3AEBC

Crystal structure of porcine heart mitochondrial complex ii bound with n-(3-phenoxy-phenyl)-2-trifluoromethyl-benzamide
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with N-(3-Phenoxy-phenyl)-2-trifluoromethyl-benzamide
rcsb
total genus 51
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3aebC01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3aebC02
3SFDC 1ZOYC 3AEDD 3CIRD 4YTMD 2ACZC 3VR8C 3AEAC 2WDQD 3AE9D 3AE4D 3P4PC 3AE3D 3AEGD 4YSZD 1L0VD 1NENC 3AE6D 4YT0D 3SFDD 1ZOYD 3CIRC 2WQYC 1KTMA 4YTMC 2ACZD 3VR8D 3AE1C 3AEEC 3AEBC 3P4RC 3AE3C 3P4PD 2H88C 4YSYD 3VRBC 1NEND 4YT0C 2WDRD 2WQYD 1YQ4C 3AECC 2WDVC 3AE1D 4YTPC 2WU2C 3AEED 3AEBD 3P4RD 2B76D 4YSYC 2H88D 3VRBD 4KX6D 2FBWD 1OW6A 3AE7C 3S9OA 2WDRC 2BS3C 3AE2D 1YQ4D 5C2TD 2WDVD 3AECD 2WU2D 4YTPD 1YQ3C 1NEKC 2B76C 2H89C 3AE8C 3AE5C 4YXDC 4KX6C 2FBWC 3AE7D 1QLBC 4YTNC 3AE2C 1ZP0C 5C2TC 1YQ3D 1NEKD 5C3JC 1OW8A 2H89D 3AE8D 3AE5D 4YXDD 4YSXC 3VRAC 2BS2C 4YTND 3AEFC 1ZP0D 3VR9D 2WS3C 1PV3A 5C3JD 3B71A 2WP9C 1KFYC 2WU5D 3ABVD 4YSXD 3P4QC 3VRAD 1K05A 3P4SC 3AEFD 1K04A 3SFEC 3VR9C 1KF6D 2WS3D 1E7PC 2BS4C 3AEDC 2WP9D 1KFYD 2WU5C 3ABVC 1OW7A 3P4QD 3AEAD 3AE4C 3AE9C 2WDQC 3P4SD 3AEGC 2G3AA 4YSZC 1L0VC 3AE6C 3SFED 1KF6C
chains in the Genus database with same CATH superfamily
4I7ZB 2FYNC 2OYIA 2K1AA 1BGYG 2IZ0A 1NTZK 2XKMA 5GTIH 1GW3A 2GUSA 3M0DC 1PP9G 3AEBC 4U3FE 3H6PA 1LWUC 3H1HG 1YJNP 3RK3C 2OTKE 1PGOA 3FWNA 4Y28J 2BEZF 2QJKC 4U7JA 1VQ5P 4PV1D 1URQC 1L0LK 3HTKA 2FBWD 2WDRC 1MKMA 2WSFH 1OVUA 1EDJA 2YKOA 2IBZE 3BCCE 5EFWB 3CMAP 1QL2A 1N73A 3HTKB 3CXHD 2B76C 2YKPA 3OA7A 3AE5C 1M56D 5AW7B 1FAVA 2KYVA 2OGUA 2BCCE 3TSIA 3QH9A 2RMZA 2M8RA 2OQQA 3CCLP 1DIPA 3L75D 2A06G 4LC1A 1Q81Q 3AE8D 4YSXC 4JYBA 5AVZB 1NU1E 2YXRB 1NTMG 3RL0g 2NPSA 1XTCC 3L72J 1WT6A 2ZXEB 2NPSB 2CK3H 3SFEC 3A0BH 4I7ZC 2WT7A 3H1ID 3MHVA 4IFMA 2WDQC 2POHA 3P4SD 3H1JE 3BASA 3WUTA 1L0VC 2HPCA 5CCHD 1WMKA 4I2LC 5KLVK 3CCQP 3PTZA 4DHIB 2P1JA 3CX5D 1T6AA 1PGQA 2L91A 4TT3H 1NTKD 3TGUE 1LT9A 2K37A 1SQBG 3KZIH 1URQD 2R3SA 1LT9B 3II6A 3F5HA 2WDRD 2P10A 5E79H 1DH3A 2R3CA 1EXIA 2B89A 3RL0B 2B76D 1T2KC 2KIKA 3L75J 1N73C 1GK4A 2WVRA 2R5BA 1FZAA 4UB6H 1EDIA 2QA4P 2R44A 1Q90D 1ZLLA 3AE2C 4H44C 1MFTA 3PLNA 1IZNB 2W6JH 1PP9D 2BS2C 2JKVA 1ZN5A 2NPSC 3H1IJ 1T8ZA 2Y0DA 1FBMA 1H0TB 3EFFK 3L71E 3AEFD 4LLHA 1DD3A 1KILE 1KV4A 1H88A 2WP9D 2W83C 1KFYD 1P84I 3ABVC 1NTKJ 2G3AA 1OVRA 4EDFA 1PL5A 4YPCA 4NPDA 1GTWA 2HG5D 1VPCA 4W7YA 1EZVD 2H8PD 3JCUH 2UWJE 5APYA 2A06D 3I55P 3VMAA 1LT9C 4BRYA 3CI9A 1N7SA 4EOTA 2A45G 4I1LA 1FZEA 4IOIH 2P7JA 3P4PD 4BRYB 3RL0C 3CPWO 1OIPA 1NEND 3GF3A 3HUSA 2O1JA 1KFNA 3AE1D 4YTPC 2Q5UA 1FDMA 1KB9H 3HUSB 3H1KD 3S9OA 2Z5HA 2K9YA 2WSFJ 2A45I 3L4FA 5AW2B 3AE2D 4AYCA 4H44D 2A45H 3M0AA 2OARA 1NEKC 1YTZI 1PP9J 2H89C 1VQ4P 4KX6C 1SVFA 1VF5B 5C2TC 1QX8A 3P7KA 3CXHE 2ZJSE 1VQ6P 5B5EE 1SLQA 5M1BA 3VRAC 3HD7B 1SQBD 1S5LH 4DZOA 2FXOA 2WS3C 3WUUA 2WTYA 1X22A 1MFZA 2KOGA 3ABVD 3H1LG 2FYUG 1YJ9P 4AUWA 5KKZB 2WMMA 2WZ7A 1NAFA 3L73G 1AQTA 1CW5A 1IK9A 1CI6B 5GTHE 1OXZA 2V7QH 4PD4D 5AVRB 4LGDE 2KUBA 5CJ4A 1N7SC 2XV5A 1KTMA 2YKQA 1M90Q 3CX5E 3H1KJ 3NXSA 3AEEC 3TNUA 5TJHA 3B5NA 3GHGB 4DDGA 2CPSA 4EIJA 2KNCA 1GU4A 1LJ2A 3CLQA 1NTKE 3HUSC 3D71A 1USDA 3F89A 2WQYD 3P8MC 3TNUB 1HF9A 3B5NB 1NHLA 4RKUJ 3P32A 2E43A 1LTJA 3JSVC 4U3FD 2O3JA 1SQPE 4KX6D 3AE7C 1N7LA 1Q86Q 1S9KD 5AVUB 4OGQD 3Q5RA 5GTIE 5C2TD 1HWTC 3BRTB 3L71G 1VF5C 1QLED 1AA0A 4YXDC 1SQBJ 3G4SP 1L4AA 4WB4A 3V4QA 2O1KA 1SQXG 1FZCA 1KB9D 2IBZD 3HD7C 3W67A 2IYOA 1G1IA 1TFFA 1L4AB 3C1LA 1BGYE 3L74G 1JMMA 1DEEG 2AEJA 5CMZA 3U59A 4O9BA 1NU1D 1NU1K 1K05A 1PP9E 5KJ7C 3RGUA 5KKZC 1YI2P 1L0NG 3VR9C 3H1HE 4RESB 1YTZT 1M1JB 3VTPC 