q3DA 2WDVC 2WDRC 2BEQD 3O6QA 3AE2D 3VR8C 1ZP0D 5C3JC 4TT3H 2MKVA 1K04A 1KTMA 3VRBD 2FXPA 2G8YA 2V7QJ 1EXJA 2H88D 3AECC 2FBWD 3P4PD 1QLBC 2BEZF 2WS3C 4H0LB 3VR9D 2B76D 4YXDD 4OGQC 4YTMC 2K9YA 4H13C 3SFEC 1RQVA 4R4MA 2WU5C 3P4SC 2QJKC 3S9OA 1L0VC 3RK3E 1U57A 3AE8D 2D2CD 3B71A 1ZP0C 4XFJA 5L8RJ 1YQ4D 1YQ3C 3AE7C 2NZ2A 3SFED 2E75C 3AEBD 2H88C 1ZRTE 1HJ0A 2ZT9C 1KORA 3P4PC 1R8EA 1VF5C 2WDQC 5M1BA 1NEND 3D70A 3VRAC 2D2CB 2E76B 3AE5C 4YSZC 4YT0D 3AEDD 3ABVD 2IDBA 5C2TC 3AE8C 3AE1D 4H0LC 3AEAC 3AEBC 3T97B 4I7ZB 1NEKC 3VR9C 5KKZC 3P4QC 1Q90D 3AEGD 1KQFB 1MKMA 2WSCJ 4YTPC 3IN6A 3D6YA 1S5LX 4Y28J 2QSIA 4Z1MH 3R4YA 1KFYD 1L0VD 3AEED 4H13D 3AEGC 1OMIA 1PL5A 4YTPD 3Q1MA 2ZT9B 3Q2YA 3AE9D 4YSYC 1TU3F 1VF5B 2OQQA 1EXIA 2E76C 4YTND 2E75D 2O01J 3AEDC 2QIWA 1ZMEC 1DD3A 3AEEC 3EWKA 3GMAA 3Q5RA 1OW8A 3Q5SA 1KQGB 3H25A 1WMKA 1OW6A 3Q5PA 1NENC 4KX6C 2FYNC 4I7ZC 1JB0J 3D71A 3P4RC 4KT0J 3VRAD 4OGQD 1E7PC 1NGMB 1NEKD 2WS3D 2E74D 4IL6X 4RKUJ 4U7JA 1KF6C 4YXDC 2ACZD 1PV3A 4H0LD 3RL0g 2WQYD 4YSXD 1NYHA 3AEFC 4YTMD 2QJPC 3AEAD 3AE6D 3LW5J 4PV1B 1RQUA 2WU5D 3P4SD 1Y9BA 1PIXA 2JO1A 2BS4C 2QJYC 1AJYA 2WQYC 3GLMA 3P4QD 2WP9C 3GF7A 1K05A 3AE4C 2WU2C 4H44C 1KILE 2E74B 3P4RD 2BS2C 2E76D 4GDOA 2WSFJ 5C3JD 3AE9C 4YSYD 3VRBC 2WU2D 3AE4D 1DD4A 4YSZD 2WDRD 2WDVD 3ABVC 4R4LA 1S1CX 1VL2A 1ZOYC 1UIXA 4KX6D 2H89C 2P10A 3SFDC 5KLIC 3D6ZA 3GF3A 1YQ4C 1FDOA 3FGAD 3AE3C 4OGQB 4PV1C 2WPVB 1YQ3D 1ZOYD 1KFYC 2H89D 3AE7D 3AE6C 2G3AA 2J5UA 3C8VA 4H13B 3AE2C 1GMJA 2YMKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BS3 C;  1OW7 A;  4YSX C;  3AEF D;  1KF6 D;  3AE5 D;  3AE3 D;  2ACZ C;  4YT0 C;  3CIR C;  2FBW C;  3AEC D;  3SFD D;  2B76 C;  4YTN C;  3AE1 C;  3VR8 D;  2WDQ D;  5C2T D;  2WP9 D;  3CIR D;  2WDV C;  2WDR C;  3AE2 D;  3VR8 C;  1ZP0 D;  5C3J C;  3VRB D;  1KTM A;  1K04 A;  2H88 D;  3AEC C;  2FBW D;  3P4P D;  1QLB C;  2WS3 C;  4YTM C;  3VR9 D;  2B76 D;  4YXD D;  3SFE C;  2WU5 C;  3P4S C;  3S9O A;  1L0V C;  3AE8 D;  3B71 A;  1ZP0 C;  1YQ4 D;  1YQ3 C;  3AE7 C;  3SFE D;  3AEB D;  2H88 C;  3P4P C;  2WDQ C;  1NEN D;  3VRA C;  3AE5 C;  4YSZ C;  4YT0 D;  3AED D;  3ABV D;  5C2T C;  3AE8 C;  3AE1 D;  3AEA C;  3AEB C;  3VR9 C;  1NEK C;  3P4Q C;  3AEG D;  4YTP C;  1KFY D;  3AEE D;  1L0V D;  3AEG C;  4YTP D;  3AE9 D;  4YSY C;  4YTN D;  3AED C;  3AEE C;  1OW8 A;  1OW6 A;  1NEN C;  4KX6 C;  