3AEBC

Crystal structure of porcine heart mitochondrial complex ii bound with n-(3-phenoxy-phenyl)-2-trifluoromethyl-benzamide
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of porcine heart mitochondrial complex II bound with N-(3-Phenoxy-phenyl)-2-trifluoromethyl-benzamide
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
total genus 51
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3aebC01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3aebC02
3S9OA 3P4PC 2WS3C 4YTMD 2WDRC 3AEDD 3P4QD 3VRAD 2H89C 3AECC 1NENC 3AE4D 3SFEC 3AE5C 1NEND 1KF6C 3AE8D 3AE6D 1KF6D 4YT0D 2G3AA 3AE9C 1ZP0C 2BS4C 3AEED 1E7PC 2WU5C 3AE2D 1KFYC 2WP9D 3VR8C 4YSZD 4YTPC 2H88D 3AE8C 1YQ4D 2WDVC 4YTPD 1K04A 3AE4C 3AEAC 3AEFD 3P4RD 3AEGD 2WU2D 1ZOYC 3CIRD 3ABVD 5C3JC 2WU5D 3AEFC 1QLBC 3AEEC 3AE7D 4YSXC 3AE6C 2BS2C 3P4PD 3AEDC 2WDRD 2WDQC 3AEBC 2WS3D 2FBWD 2WDVD 3AEAD 3VR9C 2BS3C 3AE3C 3CIRC 5C2TD 1YQ3C 5C2TC 3AE2C 4KX6C 1K05A 3SFDD 2H88C 2WDQD 3SFDC 2H89D 2WP9C 2FBWC 3VR8D 4YXDD 3B71A 3AECD 4YXDC 1L0VC 2ACZC 4YT0C 3AE3D 3AE9D 3P4RC 1OW8A 2WQYC 3AE7C 1PV3A 1KFYD 1OW6A 4KX6D 4YSZC 3P4SC 2B76D 4YTMC 3P4SD 3P4QC 2B76C 4YTNC 1KTMA 1NEKC 3SFED 3VR9D 1NEKD 4YSYC 1OW7A 4YTND 4YSYD 3ABVC 2WQYD 3VRBD 3VRAC 3AE5D 3AEBD 2WU2C 3AEGC 1YQ3D 5C3JD 1L0VD 2ACZD 1ZOYD 1ZP0D 3AE1C 3VRBC 4YSXD 3AE1D 1YQ4C
chains in the Genus database with same CATH superfamily
2R5BA 2Q7CA 5DJUB 2WSCH 4GDOA 1P84I 2G8YA 2E74C 3VOPA 3GMAA 1NTZE 2OTJP 2DW3A 3KZIH 3VR8C 1KILC 3Q2YA 1K9MQ 2WDVC 2E76B 2SPZA 4L75A 2B9BA 3CX5H 2KIKA 3PTZA 2B87B 1NTMD 4C7NB 1GDTA 4H44D 1M1JA 4PD4D 2AEFA 1EQ7A 4GKGA 3L71J 2FYUJ 2WSEJ 1GL2B 1T8ZA 2C9LY 2FBWD 2AEJA 1ZLLA 1N2DC 1LTTC 2E5YA 1NU1D 3IF4A 4YPCA 1TFFA 3RK3B 3SFDD 3MGNA 2QVAA 4PJ0H 1FDMA 5AVVB 3VMZA 1PPJD 3N7NA 3IFMA 3L75J 5B5EE 1IFPA 4YSZC 2ITAA 1JUNA 3OJAB 2FXOA 1FZBA 5APVA 1L4AA 3C8VA 2RMZA 5AVZB 3L70J 1FZCB 4QMAA 3ZDMA 5C3JD 4GIFA 3PJSK 5C39A 1PP9E 3AE1D 2KS1A 4UB8H 4DHJA 4KHXA 2HG5D 1SFCB 4XA4A 4EI2A 1EZVD 4K35A 4N78E 1URQA 2WSSH 1FOSE 3V5BA 2A06D 3TK1A 1OXZA 2NZ2A 1URQD 1NTKG 3NXSA 5AW1B 2Y0DA 5AVYB 1J1EB 3FWLA 1RF0C 1HF9A 3RK3D 1SQVG 2E75B 3CCLP 4IL6X 2E76C 1BGYJ 2BEZF 3L37A 3TSIA 1LTJC 2IYOA 5CCGD 4H0LD 2KNCB 3F89A 1U57A 1OX3A 2NPSA 3CC2P 3CCJP 