1GL2A 4L76A 3AE6C 1GL2B 4JYCA 1N7SD 1N86A 1NTZG 3Q2YA 5APSA 2N9BA 1GK6A 3H25A 3AE9D 1ZXGA 3GHGC 3PRJA 3H1JD 5APVA 2QM7A 1ZV8A 1NAYA 5APUA 4U3FJ 1LTIC 3KDPB 1KQGB 3B5NC 2JO1A 3WUVA 2Q3EA 3KYQA 4DHZA 2A06E 3SSUA 2KB7P 5KTBA 2N1TD 1LTJC 1L0LG 1NTME 2FXPA 2FYUD 1AQ5A 2E74B 1NKZB 2AEFA 3G9RA 1YHQP 1VL2A 4WVZA 2WWWA 1LWUA 1L4AC 1LTSC 5AVVB 2C0XA 3BRVB 3M91A 3KZIE 2FYZA 2M3BA 1NU1J 1Y8AA 2PGDA 5E79E 1MZ9A 1BDCA 2DW3A 1HUCA 3GMAA 4Z1MH 1JY2O 3VR9D 1YJWP 3IR9A 2WPQA 1SQBE 1PGJA 4UB6E 1GL2C 4JPZB 4IL6H 2IFMA 4H0LC 1OW7A 3H1JJ 4N3YB 2QJYB 3R4YA 3L71D 2AXCA 5KLVG 3U1CA 1ZRTE 1ZOYC 4A7PA 3GLMA 1RY3A 3AE4D 3V4WA 2OYHB 2V7QJ 3AEGD 1SQVG 2Q9IA 2ACZD 2FYUJ 2Y9ZA 3L74D 2Q7CA 3P4RC 3K5BA 2V4HA 3RK2D 3M9QA 4WY4D 1LGHB 3VN0A 2E74C 5AW3B 2GM4A 4XE5B 3VRBD 5AW6B 4D6TG 3JCUE 1GD2E 3VP9A 3BVHA 3FWLA 4N78E 4EYYQ 1MUUA 2MKVA 1S9KE 2W27A 1PPJG 3QWOC 3SWYA 1SQQG 1W2BO 2Z4EA 1YQ3D 1AV1A 1N8RQ 1DX7A 1E5WA 1KB9E 1QEXA 3MD0A 3D70A 1M7LA 3LW5J 3GF7A 3L71J 1HH0A 4H0LD 3P4QC 1YITP 2M3EA 4GIFA 2XZRA 4KHXA 3E7KA 2K3RA 3HE4A 2O01H 3CCEP 2O01N 3HE4B 2OYHC 3SWKA 3L74J 1S5LE 3AEAC 2PP6A 1PFIA 3MZWB 4L73A 3EQ2A 4I6MC 2E76B 1AVYA 2AEMA 1ZW0A 1JY3P 2YO2A 4C46A 2BASA 1M57D 1BE3G 2XU6A 2D2CB 2H88C 1Z56A 1GW4A 1DEBA 1EZVI 5AW8B 1LNQA 3AEBD 3G6EP 4YSYC 2KP8A 1FE6A 2KSJA 1RF1B 1NTKK 3OJAB 3RK3D 3MP7B 1OWAA 2VRSA 2N9YB 3H1LE 2ZFCA 1SFCA 2IPPA 4R4LA 1LTTC 2FYUE 1SQPD 2FXMA 1SFCB 1NVOA 4PJ0H 4K35A 2FKWB 2KK7A 1HVVA 5AVTB 3EWKA 5C3JC 5C39A 1OW8A 3L73E 3AE5D 4DCKA 3TYYA 1W5CE 4OVNF 2WPSA 1PV3A 4WWIA 5CBOA 4UB8H 4YSXD 1S5LX 1FOSF 1BGYD 4Y99B 2JJLA 1A02J 3FGAD 2BS4C 1HTLC 4D6TD 3AEAD 3OAKA 3C8VA 1H0TA 3CL3D 4YSZC 1KYOI 3SFED 3H1HD 2E76C 1NKNA 1ZR2A 5AW9B 4KJMA 2E75B 2WDQD 1PPJD 1SQQD 1L0VD 2QEXP 4YTMC 3CD6P 2LXBA 1SQXE 1P84H 2Y9YA 2HYNA 3TK1A 4YSYD 4GODA 1VQPP 1RF1C 3IAOA 1YQ4C 4PD4I 3AECC 2Y0EA 1SQPJ 3L74E 2WU2C 4OH8B 2ITAA 2ZYDA 2KZIA 4QMAA 3A5TA 5K5GB 2W6BA 3HE5B 3A2AA 2QIWA 1SFCC 4W80A 1VQ7P 1L0NE 1NTMD 1T2KD 1YIJP 4WBAA 1HGZA 4YTNC 3CCRP 2JWAA 3KXDA 3R2PA 1KN7A 2YNYA 1BGYJ 2QRXA 1NTZE 1G2CA 1FS0E 2KLUA 4Y99C 1PIXA 4D6TJ 1BSNA 2QVAA 2RKLA 1G2CB 3WU2H 1EQ7A 5BU5A 3G71P 2IBZI 3H1HJ 3PP5A 1J1DB 5AVYB 1NOHA 3HD7A 2NPSD 3U1AA 1R5LA 4DJGA 1SQQJ 2O01J 2ZVOB 2P67A 4W7ZA 2E75C 3CCVP 1SQBK 1L0LE 2PFXA 2JR8A 4L75A 4YTMD 1OFCX 2YMKA 2ZT9B 1VDFA 2KLVA 5KJ7A 2PRRA 4JF7A 1ZRTD 1NJIQ 5CCGA 2QSIA 5L8RJ 1RH5B 3V2PA 3Q3DA 1GMJA 2WSEH 2QJPB 1CI6A 1S1CX 4IL6E 3UIAA 1NTMJ 1IFDA 1H8AA 4GKGA 1Y9BA 3RL0D 3VMYA 3GHGA 5H2FH 1OVVA 3IFMA 1TU3F 4YTPD 1IFMA 3B4SA 3CCMP 3P8CE 1IC2A 4H13B 3RK3E 1VQNP 4N78D 5KLVE 1NEKD 2H89D 1FZGA 5CJ0A 1KILB 1JMBA 1SQVE 2ZYAA 3Q5SA 4GDOA 1LP1A 3VRAD 1HGVA 1U57A 2W90A 2NRGA 2WS3D 1RQVA 3AEDC 3ZDMA 1LP1B 2JDIH 1YYCA 3KQGA 4XA4A 1JCCA 2ZT9C 4IL6X 3H32A 4ZNCA 3SFDC 3VR8C 1M1JA 4D6TE 1PGPA 4ZKPA 1IO4A 2CPBA 4C7RA 2JP3A 3H32B 1MV8A 2RH0A 3MIWA 2QJPC 2W8ZA 1KQSO 3WMM0 1U7JA 4HB1A 5CCGC 1EXJA 5KLIB 1PPJE 3AE3C 3E1RA 1SQQE 1K73Q 5KAFH 1QGKB 2WDVC 2ZFYA 3AEED 1GZLA 4PV1B 4L74A 3NTNA 4H13C 3KHUA 1UIXA 2L5GB 1IFPA 1T3UA 2ZYGA 3A0BE 3AE7D 1CZQA 2E42A 2Q1KA 4HKZH 1ZP0C 3H1LD 1VF5D 1OMIA 2FYUK 4YXDD 3ITKA 3CMEP 3HD7D 1RE4A 3O6QA 2QG4A 5B66H 3L73D 3LIDA 3GW6A 3O6QB 3L70G 3L75G 1BE3E 4FJVA 1KC8Q 5CCHA 2WU5C 4PJ0E 1ZMEC 1VQLP 2QE7H 1WRGA 5KJ7D 4NPFX 3CXHI 1J2JB 1KF6C 2KI7B 1M1JC 5CCGD 2I1JA 3O8ZA 1PZQA 2J58A 1DD4A 1QVGO 1LTBC 3AE3D 3NFQA 2FY8A 4UB8E 3AE6D 1S2EA 2K9JA 1FC2C 1JY2N 1URQB 4ZKUA 2K9JB 2WSEJ 1NWQA 4HYTB 1BCCE 2OYHA 2WSCH 1JNMA 1SQXD 3B5ND 4C7NB 2GUVA 3C9IA 5BU8B 3H1LJ 2RN0A 4ASWA 1X8YA 2LXCB 1VQ9P 3AE8C 1P84E 3CX5I 3MUDA 3S1KA 2HR3A 1R5SA 3L73J 1L0ND 4XFJA 1L4AD 3NMDA 3V2QA 3S4RA 1GDTA 2MJZA 1RE4C 1Y47A 1JM0A 2WU5D 2JEEA 1J1EB 