3VRA D;  3P4R C;  1E7P C;  1NEK D;  2WS3 D;  1KF6 C;  4YTM D;  4YSX D;  2WQY D;  4YXD C;  2ACZ D;  1PV3 A;  3AEF C;  3AEA D;  3AE6 D;  2WU5 D;  3P4S D;  2BS4 C;  2WQY C;  3P4Q D;  2WP9 C;  1K05 A;  3AE4 C;  2WU2 C;  3P4R D;  2BS2 C;  5C3J D;  3AE9 C;  4YSY D;  3VRB C;  2WU2 D;  3AE4 D;  4YSZ D;  2WDR D;  2WDV D;  3ABV C;  1ZOY C;  2H89 C;  3SFD C;  1YQ4 C;  3AE3 C;  1ZOY D;  1YQ3 D;  3AE7 D;  1KFY C;  2H89 D;  3AE6 C;  2G3A A;  4KX6 D;  3AE2 C; 
#chains in the Genus database with same CATH topology
 2QJK B;  1RF1 C;  2OYI B;  1VQK P;  1VQ9 P;  1L4A A;  3L75 D;  4DCK A;  1FDI A;  3FWL A;  2WPQ A;  3HTK A;  2KYV A;  3B8E B;  2H88 D;  2WU5 C;  4EDF A;  2R44 A;  3G6E P;  1GK4 A;  5AW9 B;  1KD1 Q;  5BU5 A;  1M1K Q;  3TNU B;  3SWK A;  2R5B A;  3CXH D;  4YPC A;  2O1K A;  1Y47 A;  1R8E A;  1JMB A;  3CWB D;  3D70 A;  1QLE D;  3H1H D;  3B5N B;  2M3E A;  1FDM A;  1LTJ B;  3AEG D;  5KJ7 D;  3W68 A;  2QA4 P;  1YJW P;  1G2C A;  1ZR4 A;  1PPJ E;  1QL2 A;  2OQQ A;  1HGV A;  1EQ7 A;  1EDJ A;  1AV1 A;  1G1I A;  1X9V A;  2KZI A;  5AW1 B;  1NU1 K;  5CJ0 A;  1WMK A;  3E1R A;  3D71 A;  1N73 B;  1NGM B;  1PP9 D;  2ZYD A;  3V6I A;  5KLI B;  5CBN A;  3L71 J;  1P84 D;  3PLN A;  2HOD B;  3GLM A;  2E74 B;  1KQL A;  4DDG A;  3PHL A;  2K1A A;  1EDI A;  2H89 C;  3L74 J;  1EDK A;  3WUU A;  2KXP B;  3A5T A;  1SQP E;  1YJN P;  3M0D C;  1T8Z A;  2N1T A;  3CIR C;  2QEX P;  4UB8 E;  2IYP A;  5APQ A;  2WP9 D;  1NU1 E;  1ZP0 D;  1FZC C;  2Y9Z A;  4IL6 E;  1RE3 C;  3CC4 P;  2KIK A;  3L72 G;  1L4A C;  2YIU B;  3CCR P;  1KQS O;  1ZP0 C;  2RN0 A;  1SVF A;  1D7M A;  3AEB D;  2V4H A;  3MHV A;  1VF5 C;  2KS1 B;  2WDQ C;  2FYU G;  3CCE P;  2QM7 A;  1YIT P;  1T2K D;  4PD4 D;  3AE1 D;  3AEB C;  1JY3 N;  3WU2 E;  4D6T J;  3H1J G;  3RL0 C;  1L0V D;  4C7R A;  3IF4 A;  1R5S A;  2OAR A;  1PPJ G;  3P8C D;  1HWT C;  4L76 A;  1GL2 D;  1NU1 G;  1FOS F;  3Q5S A;  2FYN C;  3RK3 C;  1SQQ D;  3RK2 B;  2WSS H;  1FOS E;  4DJG A;  3H1J E;  1AQ5 A;  2OYH B;  3U59 A;  2C0W A;  1KYO I;  1KIL E;  4WY4 B;  2SPZ A;  4GOD A;  3LW5 H;  2ZXE B;  4LC1 A;  1JO5 A;  1G2C B;  3SFD C;  1L0N J;  3GHG C;  4OGQ B;  3MP7 B;  2WPV B;  3VTP C;  2BS3 C;  3S1K A;  3KZI H;  3CX5 E;  1SQP K;  1JCD A;  1HF9 A;  3L35 A;  1T2K C;  2WDR C;  1RF0 C;  3CD6 P;  3C1L A;  1SQQ E;  3B4S A;  4TT3 H;  2V7Q J;  1G1J A;  4ZNC A;  2KI7 