3A7OA 1NTZD 2AXTH 3CCJP 3P4SC 3PJSK 2OYIB 1JCDA 1QL1A 1KF6D 4LDTA 5CCHC 1H89A 2E5TA 1SP4A 2ZAEB 3CWBE 1VQMP 3RBZA 1X79B 4R4MA 1GL2D 1RF0A 4RJTA 1VQ8P 3D6ZA 4DHJA 2QJYC 3MGNA 3WU2E 1S72P 1L0LD 1SQXJ 1FZFA 1ZOYD 5DJTB 3A0HH 1IK7A 3GG2A 1RHZB 2HFED 1N73B 1EZVG 4IFFA 3P4RD 3L70D 3HRNA 2E74D 1L0NJ 4H44B 3L36A 1Q2NA 1N2DC 1JEKA 2H43A 4BXLA 2G8YA 4RO0A 3MUDC 5APWA 3VMXA 4I6LA 5AVXB 2OTLP 1RF1A 3I56P 1BDDA 3H1KG 1NTZJ 3P8CD 1RE3A 1OZHA 1J1EC 3AEFC 3N4XA 5H2FE 2WT7B 5KLVD 2OYIC 2WP9C 3Q1MA 1KFYC 1KZUB 1SQPK 3W68A 2HLOA 2HPCB 1K04A 5CBNA 1E7PC 2I8DA 1BCCG 1SQVD 5KAIH 1SQVK 3EFGA 1L0LJ 3P4QD 1G1JA 1OX3A 5BVZA 3CC4P 1RF0C 4M3LA 4N6JA 3P4PC 1NENC 1AVOA 3USSA 3L70J 3AE1C 2BEQD 3IN6A 4YT0C 1D7MA 1KYOH 2WSCJ 2KZJA 2H88D 1SQQK 2D2CC 1M1KQ 4OGQB 2LKMA 3N7NA 1JO5A 2I1KA 1X0TA 1L2PA 2J59M 2XDJA 1FZBA 3CWBG 2K88A 5KLVJ 1GU5A 1KQFB 5TISH 3D6YA 3HE5A 1JY3O 4U3FG 5KAFE 1FOSE 2OYOA 4PD4H 1RE3C 3T97A 4ASVA 2IX7C 3Q5PA 1LTAC 1SQVJ 2LR2A 3V5BA 2NZ2A 3T97B 4DT0A 1ZR4A 3MTUE 1NTMK 5C3JD 1JTHA 2R5DA 1UIIA 1JY3N 2IBZG 3BCCG 1FU1A 2KSEA 1IFIA 3L72E 2SPZA 1JTHB 1RQUA 3VYIA 2BCCG 1JUNA 3CCSP 1IFNA 2IYPA 1LT1A 1BE3D 1N7SB 1NU1G 2Q6QA 1KB9I 1VQKP 3TDKA 1SS1A 5B66E 4YSZD 1A02F 4YT0D 2W6AA 1NO4A 1S4XA 2E76D 1M8OB 2WQYC 1NH4A 2IDBA 2C9LY 2N1TA 4DDIA 3TF5A 2D2CD 3CCUP 2IFNA 2WITA 4OGQC 3VONA 2N1TB 1R8EA 3KPEA 4HH2A 3H1JG 5DJUB 4YXWH 2Z5IA 1BSHA 3CC7P 1OW6A 4JQ0D 1BCCD 2BS3C 1YQ4D 5AW0B 3AECD 1U7MA 2WU2D 3L70E 3FXEA 3L75E 1KYOD 2GA1A 3TGUG 1LTGC 1NYHA 1QLBC 1FJKA 3L35A 1SFCD 1S3JA 1X9VA 2C0WA 1FDOA 4BWNA 3PH0A 4NPEA 1P84D 4YTND 1Q82Q 2HODA 3PHLA 2WPRA 3H1IE 1BE3J 2HODB 2YO3A 1KILA 1NGMB 4TLFA 3AE9C 1J1DC 3FX0A 3V6IA 4MN4C 3CWBD 2KNCB 2E75D 4WY4A 1HJ0A 2WPVB 2AXTE 3CIRC 3L37A 1JB0J 3OW2O 1LTJB 4JBZA 4ZMDA 1EDLA 2N1TC 5APTA 3RK2B 1BCCJ 4WY4B 1USEA 4KT0J 4HJGH 1AFOA 1JY2P 3BCCD 2OTJP 1QVFO 1FZCB 1KD1Q 5AW5B 2BCCD 2C9NY 3L72G 1KFMA 2KXPB 3LW5H 3RBXA 1VQOP 3A0HE 3M9BA 2B87A 2Y0CA 4B86A 2KS1A 2IZ1A 2YIUB 2B87B 2FFDA 5AVSB 3LIEA 2Q3IA 3V2RA 2KS1B 3SWFA 3I5CA 2FFDB 4H0LB 3B71A 1FDIA 1KORA 4GT1A 4GOFA 3CC2P 3V2NA 3CWBJ 1KILC 1EC5A 1AJYA 4DOJA 3AE4C 3VP8A 1EZVE 3AEGC 1XTGB 5APXA 1KQLA 3TGUD 2P58A 5AW1B 3AEDD 3CIRD 5AVQB 2ACZC 1IFJA 2R32A 2ZT9D 3RK2C 4WY4C 3BCCJ 2FYNB 3M0DA 3SFDD 2ZVNB 2M5AA 3VR8D 2XNXA 3A3YB 2BCCJ 5KAIE 3VRBC 3H1KE 3IF4A 2M5AB 1JOCA 1FZCC 3CXHH 2M0BA 5B5EH 3M06A 2JWDA 4IFDK 1LWUB 1HJBA 5KLIC 5APQA 2B9BA 3RK3B 1URQA 1K8AQ 3H1IG 2PAJA 4EI2A 4CPGA 1E79H 2WDVD 2QJKB 1W2EA 1YQ3C 4PV1C 2P2UA 4H13D 2FBWC 2YIUC 2E5YA 4C7NA 4OWFA 2YXQB 1SQXK 1CSBA 3M9HA 3VMZA 1KYOE 1NTKG 2J5UA 2FFDC 1HBWA 4AQRD 1ZP0D 2WSSH 5GTHH 1IJDB 2XNDH 1KILD 1SQPG 5CHXA 3BATA 3G3ZA 2B88A 2ZXXA 2QM8A 3TGUJ 1Q7YQ 1KMIZ 3B8EB 3CX5H 1EDKA 5AW4B 3VOPA 3JC22 1L0NK 4K3AA 1T3JA 3E1IA 5TISE 2H7HA 1K9MQ 1FJPA 4PD4E 3L72D 3FXDA 2YMYA 4GOEA 5AVWB 1YBKA
chains in the Genus database with same CATH topology
4R4MA 2E76C 4I7ZB 3SFDC 1ZOYC 2FYNC 1WMKA 3AEDD 1PL5A 3CIRD 4YTMD 3Q2YA 2ACZC 3VR8C 3D6ZA 2YMKA 2ZT9B 3AEAC 3GLMA 3H25A 2JP3A 2E75B 2WDQD 3AE9D 3AE4D 2QJYC 2ZT9D 1DD4A 2E75D 3P4PC 3AE3D 2V7QJ 3AEGD 2QJPC 4TT3H 2E76B 1L0VD 1NENC 3AE6D 4YT0D 4YSZD 3SFDD 2E76D 1HJ0A 2WPVB 1ZOYD 3CIRC 2WQYC 1KTMA 4YTMC 2ACZD 3VR8D 2IDBA 1JB0J 1EXJA 1KQGB 2QSIA 3AE1C 5L8RJ 3AEEC 3Q3DA 1GMJA 3AEBC 3P4RC 2JO1A 1IK7A 2BEQD 3AE3C 3P4PD 2D2CB 2WSEJ 1S1CX 2H88C 4YSYD 3VRBC 3IN6A 2D2CD 1NEND 4YT0C 3GF3A 4KT0J 3D71A 2WDRD 2E74C 2WSCJ 2WQYD 3IAOA 4OGQC 2P10A 1HF9A 1YQ4C 1R8EA 3AECC 4Y28J 2WDVC 3AE1D 4YTPC 2BEZF 4RKUJ 2WU2C 3AEED 1EXIA 3AEBD 4PV1B 3P4RD 2QJKC 1Y9BA 4U7JA 5KLIC 2FXPA 2B76D 4PV1D 4YSYC 2H88D 3VRBD 2D2CC 4H13C 2FBWD 1OW6A 4KX6D 2E74B 3AE7C 3S9OA 4OGQB 2WDRC 1MKMA 1UIXA 2E74D 2K9YA 2BS3C 4OGQD 4H44B 2WSFJ 3Q5RA 1TU3F 3AE2D 2QIWA 1YQ4D 3G9RA 5C2TD 4H44D 2WDVD 3AECD 1VF5C 2WU2D 1VL2A 4YTPD 2G8YA 4R4LA 1YQ3C 1NEKC 2B76C 4H13B 4PV1C 2H89C 3AE8C 3AE5C 4YXDC 4H13D 2FBWC 1NYHA 2YIUC 4KX6C 2MKVA 3AE7D 3RK3E 1QLBC 1Q90D 4YTNC 3AE2C 1KQFB 3D6YA 1VF5B 1ZP0C 5C2TC 4H44C 2OQQA 1VF5D 1OMIA 3EWKA 1DIPA 1YQ3D 1NEKD 5C3JC 1OW8A 2J5UA 2H89D 1FDOA 3AE8D 3AE5D 4XFJA 4YXDD 4YSXC 3Q5PA 5M1BA 3VRAC 2BS2C 4YTND 3AEFC 1ZP0D 2NZ2A 3RL0g 3GMAA 3T97B 1PIXA 4Z1MH 3O6QA 2WS3C 3VR9D 1PV3A 5C3JD 4H0LB 3B71A 1FDIA 3Q1MA 3D70A 3LW5J 3GF7A 1KORA 1KFYC 2WP9C 3Q5SA 4H0LD 2WU5D 3ABVD 4YSXD 1S5LX 4GDOA 3P4QC 3VRAD 1K05A 1U57A 3P4SC 3AEFD 1K04A 5KKZC 1KMIZ 3SFEC 3VR9C 1KF6D 1RQUA 3FGAD 1E7PC 2WS3D 2BS4C 1KILE 1DD3A 1RQVA 3AEDC 2WP9D 4I7ZC 1KFYD 1AJYA 2WU5C 1ZMEC 4H0LC 3ABVC 1NGMB 1OW7A 3P4QD 3AEAD 2O01J 3AE4C 3AE9C 2WDQC 3R4YA 2ZT9C 3C8VA 2E75C 3P4SD 3AEGC 4IL6X 2G3AA 4YSZC 1L0VC 3AE6C 3SFED 1KF6C 1ZRTE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SFD C;  1ZOY C;  3AED D;  3CIR D;  4YTM D;  2ACZ C;  3VR8 C;  3AEA C;  2WDQ D;  3AE9 D;  3AE4 D;  3P4P C;  3AE3 D;  3AEG D;  4YSZ D;  1L0V D;  1NEN C;  3AE6 D;  4YT0 D;  3SFD D;  1ZOY D;  3CIR C;  2WQY C;  1KTM A;  4YTM C;  2ACZ D;  3VR8 D;  3AE1 C;  3AEE C;  3AEB C;  3P4R C;  3AE3 C;  3P4P D;  2H88 C;  4YSY D;  3VRB C;  1NEN D;  4YT0 C;  2WDR D;  2WQY D;  1YQ4 C;  3AEC C;  2WDV C;  3AE1 D;  4YTP C;  2WU2 C;  3AEE D;  3AEB D;  3P4R D;  2B76 D;  4YSY C;  2H88 D;  3VRB D;  4KX6 D;  2FBW D;  1OW6 A;  3AE7 C;  3S9O A;  2WDR C;  2BS3 C;  3AE2 D;  1YQ4 D;  5C2T D;  2WDV D;  3AEC D;  2WU2 D;  4YTP D;  1YQ3 C;  1NEK C;  2B76 C;  2H89 C;  3AE8 C;  3AE5 C;  4YXD C;  4KX6 C;  2FBW C;  3AE7 D;  1QLB C;  4YTN C;  3AE2 C;  1ZP0 C;  5C2T C;  1YQ3 D;  1NEK D;  5C3J C;  1OW8 A;  2H89 D;  3AE8 D;  3AE5 D;  4YXD D;  4YSX C;  3VRA C;  2BS2 C;  4YTN D;  3AEF C;  1ZP0 D;  3VR9 D;  2WS3 C;  1PV3 A;  5C3J D;  3B71 A;  2WP9 C;  1KFY C;  2WU5 D;  3ABV D;  4YSX D;  3P4Q C;  3VRA D;  1K05 A;  3P4S C;  3AEF D;  1K04 A;  3SFE C;  3VR9 C;  1KF6 D;  2WS3 D;  1E7P C;  2BS4 C;  3AED C;  2WP9 D;  1KFY D;  2WU5 C;  3ABV C;  1OW7 A;  3P4Q D;  3AEA D;  3AE4 C;  3AE9 C;  2WDQ C;  3P4S D;  3AEG C;  2G3A A;  4YSZ C;  1L0V C;  3AE6 C;  3SFE D;  1KF6 C; 
#chains in the Genus database with same CATH topology
 4I7Z B;  2FYN C;  2OYI A;  2K1A A;  1BGY G;  2IZ0 A;  1NTZ K;  2XKM A;  5GTI H;  1GW3 A;  2GUS A;  3M0D C;  1PP9 G;  3AEB C;  4U3F E;  3H6P A;  1LWU C;  3H1H G;  1YJN P;  3RK3 C;  2OTK E;  1PGO A;  3FWN A;  4Y28 J;  2BEZ F;  2QJK C;  4U7J A;  1VQ5 P;  4PV1 D;  1URQ C;  1L0L K;  3HTK A;  2FBW D;  2WDR C;  1MKM A;  2WSF H;  1OVU A;  1EDJ A;  2YKO A;  2IBZ E;  3BCC E;  5EFW B;  3CMA P;  1QL2 A;  1N73 A;  3HTK B;  3CXH D;  2B76 C;  2YKP A;  3OA7 A;  3AE5 C;  1M56 D;  5AW7 B;  1FAV A;  2KYV A;  2OGU A;  2BCC E;  3TSI A;  3QH9 A;  2RMZ A;  2M8R A;  2OQQ A;  3CCL P;  1DIP A;  3L75 D;  2A06 G;  4LC1 A;  1Q81 Q;  3AE8 D;  4YSX C;  4JYB A;  5AVZ B;  1NU1 E;  2YXR B;  1NTM G;  3RL0 g;  2NPS A;  1XTC C;  3L72 J;  1WT6 A;  2ZXE B;  2NPS B;  2CK3 H;  3SFE C;  3A0B H;  4I7Z C;  2WT7 A;  3H1I D;  3MHV A;  4IFM A;  2WDQ C;  2POH A;  3P4S D;  3H1J E;  3BAS A;  3WUT A;  1L0V C;  2HPC A;  5CCH D;  1WMK A;  4I2L C;  5KLV K;  3CCQ P;  3PTZ A;  4DHI B;  2P1J A;  3CX5 D;  1T6A A;  1PGQ A;  2L91 A;  4TT3 H;  1NTK D;  3TGU E;  1LT9 A;  2K37 A;  1SQB G;  3KZI H;  1URQ D;  2R3S A;  1LT9 B;  3II6 A;  3F5H A;  2WDR D;  2P10 A;  5E79 H;  1DH3 A;  2R3C A;  1EXI A;  2B89 A;  3RL0 B;  2B76 D;  1T2K C;  2KIK A;  3L75 J;  1N73 C;  1GK4 A;  2WVR A;  2R5B A;  1FZA A;  4UB6 H;  1EDI A;  2QA4 P;  2R44 