B;  2LKM A;  1U7M A;  1QL1 A;  1L0V C;  1U57 A;  3AE8 D;  1LGH B;  3H1H E;  3SFE D;  2BCC G;  1Q7Y Q;  3R2P A;  1R5L A;  2D2C B;  3F89 A;  2CPS A;  4I2L C;  3CPW O;  1SQV E;  3BRV B;  4IFD K;  3PTZ A;  5B5E E;  2M5A B;  4CPG A;  4YTP C;  1QVG O;  3V4Q A;  4Y28 J;  3R4Y A;  2WT7 B;  2OGU A;  1IFI A;  3M06 A;  3Q1M A;  5CCH A;  5H2F E;  3L4F A;  2QIW A;  2Q1K A;  1UII A;  3L74 D;  1JB0 J;  3B5N A;  3G3Z A;  2IZ0 A;  4U7J A;  3MGN A;  1L0N D;  5BVZ A;  3RL0 g;  1RQU A;  4D6T G;  2BS4 C;  2QJY C;  3MZW B;  3H1I G;  1M56 D;  2BS2 C;  3HE5 A;  4RES B;  3SWY A;  2WDR D;  3KYQ A;  1S1C X;  3EQ2 A;  1NU1 J;  1FZC B;  4HKZ H;  1NTM D;  3AE3 C;  3JC2 2;  3M0A A;  3VMZ A;  1SQB J;  2YIU C;  5KAI E;  2FBW C;  1OVV A;  4W7Y A;  3G4S P;  1NTK E;  2WSE J;  1LNQ A;  1GK6 A;  2FYU E;  4U3F G;  3VR8 C;  2GUS A;  1IK9 A;  4GIF A;  2FBW D;  2AEM A;  4YXD D;  1ZR2 A;  1BE3 E;  2GA1 A;  1CW5 A;  1URQ D;  2E75 C;  1S9K D;  5APW A;  2WSC H;  3P7K A;  3AED D;  3BAT A;  1QVF O;  1ZN5 A;  1S3J A;  3P32 A;  3I55 P;  3CMA P;  3MTU E;  5KKZ C;  4HH2 A;  3RK2 C;  1MKM A;  1NTZ D;  4GOE A;  2Q7C A;  1EC5 A;  2YKO A;  2C0X A;  3WU2 H;  4WY4 C;  3MUD A;  5BU8 B;  1VQM P;  2O01 N;  3U1C A;  1SQX G;  4HB1 A;  3E7K A;  1PGJ A;  4H0L D;  4DHI B;  2L91 A;  1FJK A;  3LW5 J;  1J1E B;  1Y9B A;  3V2N A;  2KNC B;  1AJY A;  2RH0 A;  1JY2 O;  1SQV G;  3GF7 A;  4OWF A;  5AW3 B;  4DDI A;  1BSH A;  1NAF A;  4YSZ D;  1HVV A;  1VL2 A;  1ZOY C;  1FS0 E;  4PD4 E;  1SQQ J;  1YQ4 C;  1WRG A;  5APY A;  2Q6Q A;  2PP6 A;  4PV1 C;  3C8V A;  2J5U A;  3VR8 D;  3A3Y B;  5C39 A;  3AEC D;  2RMZ A;  4YTN C;  2E5Y A;  3VMX A;  2OYH A;  1XTG B;  3H1I J;  1DIP A;  2MJZ A;  3L70 E;  4K3A A;  5AVY B;  1NTM K;  5AW6 B;  4IFM A;  2NPS D;  3AEC C;  1KV4 A;  3CCU P;  3A2A A;  1RQV A;  1SQQ K;  2QJK C;  1RF1 B;  4DOJ A;  3AE7 C;  1SQB G;  2WIT A;  1VDF A;  2A06 D;  3H32 B;  2H8P D;  3CCJ P;  4WWI A;  2ITA A;  2AXC A;  1XTC C;  3D6Y A;  3H6P A;  3CC7 P;  2O3J A;  1OMI A;  3UIA A;  1NTZ G;  3AE9 D;  2HR3 A;  3B5N C;  2E75 D;  1L0L D;  3L36 A;  5KJ7 A;  1FU1 A;  1KQG B;  1LTJ C;  1QEX A;  2ZVN B;  4N3Y B;  4YSX D;  1VQN P;  2HPC A;  4PD4 I;  2WTY A;  1PIX A;  3PRJ A;  1CZQ A;  1M7L A;  1EZV E;  2JWD A;  4EI2 A;  1LT9 A;  5AVU B;  1DD4 A;  2M3B A;  2K3R A;  2C9L Y;  1T6A A;  2A45 H;  2PAJ A;  1N73 C;  1Z56 A;  1KC8 