A;  1Q90 D;  1ZLL A;  3AE2 C;  4H44 C;  1MFT A;  3PLN A;  1IZN B;  2W6J H;  1PP9 D;  2BS2 C;  2JKV A;  1ZN5 A;  2NPS C;  3H1I J;  1T8Z A;  2Y0D A;  1FBM A;  1H0T B;  3EFF K;  3L71 E;  3AEF D;  4LLH A;  1DD3 A;  1KIL E;  1KV4 A;  1H88 A;  2WP9 D;  2W83 C;  1KFY D;  1P84 I;  3ABV C;  1NTK J;  2G3A A;  1OVR A;  4EDF A;  1PL5 A;  4YPC A;  4NPD A;  1GTW A;  2HG5 D;  1VPC A;  4W7Y A;  1EZV D;  2H8P D;  3JCU H;  2UWJ E;  5APY A;  2A06 D;  3I55 P;  3VMA A;  1LT9 C;  4BRY A;  3CI9 A;  1N7S A;  4EOT A;  2A45 G;  4I1L A;  1FZE A;  4IOI H;  2P7J A;  3P4P D;  4BRY B;  3RL0 C;  3CPW O;  1OIP A;  1NEN D;  3GF3 A;  3HUS A;  2O1J A;  1KFN A;  3AE1 D;  4YTP C;  2Q5U A;  1FDM A;  1KB9 H;  3HUS B;  3H1K D;  3S9O A;  2Z5H A;  2K9Y A;  2WSF J;  2A45 I;  3L4F A;  5AW2 B;  3AE2 D;  4AYC A;  4H44 D;  2A45 H;  3M0A A;  2OAR A;  1NEK C;  1YTZ I;  1PP9 J;  2H89 C;  1VQ4 P;  4KX6 C;  1SVF A;  1VF5 B;  5C2T C;  1QX8 A;  3P7K A;  3CXH E;  2ZJS E;  1VQ6 P;  5B5E E;  1SLQ A;  5M1B A;  3VRA C;  3HD7 B;  1SQB D;  1S5L H;  4DZO A;  2FXO A;  2WS3 C;  3WUU A;  2WTY A;  1X22 A;  1MFZ A;  2KOG A;  3ABV D;  3H1L G;  2FYU G;  1YJ9 P;  4AUW A;  5KKZ B;  2WMM A;  2WZ7 A;  1NAF A;  3L73 G;  1AQT A;  1CW5 A;  1IK9 A;  1CI6 B;  5GTH E;  1OXZ A;  2V7Q H;  4PD4 D;  5AVR B;  4LGD E;  2KUB A;  5CJ4 A;  1N7S C;  2XV5 A;  1KTM A;  2YKQ A;  1M90 Q;  3CX5 E;  3H1K J;  3NXS A;  3AEE C;  3TNU A;  5TJH A;  3B5N A;  3GHG B;  4DDG A;  2CPS A;  4EIJ A;  2KNC A;  1GU4 A;  1LJ2 A;  3CLQ A;  1NTK E;  3HUS C;  3D71 A;  1USD A;  3F89 A;  2WQY D;  3P8M C;  3TNU B;  1HF9 A;  3B5N B;  1NHL A;  4RKU J;  3P32 A;  2E43 A;  1LTJ A;  3JSV C;  4U3F D;  2O3J A;  1SQP E;  4KX6 D;  3AE7 C;  1N7L A;  1Q86 Q;  1S9K D;  5AVU B;  4OGQ D;  3Q5R A;  5GTI E;  5C2T D;  1HWT C;  3BRT B;  3L71 G;  1VF5 C;  1QLE D;  1AA0 A;  4YXD C;  1SQB J;  3G4S P;  1L4A A;  4WB4 A;  3V4Q A;  2O1K A;  1SQX G;  1FZC A;  1KB9 D;  2IBZ D;  3HD7 C;  3W67 A;  2IYO A;  1G1I A;  1TFF A;  1L4A B;  3C1L A;  1BGY E;  3L74 G;  1JMM A;  1DEE G;  2AEJ A;  5CMZ A;  3U59 A;  4O9B A;  1NU1 D;  1NU1 K;  1K05 A;  1PP9 E;  5KJ7 C;  3RGU A;  5KKZ C;  1YI2 P;  1L0N G;  3VR9 C;  3H1H E;  4RES B;  1YTZ T;  1M1J B;  3VTP C;  1GL2 A;  4L76 A;  3AE6 C;  1GL2 B;  4JYC A;  1N7S D;  1N86 A;  1NTZ G;  3Q2Y A;  5APS A;  2N9B A;  1GK6 A;  3H25 A;  3AE9 D;  1ZXG A;  3GHG C;  3PRJ A;  3H1J D;  5APV A;  2QM7 A;  1ZV8 A;  1NAY A;  5APU A;  4U3F J;  1LTI C;  3KDP B;  1KQG B;  3B5N C;  2JO1 A;  3WUV A;  2Q3E A;  3KYQ A;  4DHZ A;  2A06 E;  3SSU A;  2KB7 P;  5KTB A;  2N1T D;  1LTJ C;  1L0L G;  1NTM E;  2FXP A;  2FYU D;  1AQ5 A;  2E74 B;  1NKZ B;  2AEF A;  3G9R A;  1YHQ P;  1VL2 A;  4WVZ A;  2WWW A;  1LWU A;  1L4A C;  1LTS C;  5AVV B;  2C0X A;  3BRV B;  3M91 A;  3KZI E;  2FYZ A;  2M3B A;  1NU1 J;  1Y8A A;  2PGD A;  5E79 E;  1MZ9 A;  1BDC A;  2DW3 A;  1HUC A;  3GMA A;  4Z1M H;  1JY2 O;  3VR9 D;  1YJW P;  3IR9 A;  2WPQ A;  1SQB E;  1PGJ A;  4UB6 E;  1GL2 C;  4JPZ B;  4IL6 H;  2IFM A;  4H0L C;  1OW7 A;  3H1J J;  4N3Y B;  2QJY B;  3R4Y A;  3L71 D;  2AXC A;  5KLV G;  3U1C A;  1ZRT E;  1ZOY C;  4A7P A;  3GLM A;  1RY3 A;  3AE4 D;  3V4W A;  2OYH B;  2V7Q J;  3AEG D;  1SQV G;  2Q9I A;  2ACZ D;  2FYU J;  2Y9Z A;  3L74 D;  2Q7C A;  3P4R C;  3K5B A;  2V4H A;  3RK2 D;  3M9Q A;  4WY4 D;  1LGH B;  3VN0 A;  2E74 C;  5AW3 B;  2GM4 A;  4XE5 B;  3VRB D;  5AW6 B;  4D6T G;  3JCU E;  1GD2 E;  3VP9 A;  3BVH A;  3FWL A;  4N78 E;  4EYY Q;  1MUU A;  2MKV A;  1S9K E;  2W27 A;  1PPJ G;  3QWO C;  3SWY A;  1SQQ G;  1W2B O;  2Z4E A;  1YQ3 D;  1AV1 A;  1N8R Q;  1DX7 A;  1E5W A;  1KB9 E;  1QEX A;  3MD0 A;  3D70 A;  1M7L A;  3LW5 J;  3GF7 A;  3L71 J;  1HH0 A;  4H0L D;  3P4Q C;  1YIT P;  2M3E A;  4GIF A;  2XZR A;  4KHX A;  3E7K A;  2K3R A;  3HE4 A;  2O01 H;  3CCE P;  2O01 N;  3HE4 B;  2OYH C;  3SWK A;  3L74 J;  1S5L E;  3AEA C;  2PP6 A;  1PFI A;  3MZW B;  4L73 A;  3EQ2 A;  4I6M C;  2E76 B;  1AVY A;  2AEM A;  1ZW0 A;  1JY3 P;  2YO2 A;  4C46 A;  2BAS A;  1M57 D;  1BE3 G;  2XU6 A;  2D2C B;  2H88 C;  1Z56 A;  1GW4 A;  1DEB A;  1EZV I;  5AW8 B;  1LNQ A;  3AEB D;  3G6E P;  4YSY C;  2KP8 A;  1FE6 A;  2KSJ A;  1RF1 B;  1NTK K;  3OJA B;  3RK3 D;  3MP7 B;  1OWA A;  2VRS A;  2N9Y B;  3H1L E;  2ZFC A;  1SFC A;  2IPP A;  4R4L A;  1LTT C;  2FYU E;  1SQP D;  2FXM A;  1SFC B;  1NVO A;  4PJ0 H;  4K35 A;  2FKW B;  2KK7 A;  1HVV A;  5AVT B;  3EWK A;  5C3J C;  5C39 A;  1OW8 A;  3L73 E;  3AE5 D;  4DCK A;  3TYY A;  1W5C E;  4OVN F;  2WPS A;  1PV3 A;  4WWI A;  5CBO A;  4UB8 H;  4YSX D;  1S5L X;  1FOS F;  1BGY D;  4Y99 B;  2JJL A;  1A02 J;  3FGA D;  2BS4 C;  1HTL C;  4D6T D;  3AEA D;  3OAK A;  3C8V A;  1H0T A;  3CL3 D;  4YSZ C;  1KYO I;  3SFE D;  3H1H D;  2E76 C;  1NKN A;  1ZR2 A;  5AW9 B;  4KJM A;  2E75 B;  2WDQ D;  1PPJ D;  1SQQ D;  1L0V D;  2QEX P;  4YTM C;  3CD6 P;  2LXB A;  1SQX E;  1P84 H;  2Y9Y A;  2HYN A;  3TK1 A;  4YSY D;  4GOD A;  1VQP P;  1RF1 C;  3IAO A;  1YQ4 C;  4PD4 I;  3AEC C;  2Y0E A;  1SQP J;  3L74 E;  2WU2 C;  4OH8 B;  2ITA A;  2ZYD A;  2KZI A;  4QMA A;  3A5T A;  5K5G B;  2W6B A;  3HE5 B;  3A2A A;  2QIW A;  1SFC C;  4W80 A;  1VQ7 P;  1L0N E;  1NTM D;  1T2K D;  1YIJ P;  4WBA A;  1HGZ A;  4YTN C;  3CCR P;  2JWA A;  3KXD A;  3R2P A;  1KN7 A;  2YNY A;  1BGY J;  2QRX A;  1NTZ E;  1G2C A;  1FS0 E;  2KLU A;  4Y99 C;  1PIX A;  4D6T J;  1BSN A;  2QVA A;  2RKL A;  1G2C B;  3WU2 H;  1EQ7 A;  5BU5 A;  3G71 P;  2IBZ I;  3H1H J;  3PP5 A;  1J1D B;  5AVY B;  1NOH A;  3HD7 A;  2NPS D;  3U1A A;  1R5L A;  4DJG A;  1SQQ J;  2O01 J;  2ZVO B;  2P67 A;  4W7Z A;  2E75 C;  3CCV P;  1SQB K;  1L0L E;  2PFX A;  2JR8 A;  4L75 A;  4YTM D;  1OFC X;  2YMK A;  2ZT9 B;  1VDF A;  2KLV A;  5KJ7 A;  2PRR A;  4JF7 A;  1ZRT D;  1NJI Q;  5CCG A;  2QSI A;  5L8R J;  1RH5 B;  3V2P A;  3Q3D A;  1GMJ A;  2WSE H;  2QJP B;  1CI6 A;  1S1C X;  4IL6 E;  3UIA A;  1NTM J;  1IFD A;  1H8A A;  4GKG A;  1Y9B A;  3RL0 D;  3VMY A;  3GHG A;  5H2F H;  1OVV A;  3IFM A;  1TU3 F;  4YTP D;  1IFM A;  3B4S A;  3CCM P;  3P8C E;  1IC2 A;  4H13 B;  3RK3 E;  1VQN P;  4N78 D;  5KLV E;  1NEK D;  2H89 D;  1FZG A;  5CJ0 A;  1KIL B;  1JMB A;  1SQV E;  2ZYA A;  3Q5S A;  4GDO A;  1LP1 A;  3VRA D;  1HGV A;  1U57 A;  2W90 A;  2NRG A;  2WS3 D;  1RQV A;  3AED C;  3ZDM A;  1LP1 B;  2JDI H;  1YYC A;  3KQG A;  4XA4 A;  1JCC A;  2ZT9 C;  4IL6 X;  3H32 A;  4ZNC A;  3SFD C;  3VR8 C;  1M1J A;  4D6T E;  1PGP A;  4ZKP A;  1IO4 A;  2CPB A;  4C7R A;  2JP3 A;  3H32 B;  1MV8 A;  2RH0 A;  3MIW A;  2QJP C;  2W8Z A;  1KQS O;  3WMM 0;  1U7J A;  4HB1 A;  5CCG C;  1EXJ A;  5KLI B;  1PPJ E;  3AE3 C;  3E1R A;  1SQQ E;  1K73 Q;  5KAF H;  1QGK B;  2WDV C;  2ZFY A;  3AEE D;  1GZL A;  4PV1 B;  4L74 A;  3NTN A;  4H13 C;  3KHU A;  1UIX A;  2L5G B;  1IFP A;  1T3U A;  2ZYG A;  3A0B E;  3AE7 D;  1CZQ A;  2E42 A;  2Q1K A;  4HKZ H;  1ZP0 C;  3H1L D;  1VF5 D;  1OMI A;  2FYU K;  4YXD D;  3ITK A;  3CME P;  3HD7 D;  1RE4 A;  3O6Q A;  2QG4 A;  5B66 H;  3L73 D;  3LID A;  3GW6 A;  3O6Q B;  3L70 G;  3L75 G;  1BE3 E;  4FJV A;  1KC8 Q;  5CCH A;  2WU5 C;  4PJ0 E;  1ZME C;  1VQL P;  2QE7 H;  1WRG A;  5KJ7 D;  4NPF X;  3CXH I;  1J2J B;  1KF6 C;  2KI7 B;  1M1J C;  5CCG D;  2I1J A;  3O8Z A;  1PZQ A;  2J58 A;  1DD4 A;  1QVG O;  1LTB C;  3AE3 D;  3NFQ A;  2FY8 A;  4UB8 E;  3AE6 D;  1S2E A;  2K9J A;  1FC2 C;  1JY2 N;  1URQ B;  4ZKU A;  2K9J