Q;  1VQP P;  1BDD A;  1P84 H;  3HE4 A;  4C46 A;  3L75 E;  1L4A D;  2E74 C;  2K37 A;  3L71 G;  2E5T A;  1NJI Q;  2QM8 A;  1VF5 D;  2WDQ D;  1SQB K;  1QX8 A;  3Q3D A;  3L72 E;  1Y8A A;  4GKG A;  1NTK K;  2Q3I A;  3JCU E;  4R4M A;  3NFQ A;  5CCH C;  4W7Z A;  2AXT E;  3TNU A;  2FYZ A;  2RKL A;  1OVU A;  3KHU A;  5AW0 B;  2P67 A;  1JTH B;  2IX7 C;  4DT0 A;  4H0L C;  1IFP A;  1VPC A;  2YNY A;  2WSE H;  1L4A B;  3H1K G;  1X0T A;  5AW8 B;  1MUU A;  2XV5 A;  2FFD B;  5APT A;  1VF5 B;  4XE5 B;  2IBZ G;  3RBX A;  4JPZ B;  3A0B H;  3S4R A;  1GU5 A;  4N78 E;  1Q86 Q;  1OW6 A;  1L2P A;  1CI6 B;  1E7P C;  1GW4 A;  2ACZ D;  1HTL C;  1JM0 A;  1SFC A;  4JBZ A;  3V4W A;  3H32 A;  3RGU A;  1K05 A;  1URQ A;  3AE4 C;  5KJ7 C;  3CXH I;  3AE9 C;  2QG4 A;  3GW6 A;  3GHG A;  3WUV A;  3RK3 B;  5B66 E;  3FX0 A;  5KLV G;  3LID A;  3AE7 D;  1BGY D;  1LP1 A;  1GMJ A;  1JCC A;  1TFF A;  1NO4 A;  1RHZ B;  1OW7 A;  4EIJ A;  3L70 D;  5EFW B;  4TLF A;  4YT0 C;  3L74 E;  3H1L E;  4MN4 C;  2MKV A;  2G8Y A;  1EXJ A;  2FKW B;  4OGQ C;  2DW3 A;  1NTM J;  4NPD A;  2QRX A;  3S9O A;  4U3F E;  1SQB D;  3VOP A;  3FXE A;  1HGZ A;  4LDT A;  1YYC A;  1OWA A;  3EFF K;  4PD4 H;  3TGU E;  1JTH A;  1S5L X;  3A0H E;  5AVQ B;  4Z1M H;  4H13 D;  3AEG C;  1J1D B;  1KFN A;  1RE3 A;  1TU3 F;  5TJH A;  3CCV P;  2OYO A;  1N7S A;  1KN7 A;  2IBZ D;  4A7P A;  4WBA A;  1NYH A;  4HJG H;  2W6J H;  3P4S D;  2KOG A;  1JNM A;  2B87 A;  3CI9 A;  4H44 C;  3LIE A;  1QGK B;  2A45 I;  3CME P;  1YI2 P;  1RH5 B;  3HUS B;  1Q82 Q;  2P2U A;  3H1I D;  2Q3E A;  1ZV8 A;  2H89 D;  1W2B O;  3AE6 C;  2QJY B;  5KLV D;  2JKV A;  1PP9 G;  3OJA B;  3CL3 D;  3L73 J;  3FWN A;  2XU6 A;  2Q5U A;  3KQG A;  3O6Q A;  4NPF X;  1L0N E;  2W90 A;  1FZG A;  5E79 E;  1M57 D;  3M9H A;  4H0L B;  2H43 A;  3O8Z A;  3NXS A;  1OFC X;  1DEB A;  2OTJ P;  3HE4 B;  3O6Q B;  1KOR A;  4C7N B;  1GL2 B;  3ZDM A;  2K9J B;  1LTJ A;  4I6M C;  3KXD A;  3L70 J;  1N7S C;  1NTZ E;  1K9M Q;  3BCC J;  3AEA C;  2WVR A;  2XKM A;  2KLU A;  1S72 P;  1GL2 A;  1L0L J;  1JY2 P;  2QSI A;  2W83 C;  1E79 H;  1VQL P;  2Q9I A;  1PFI A;  2AEF A;  2O01 J;  1ZXG A;  2N1T B;  3AEE C;  3GMA A;  1DH3 A;  2FYU D;  1BE3 D;  5TIS H;  2KLV A;  2YO3 A;  1JY3 O;  4N78 D;  2WQY D;  2YO2 A;  3AE6 D;  5CCG C;  1S5L E;  1SQV K;  1H88 A;  1L0N K;  2GM4 A;  2FFD A;  5APV A;  2WWW A;  