B;  2WSE J;  1NWQ A;  4HYT B;  1BCC E;  2OYH A;  2WSC H;  1JNM A;  1SQX D;  3B5N D;  4C7N B;  2GUV A;  3C9I A;  5BU8 B;  3H1L J;  2RN0 A;  4ASW A;  1X8Y A;  2LXC B;  1VQ9 P;  3AE8 C;  1P84 E;  3CX5 I;  3MUD A;  3S1K A;  2HR3 A;  1R5S A;  3L73 J;  1L0N D;  4XFJ A;  1L4A D;  3NMD A;  3V2Q A;  3S4R A;  1GDT A;  2MJZ A;  1RE4 C;  1Y47 A;  1JM0 A;  2WU5 D;  2JEE A;  1J1E B;  3A7O A;  1NTZ D;  2AXT H;  3CCJ P;  3P4S C;  3PJS K;  2OYI B;  1JCD A;  1QL1 A;  1KF6 D;  4LDT A;  5CCH C;  1H89 A;  2E5T A;  1SP4 A;  2ZAE B;  3CWB E;  1VQM P;  3RBZ A;  1X79 B;  4R4M A;  1GL2 D;  1RF0 A;  4RJT A;  1VQ8 P;  3D6Z A;  4DHJ A;  2QJY C;  3MGN A;  3WU2 E;  1S72 P;  1L0L D;  1SQX J;  1FZF A;  1ZOY D;  5DJT B;  3A0H H;  1IK7 A;  3GG2 A;  1RHZ B;  2HFE D;  1N73 B;  1EZV G;  4IFF A;  3P4R D;  3L70 D;  3HRN A;  2E74 D;  1L0N J;  4H44 B;  3L36 A;  1Q2N A;  1N2D C;  1JEK A;  2H43 A;  4BXL A;  2G8Y A;  4RO0 A;  3MUD C;  5APW A;  3VMX A;  4I6L A;  5AVX B;  2OTL P;  1RF1 A;  3I56 P;  1BDD A;  3H1K G;  1NTZ J;  3P8C D;  1RE3 A;  1OZH A;  1J1E C;  3AEF C;  3N4X A;  5H2F E;  2WT7 B;  5KLV D;  2OYI C;  2WP9 C;  3Q1M A;  1KFY C;  1KZU B;  1SQP K;  3W68 A;  2HLO A;  2HPC B;  1K04 A;  5CBN A;  1E7P C;  2I8D A;  1BCC G;  1SQV D;  5KAI H;  1SQV K;  3EFG A;  1L0L J;  3P4Q D;  1G1J A;  1OX3 A;  5BVZ A;  3CC4 P;  1RF0 C;  4M3L A;  4N6J A;  3P4P C;  1NEN C;  1AVO A;  3USS A;  3L70 J;  3AE1 C;  2BEQ D;  3IN6 A;  4YT0 C;  1D7M A;  1KYO H;  2WSC J;  2KZJ A;  2H88 D;  1SQQ K;  2D2C C;  1M1K Q;  4OGQ B;  2LKM A;  3N7N A;  1JO5 A;  2I1K A;  1X0T A;  1L2P A;  2J59 M;  2XDJ A;  1FZB A;  3CWB G;  2K88 A;  5KLV J;  1GU5 A;  1KQF B;  5TIS H;  3D6Y A;  3HE5 A;  1JY3 O;  4U3F G;  5KAF E;  1FOS E;  2OYO A;  4PD4 H;  1RE3 C;  3T97 A;  4ASV A;  2IX7 C;  3Q5P A;  1LTA C;  1SQV J;  2LR2 A;  3V5B A;  2NZ2 A;  3T97 B;  4DT0 A;  1ZR4 A;  3MTU E;  1NTM K;  5C3J D;  1JTH A;  2R5D A;  1UII A;  1JY3 N;  2IBZ G;  3BCC G;  1FU1 A;  2KSE A;  1IFI A;  3L72 E;  2SPZ A;  1JTH B;  1RQU A;  3VYI A;  2BCC G;  1JUN A;  3CCS P;  1IFN A;  2IYP A;  1LT1 A;  1BE3 D;  1N7S B;  1NU1 G;  2Q6Q A;  1KB9 I;  1VQK P;  3TDK A;  1SS1 A;  5B66 E;  4YSZ D;  1A02 F;  4YT0 D;  2W6A A;  1NO4 A;  1S4X A;  2E76 D;  1M8O B;  2WQY C;  1NH4 A;  2IDB A;  2C9L Y;  2N1T A;  4DDI A;  3TF5 A;  2D2C D;  3CCU P;  2IFN A;  2WIT A;  4OGQ C;  3VON A;  2N1T B;  1R8E A;  3KPE A;  4HH2 A;  3H1J G;  5DJU B;  4YXW H;  2Z5I A;  1BSH A;  3CC7 P;  1OW6 A;  4JQ0 D;  1BCC D;  2BS3 C;  1YQ4 D;  5AW0 B;  3AEC D;  1U7M A;  2WU2 D;  3L70 E;  3FXE A;  3L75 E;  1KYO D;  2GA1 A;  3TGU G;  1LTG C;  1NYH A;  1QLB C;  1FJK A;  3L35 A;  1SFC D;  1S3J A;  1X9V A;  2C0W A;  1FDO A;  4BWN A;  3PH0 A;  4NPE A;  1P84 D;  4YTN D;  1Q82 Q;  2HOD A;  3PHL A;  2WPR A;  3H1I E;  1BE3 J;  2HOD B;  2YO3 A;  1KIL A;  1NGM B;  4TLF A;  3AE9 C;  1J1D C;  3FX0 A;  3V6I A;  4MN4 C;  3CWB D;  2KNC B;  2E75 D;  4WY4 A;  1HJ0 A;  2WPV B;  2AXT E;  3CIR C;  3L37 A;  1JB0 J;  3OW2 O;  1LTJ B;  4JBZ A;  4ZMD A;  1EDL A;  2N1T C;  5APT A;  3RK2 B;  1BCC J;  4WY4 B;  1USE A;  4KT0 J;  4HJG H;  1AFO A;  1JY2 P;  3BCC D;  2OTJ P;  1QVF O;  1FZC B;  1KD1 Q;  5AW5 B;  2BCC D;  2C9N Y;  3L72 G;  1KFM A;  2KXP B;  3LW5 H;  3RBX A;  1VQO P;  3A0H E;  3M9B A;  2B87 A;  2Y0C A;  4B86 A;  2KS1 A;  2IZ1 A;  2YIU B;  2B87 B;  2FFD A;  5AVS B;  3LIE A;  2Q3I A;  3V2R A;  2KS1 B;  3SWF A;  3I5C A;  2FFD B;  4H0L B;  3B71 A;  1FDI A;  1KOR A;  4GT1 A;  4GOF A;  3CC2 P;  3V2N A;  3CWB J;  1KIL C;  1EC5 A;  1AJY A;  4DOJ A;  3AE4 C;  3VP8 A;  1EZV E;  3AEG C;  1XTG B;  5APX A;  1KQL A;  3TGU D;  2P58 A;  5AW1 B;  3AED D;  3CIR D;  5AVQ B;  2ACZ C;  1IFJ A;  2R32 A;  2ZT9 D;  3RK2 C;  4WY4 C;  3BCC J;  2FYN B;  3M0D A;  3SFD D;  2ZVN B;  2M5A A;  3VR8 D;  2XNX A;  3A3Y B;  2BCC J;  5KAI E;  3VRB C;  3H1K E;  3IF4 A;  2M5A B;  1JOC A;  1FZC C;  3CXH H;  2M0B A;  5B5E H;  3M06 A;  2JWD A;  4IFD K;  1LWU B;  1HJB A;  5KLI C;  5APQ A;  2B9B A;  3RK3 B;  1URQ A;  1K8A Q;  3H1I G;  2PAJ A;  4EI2 A;  4CPG A;  1E79 H;  2WDV D;  2QJK B;  1W2E A;  1YQ3 C;  4PV1 C;  2P2U A;  4H13 D;  2FBW C;  2YIU C;  2E5Y A;  4C7N A;  4OWF A;  2YXQ B;  1SQX K;  1CSB A;  3M9H A;  3VMZ A;  1KYO E;  1NTK G;  2J5U A;  2FFD C;  1HBW A;  4AQR D;  1ZP0 D;  2WSS H;  5GTH H;  1IJD B;  2XND H;  1KIL D;  1SQP G;  5CHX A;  3BAT A;  3G3Z A;  2B88 A;  2ZXX A;  2QM8 A;  3TGU J;  1Q7Y Q;  1KMI Z;  3B8E B;  3CX5 H;  1EDK A;  5AW4 B;  3VOP A;  3JC2 2;  1L0N K;  4K3A A;  1T3J A;  3E1I A;  5TIS E;  2H7H A;  1K9M Q;  1FJP A;  4PD4 E;  3L72 D;  3FXD A;  2YMY A;  4GOE A;  5AVW B;  1YBK A; 
#chains in the Genus database with same CATH homology
 4R4M A;  2E76 C;  4I7Z B;  3SFD C;  1ZOY C;  2FYN C;  1WMK A;  3AED D;  1PL5 A;  3CIR D;  4YTM D;  3Q2Y A;  2ACZ C;  3VR8 C;  3D6Z A;  2YMK A;  2ZT9 B;  3AEA C;  3GLM A;  3H25 A;  2JP3 A;  2E75 B;  2WDQ D;  3AE9 D;  3AE4 D;  2QJY C;  2ZT9 D;  1DD4 A;  2E75 D;  3P4P C;  3AE3 D;  2V7Q J;  3AEG D;  2QJP C;  4TT3 H;  2E76 B;  1L0V D;  1NEN C;  3AE6 D;  4YT0 D;  4YSZ D;  3SFD D;  2E76 D;  1HJ0 A;  2WPV B;  1ZOY D;  3CIR C;  2WQY C;  1KTM A;  4YTM C;  2ACZ D;  3VR8 D;  2IDB A;  1JB0 J;  1EXJ A;  1KQG B;  2QSI A;  3AE1 C;  5L8R J;  3AEE C;  3Q3D A;  1GMJ A;  3AEB C;  3P4R C;  2JO1 A;  1IK7 A;  2BEQ D;  3AE3 C;  3P4P D;  2D2C B;  2WSE J;  1S1C X;  2H88 C;  4YSY D;  3VRB C;  3IN6 A;  2D2C D;  1NEN D;  4YT0 C;  3GF3 A;  4KT0 J;  3D71 A;  2WDR D;  2E74 C;  2WSC J;  2WQY D;  3IAO A;  4OGQ C;  2P10 A;  1HF9 A;  1YQ4 C;  1R8E A;  3AEC C;  4Y28 J;  2WDV C;  3AE1 D;  4YTP C;  2BEZ F;  4RKU J;  2WU2 C;  3AEE D;  1EXI A;  3AEB D;  4PV1 B;  3P4R D;  2QJK C;  1Y9B A;  4U7J A;  5KLI C;  2FXP A;  2B76 D;  4PV1 D;  4YSY C;  2H88 D;  3VRB D;  2D2C C;  4H13 C;  2FBW D;  1OW6 A;  4KX6 D;  2E74 B;  3AE7 C;  3S9O A;  4OGQ B;  2WDR C;  1MKM A;  1UIX A;  2E74 D;  2K9Y A;  2BS3 C;  4OGQ D;  4H44 B;  2WSF J;  3Q5R A;  1TU3 F;  3AE2 D;  2QIW A;  1YQ4 D;  3G9R A;  5C2T D;  4H44 D;  2WDV D;  3AEC D;  1VF5 C;  2WU2 D;  1VL2 A;  4YTP D;  2G8Y A;  4R4L A;  1YQ3 C;  1NEK C;  2B76 C;  4H13 B;  4PV1 C;  2H89 C;  3AE8 C;  3AE5 C;  4YXD C;  4H13 D;  2FBW C;  1NYH A;  2YIU C;  4KX6 C;  2MKV A;  3AE7 D;  3RK3 E;  1QLB C;  1Q90 D;  4YTN C;  3AE2 C;  1KQF B;  3D6Y A;  1VF5 B;  1ZP0 C;  5C2T C;  4H44 C;  2OQQ A;  1VF5 D;  1OMI A;  3EWK A;  1DIP A;  1YQ3 D;  1NEK D;  5C3J C;  1OW8 A;  2J5U A;  2H89 D;  1FDO A;  3AE8 D;  3AE5 D;  4XFJ A;  4YXD D;  4YSX C;  3Q5P A;  5M1B A;  3VRA C;  2BS2 C;  4YTN D;  3AEF C;  1ZP0 D;  2NZ2 A;  3RL0 g;  3GMA A;  3T97 B;  1PIX A;  4Z1M H;  3O6Q A;  2WS3 C;  3VR9 D;  1PV3 A;  5C3J D;  4H0L B;  3B71 A;  1FDI A;  3Q1M A;  3D70 A;  3LW5 J;  3GF7 A;  1KOR A;  1KFY C;  2WP9 C;  3Q5S A;  4H0L D;  2WU5 D;  3ABV D;  4YSX D;  1S5L X;  4GDO A;  3P4Q C;  3VRA D;  1K05 A;  1U57 A;  3P4S C;  3AEF D;  1K04 A;  5KKZ C;  1KMI Z;  3SFE C;  3VR9 C;  1KF6 D;  1RQU A;  3FGA D;  1E7P C;  2WS3 D;  2BS4 C;  1KIL E;  1DD3 A;  1RQV A;  3AED C;  2WP9 D;  4I7Z C;  1KFY D;  1AJY A;  2WU5 C;  1ZME C;  4H0L C;  3ABV C;  1NGM B;  1OW7 A;  3P4Q D;  3AEA D;  2O01 J;  3AE4 C;  3AE9 C;  2WDQ C;  3R4Y A;  2ZT9 C;  3C8V A;  2E75 C;  3P4S D;  3AEG C;  4IL6 X;  2G3A A;  4YSZ C;  1L0V C;  3AE6 C;  3SFE D;  1KF6 C;  1ZRT E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...