2XZR A;  1JY2 N;  3QWO C;  4PJ0 E;  2YMY A;  3D6Z A;  2R32 A;  1KIL A;  1NTK D;  1IK7 A;  3M91 A;  4YSX C;  3AEF D;  2ACZ C;  4U3F J;  1SFC B;  2N1T D;  1HUC A;  5E79 H;  1KMI Z;  3L37 A;  4ZKU A;  2M5A A;  2Y0E A;  1NAY A;  4PJ0 H;  2B76 D;  2K9Y A;  4H13 C;  1SQQ G;  2HPC B;  1YQ3 C;  1N8R Q;  1ZRT E;  3CX5 H;  2YKQ A;  2ZT9 C;  5CBO A;  1S5L H;  1KIL D;  3QH9 A;  4YSZ C;  1S2E A;  3A0H H;  3RBZ A;  3SWF A;  1BE3 J;  3RL0 D;  3P4Q C;  1AVO A;  4I1L A;  1HJB A;  1NTZ K;  1YHQ P;  4YTP D;  2W8Z A;  1JMM A;  1LP1 B;  5KTB A;  2JWA A;  1VQ8 P;  1KB9 I;  1BCC G;  2J59 M;  3Q5P A;  2VRS A;  3HUS C;  2AEJ A;  3H1L D;  4YTM D;  3L70 G;  1KF6 C;  4BXL A;  2WU5 D;  1LT9 C;  3PJS K;  2JO1 A;  1ZRT D;  1E5W A;  1L0L G;  4DZO A;  3K5B A;  1AA0 A;  3RK2 D;  2WU2 C;  3L73 D;  1PGO A;  2W6B A;  5DJT B;  1FZE A;  1LT1 A;  1VQ5 P;  2B89 A;  1U7J A;  3L71 E;  2N9B A;  5B66 H;  1LTG C;  3L74 G;  1T3U A;  3BRT B;  5KLV E;  2OTK E;  3F5H A;  4H44 D;  3OAK A;  2FYU K;  2OYI A;  2BEQ D;  4BWN A;  1PGQ A;  4FJV A;  2JR8 A;  1QLB C;  4LGD E;  3BCC E;  3SFE C;  3HTK B;  2LXB A;  1M1J A;  3A0B E;  1RF0 A;  2JEE A;  3VRA C;  2KSE A;  2N1T C;  2FYU J;  4W80 A;  1CSB A;  1EZV I;  2WZ7 A;  2ZAE B;  2Z5I A;  3HRN A;  4I7Z B;  3VR9 C;  1IJD B;  1T3J A;  1SQX K;  1KQF B;  3TDK A;  5CHX A;  2ZXX A;  2QJP B;  1LWU B;  5AVW B;  3H1J J;  2Y0D A;  1JY3 P;  1EXI A;  2AXT H;  1IFJ A;  2PGD A;  3CX5 I;  1OW8 A;  3M0D A;  1LWU A;  1PGP A;  2LR2 A;  1USE A;  3BCC D;  4KT0 J;  1NEK D;  5AW4 B;  2WS3 D;  4RKU J;  3AEF C;  1N7S D;  5APS A;  4Y99 C;  2ZVO B;  1N2D C;  2FFD C;  4U3F D;  1SFC C;  4GDO A;  3VRB C;  4IL6 H;  1W5C E;  4WY4 D;  1FZA A;  2QVA A;  5KAF E;  1RF1 A;  3HD7 B;  4UB8 H;  2I1K A;  3A7O A;  1MFZ A;  1FDO A;  1ZOY D;  1YQ3 D;  1ZLL A;  4H13 B;  1SQX D;  5AW2 B;  2JDI H;  4RO0 A;  1IFD A;  5C2T D;  1Q81 Q;  4HYT B;  5CMZ A;  1GU4 A;  3CIR D;  2HFE D;  4AUW A;  2ZJS E;  3CWB E;  2IBZ E;  2QE7 H;  2BEZ F;  4OH8 B;  2K88 A;  3VR9 D;  1KB9 E;  3JSV C;  2NPS C;  2D2C D;  5L8R J;  4XFJ A;  1YQ4 D;  4C7N A;  4UB6 H;  1FAV A;  3CLQ A;  1FE6 A;  1SQV D;  4JQ0 D;  3TGU G;  4ASV A;  1GZL A;  3L75 G;  1N86 A;  4NPE A;  1SQP D;  3P8C E;  2UWJ E;  5GTI H;  2CK3 H;  1LT9 B;  1YIJ P;  1SFC D;  5CJ4 A;  1DX7 A;  2WT7 A;  2Z4E A;  2V7Q H;  1KIL C;  3CWB G;  4KX6 C;  1FC2 C;  1AVY A;  1YTZ T;  3BAS A;  5KAI H;  2WSF H;  1J1D C;  1NWQ A;  2P7J A;  1SQB E;  2E76 D;  2WSF J;  2M8R A;  5C3J D;  2YXR B;  2N9Y B;  1SQP G;  2Y9Y A;  1NTK J;  3ABV C;  1Q2N A;  3M9B A;  1FBM A;  3CCM P;  3E1I A;  3H1L J;  3V2P A;  1LTB C;  3FGA D;  3PH0 A;  3CCL P;  1GTW A;  2G3A A;  3P8M C;  1N7L A;  5AW5 B;  4H44 B;  3I5C A;  3HD7 A;  4XA4 A;  3TYY A;  1BGY E;  2E43 A;  3HUS A;  3USS A;  1CI6 A;  2YKP A;  1NVO A;  3AE2 D;  3JCU H;  1KTM A;  1K04 A;  4WY4 A;  1URQ B;  2I8D A;  3CXH E;  1S9K E;  4DHJ A;  4RJT A;  1OIP A;  3VON A;  5K5G B;  1SS1 A;  5B5E H;  1PP9 J;  1HH0 A;  1S4X A;  4WVZ A;  1DEE G;  1AFO A;  3WMM 0;  1BGY J;  3ITK A;  5APX A;  2IDB A;  2WPS A;  1HBW A;  1W2E A;  3VN0 A;  1BDC A;  4OVN F;  4GOF A;  3NTN A;  3GG2 A;  1KFY D;  3AEE D;  1RE4 A;  3IR9 A;  2A06 G;  2IBZ I;  3NMD A;  3Q2Y A;  2IZ1 A;  1GL2 C;  2ZYG A;  4YSY C;  1FZB A;  1L0L K;  5APU A;  2E76 C;  1FZF A;  1NOH A;  4WB4 A;  1RY3 A;  2FXM A;  2PRR A;  2BCC D;  4EYY Q;  1PP9 E;  5AW7 B;  1FJP A;  1N7S B;  3Q5R A;  3II6 A;  3VRA D;  2ZYA A;  4ZMD A;  4IL6 X;  4IFF A;  1SQV J;  3HD7 C;  4BRY B;  1H8A A;  1KZU B;  4JYB A;  3N4X A;  3H1K D;  1IC2 A;  2OYI C;  4UB6 E;  4JF7 A;  3AE4 D;  2GUV A;  1VQ6 P;  1JOC A;  1AQT A;  3HE5 B;  1M1J C;  2KK7 A;  1K73 Q;  4I6L A;  2KUB A;  3AE2 C;  2YXQ B;  2YMK A;  1VQ4 P;  3AE3 D;  4N6J A;  2JP3 A;  2B76 C;  1VQO P;  2ZT9 D;  3AE1 C;  3MD0 A;  3BVH A;  1JUN A;  2J58 A;  3N7N A;  2Z5H A;  5C3J C;  2NPS A;  2WPR A;  1SQP J;  3CC2 P;  3H1L G;  3L73 E;  3M9Q A;  3VP8 A;  2HLO A;  2IFN A;  1HJ0 A;  1KB9 H;  3BCC G;  2ZFY A;  1VQ7 P;  4YT0 D;  1NHL A;  3TF5 A;  1KYO E;  5GTH H;  2CPB A;  1KIL B;  1Q90 D;  3TSI A;  2WSC J;  3IN6 A;  4L74 A;  2JJL A;  1MV8 A;  2R5D A;  2I1J A;  3CX5 D;  1SP4 A;  2IPP A;  2ZT9 B;  1MZ9 A;  4KHX A;  4YTN D;  1NTZ J;  1K8A Q;  5KAF H;  4M3L A;  3W67 A;  1ZME C;  1DD3 A;  2B9B A;  4D6T E;  4GT1 A;  4K35 A;  1X79 B;  1L0L E;  2W6A A;  5H2F H;  1BE3 G;  2KB7 P;  1YTZ I;  4L73 A;  1J2J B;  1LTA C;  4YSY D;  1NKN A;  2A06 E;  3TGU D;  1UIX A;  2P10 A;  2XNX A;  1WT6 A;  1BSN A;  3FXD A;  3L72 J;  1BCC J;  1URQ C;  3V5B A;  3V2R A;  3AE5 D;  4PV1 D;  3VMY A;  1GW3 A;  5CCG A;  3IAO A;  4ASW A;  2WDV C;  2O1J A;  3VRB D;  3MIW A;  2R3S A;  2FXP A;  4YTM C;  2R3C A;  3CCQ P;  1FZC A;  3VMA A;  1NKZ B;  3H1K E;  1IFN A;  2NZ2 A;  2C9N Y;  2OTL P;  2H88 C;  1GDT A;  3P4P C;  5M1B A;  1M90 Q;  1EZV D;  1NEN D;  2E76 B;  1PZQ A;  2BCC J;  2E42 A;  5C2T C;  2FYN B;  1NEK C;  2KS1 A;  3H1K J;  2W27 A;  5TIS E;  3B5N D;  1L0N G;  3H25 A;  4I7Z C;  3H1H G;  4OGQ D;  1LTS C;  5AVV B;  1M1J B;  1N73 A;  3GHG B;  2QJP C;  3AEA D;  1LWU C;  3V2Q A;  5CCH D;  4DHZ A;  2WQY C;  3P4Q D;  3H1I E;  1YBK A;  3RK3 D;  1MFT A;  2H7H A;  5KLV J;  3L71 D;  2WDV D;  4R4L A;  2P58 A;  2KP8 A;  5DJU B;  2O01 H;  1LTT C;  4Y99 B;  1KF6 D;  3HD7 D;  2XND H;  3G9R A;  2KNC A;  1OX3 A;  2D2C C;  1KB9 D;  2FY8 A;  2KZJ A;  1NTM G;  3VYI A;  2BAS A;  3P4P D;  2WS3 C;  3PP5 A;  2M0B A;  1USD A;  3P4S C;  2PFX A;  2K9J A;  1A02 J;  2ZFC A;  1H89 A;  3KDP B;  1X22 A;  2L5G B;  4JYC A;  2Y0C A;  4O9B A;  1IFM A;  5GTI E;  1SLQ A;  3AE8 C;  1NTM E;  1EDL A;  3T97 B;  2POH A;  2WMM A;  2HOD A;  2NPS B;  1KFM A;  2IYO A;  3EFG A;  1P84 I;  1PL5 A;  2FXO A;  1KYO H;  2B87 B;  3EWK A;  5GTH E;  3KPE A;  1IO4 A;  3TGU J;  4QMA A;  3L72 D;  3L75 J;  4YXD C;  1OXZ A;  1PV3 A;  3G71 P;  2HG5 D;  1BCC E;  2WP9 C;  4KJM A;  3TK1 A;  1P84 E;  1JEK A;  4AYC A;  2WU2 D;  1H0T B;  3H1J D;  1OVR A;  1GD2 E;  1NH4 A;  5KLI C;  3CWB J;  3H1H J;  4L75 A;  5AVR B;  1PPJ D;  3VP9 A;  3SFD D;  1X8Y A;  3CCS P;  2KSJ A;  1LJ2 A;  2E75 B;  1SQX E;  3L73 G;  3CXH H;  4LLH A;  4B86 A;  4ZKP A;  2BCC E;  1NTK G;  4D6T D;  2P1J A;  5KKZ B;  5CCG D;  3RK3 E;  4BRY A;  3B71 A;  4AQR D;  2B88 A;  3OW2 O;  5AVS B;  3C9I A;  3AE5 C;  1SQX J;  2A45 G;  3ABV D;  5AVT B;  1EZV G;  1A02 F;  1OZH A;  3I56 P;  4YXW H;  4EOT A;  1J1E C;  5AVX B;  2IFM A;  1M8O B;  3KZI E;  3IFM A;  1ZW0 A;  2LXC B;  1RE4 C;  3AED C;  1IZN B;  3WUT A;  1LTI C;  3U1A A;  1NEN C;  3OA7 A;  1BGY G;  3MUD C;  1NU1 D;  2XDJ A;  3P4R C;  2E74 D;  3RL0 B;  4PV1 B;  5AVZ B;  3T97 A;  3P4R D;  1BCC D;  3SSU A;  2HYN A;  1KYO D;  5KLV K;  3GF3 A;  4IOI H;  2NRG A;  1H0T A;  1KFY C;  2OYH C;  4KX6 D;  1YJ9 P; 
#chains in the Genus database with same CATH homology
 1IK7 A;  2BS3 C;  1OW7 A;  4H44 B;  4YSX C;  3AEF D;  2E74 C;  1KF6 D;  2YIU C;  4PV1 D;  3AE3 D;  3AE5 D;  2ACZ C;  2JP3 A;  3CIR C;  2FBW C;  3AEC D;  4YT0 C;  2B76 C;  1HF9 A;  3SFD D;  2E75 B;  2ZT9 D;  4YTN C;  3G9R A;  3AE1 C;  3VR8 D;  1VF5 D;  2WDQ D;  5C2T D;  1DIP A;  2WSE J;  1FDI A;  1KMI Z;  2WP9 D;  3CIR D;  3IAO A;  4H44 D;  2D2C C;  3Q3D A;  2WDV C;  2WDR C;  2BEQ D;  3O6Q A;  3AE2 D;  3VR8 C;  1ZP0 D;  5C3J C;  4TT3 H;  2MKV A;  1K04 A;  1KTM A;  3VRB D;  2FXP A;  2G8Y A;  2V7Q J;  1EXJ A;  2H88 D;  3AEC C;  2FBW D;  3P4P D;  1QLB C;  2BEZ F;  2WS3 C;  4H0L B;  3VR9 D;  2B76 D;  4YXD D;  4OGQ C;  4YTM C;  2K9Y A;  4H13 C;  3SFE C;  1RQV A;  4R4M A;  2WU5 C;  3P4S C;  2QJK C;  3S9O A;  1L0V C;  3RK3 E;  1U57 A;  3AE8 D;  2D2C D;  3B71 A;  1ZP0 C;  4XFJ A;  5L8R J;  1YQ4 D;  1YQ3 C;  3AE7 C;  2NZ2 A;  3SFE D;  2E75 C;  3AEB D;  2H88 C;  1ZRT E;  1HJ0 A;  2ZT9 C;  1KOR A;  3P4P C;  1R8E A;  1VF5 C;  2WDQ C;  5M1B A;  1NEN D;  3D70 A;  3VRA C;  2D2C B;  2E76 B;  3AE5 C;  4YSZ C;  4YT0 D;  3AED D;  3ABV D;  2IDB A;  5C2T C;  3AE8 C;  3AE1 D;  4H0L C;  3AEA C;  3AEB C;  3T97 B;  4I7Z B;  1NEK C;  3VR9 C;  5KKZ C;  3P4Q C;  1Q90 D;  3AEG D;  1KQF B;  1MKM A;  2WSC J;  4YTP C;  3IN6 A;  3D6Y A;  1S5L X;  4Y28 J;  2QSI A;  4Z1M H;  3R4Y A;  1KFY D;  1L0V D;  3AEE D;  4H13 D;  3AEG C;  1OMI A;  1PL5 A;  4YTP D;  3Q1M A;  2ZT9 B;  3Q2Y A;  3AE9 D;  4YSY C;  1TU3 F;  1VF5 B;  2OQQ A;  1EXI A;  2E76 C;  4YTN D;  2E75 D;  2O01 J;  3AED C;  2QIW A;  1ZME C;  1DD3 A;  3AEE C;  3EWK A;  3GMA A;  3Q5R A;  1OW8 A;  3Q5S A;  1KQG B;  3H25 A;  1WMK A;  1OW6 A;  3Q5P A;  1NEN C;  4KX6 C;  2FYN C;  4I7Z C;  1JB0 J;  3D71 A;  3P4R C;  4KT0 J;  3VRA D;  4OGQ D;  1E7P C;  1NGM B;  1NEK D;  2WS3 D;  2E74 D;  4IL6 X;  4RKU J;  4U7J A;  1KF6 C;  4YXD C;  2ACZ D;  1PV3 A;  4H0L D;  3RL0 g;  2WQY D;  4YSX D;  1NYH A;  3AEF C;  4YTM D;  2QJP C;  3AEA D;  3AE6 D;  3LW5 J;  4PV1 B;  1RQU A;  2WU5 D;  3P4S D;  1Y9B A;  1PIX A;  2JO1 A;  2BS4 C;  2QJY C;  1AJY A;  2WQY C;  3GLM A;  3P4Q D;  2WP9 C;  3GF7 A;  1K05 A;  3AE4 C;  2WU2 C;  4H44 C;  1KIL E;  2E74 B;  3P4R D;  2BS2 C;  2E76 D;  4GDO A;  2WSF J;  5C3J D;  3AE9 C;  4YSY D;  3VRB C;  2WU2 D;  3AE4 D;  1DD4 A;  4YSZ D;  2WDR D;  2WDV D;  3ABV C;  4R4L A;  1S1C X;  1VL2 A;  1ZOY C;  1UIX A;  4KX6 D;  2H89 C;  2P10 A;  3SFD C;  5KLI C;  3D6Z A;  3GF3 A;  1YQ4 C;  1FDO A;  3FGA D;  3AE3 C;  4OGQ B;  4PV1 C;  2WPV B;  1YQ3 D;  1ZOY D;  1KFY C;  2H89 D;  3AE7 D;  3AE6 C;  2G3A A;  2J5U A;  3C8V A;  4H13 B;  3AE2 C;  1GMJ A;  2YMK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...