1Q86Q 1KZUB 1PGOA 1PP9J 1MFTA 2E74D 2WSFH 5AW8B 2GM4A 1OW6A 3L74G 4JYCA 2B76D 4YTMC 3R2PA 5AW2B 1S5LX 3G3ZA 3ABVC 2FKWB 3KPEA 1HVVA 3HTKB 2FXPA 4PV1D 1YTZI 2ZT9B 2ZT9C 1ZP0D 5KAIH 3A2AA 2KB7P 1N73B 3L75D 4N3YB 2Y0EA 2FFDA 5KJ7D 3PRJA 2Q9IA 4YT0D 5AVQB 3D71A 3VP8A 3AE9C 3LW5J 3Q1MA 2HPCA 2W27A 1RH5B 3H32A 2D2CB 4RESB 1KFYC 2WP9D 2OARA 1BSHA 2H88D 1LT9A 4EDFA 1NWQA 4Z1MH 1IFDA 1N7SB 1PL5A 2O1KA 3ABVD 3AE7D 3TGUE 4D6TJ 3AEBC 4KJMA 2Z4EA 2V4HA 5KLIB 1IFJA 3M91A 1W2BO 2RH0A 4GT1A 2E42A 5BU5A 2HODA 3CI9A 3KXDA 1M8OB 2H89D 3CLQA 2IBZE 4RKUJ 4DCKA 4WY4D 1DEBA 1NAYA 2QJKC 3AE7C 1OVVA 1VL2A 4IFDK 3KYQA 3LW5H 3GLMA 5CHXA 3IAOA 2K37A 3SFED 1OW7A 2YIUC 3SWFA 1PZQA 3RK3C 3H1KD 1RF1B 3JC22 5DJTB 2FYUG 3V2QA 4OH8B 1XTCC 3L73D 2QJPC 3V4WA 2H89C 3RGUA 1QL2A 3K5BA 1L0LE 2R32A 5AW0B 2QA4P 1Z56A 2M3BA 1Y8AA 2Y0CA 4OGQB 5GTHE 5KKZC 4JF7A 3NFQA 2CPSA 2N1TC 3P4RD 4C7RA 3H1JG 1L0LD 2ZAEB 2QRXA 2I1KA 2WTYA 2OGUA 1JOCA 3B8EB 1AVOA 4LLHA 2JEEA 1G2CA 2BS3C 1FJPA 1P84H 3ITKA 4TLFA 3H1KE 3CC7P 3OAKA 3SWKA 2KLUA 1VQPP 2KYVA 1LT9B 2KI7B 3RK3E 4RJTA 1T2KC 2R5DA 1YTZT 3H6PA 3AE9D 1VF5D 2WQYC 3CCVP 2WT7B 5E79E 2WSFJ 4N6JA 3CWBD 3LIDA 4WBAA 1Y47A 3O6QA 1EDKA 1DD4A 3HUSA 1SQXJ 2JDIH 2KP8A 2WSEH 2Y9ZA 5AVXB 3VONA 4YSYD 1LGHB 3AE5D 3G4SP 3WU2E 1S1CX 1ZXGA 2IZ0A 1SQQG 1S5LE 3FGAD 5APSA 3L72J 1PP9D 4ZKPA 1GU4A 5KLVG 3AE8D 2Q3EA 3S9OA 1T6AA 5KAIE 2FFDC 2FFDB 1NYHA 3TGUD 3AEED 2BS4C 1VQKP 3MD0A 1KQLA 4YTPC 2KLVA 2R3CA 2N9BA 3L71D 2KXPB 1N7SA 3BCCJ 1ZOYC 3PLNA 3V2NA 3AEEC 1YYCA 3MZWB 1PFIA 1NU1E 1AFOA 3P4PD 3AEAD 1Q90D 2W90A 2KS1B 5B5EH 1CSBA 1ZRTD 3AE2C 3A7OA 1M7LA 5AW3B 3CCUP 4PD4E 2YXRB 3FX0A 1NTME 1OVUA 2W83C 3B71A 3CX5D 3EFFK 4K3AA 3CCQP 1PGJA 5EFWB 1SQQD 4ZMDA 1JY2P 4O9BA 2PFXA 1JY3N 1SQXK 1X22A 1SQVJ 1IFNA 1YQ3D 2ACZD 4UB8E 2ZFYA 1S2EA 1EDJA 3L73G 3L74J 1SQPG 1RE3A 2K1AA 1X8YA 5KLVE 2A45H 2XKMA 5CBNA 2O1JA 2YKPA 4YTMD 2KNCA 2O3JA 5APWA 2NPSB 1L4AD 3W67A 1NTMK 2V7QJ 1Q2NA 3E1IA 1KF6D 1OWAA 5KAFE 1NTMG 3U59A 1NGMB 4OGQC 1YQ4D 4I6MC 3G71P 1YIJP 1M1KQ 1VQOP 2E74B 1IK7A 1CI6A 1PIXA 1NTKE 3CIRD 2WMMA 2IFNA 1JY3O 4ASWA 2QM8A 3WUTA 4H13C 3BVHA 2WDRD 1BDDA 2BEQD 2N1TB 2WDVD 3VR9C 1SFCA 1P84D 2KSEA 5AVRB 3CIRC 1NVOA 1RF1A 5BU8B 2OQQA 4JYBA 1VPCA 3CMEP 2FY8A 1NH4A 2BCCJ 1U7JA 1HJ0A 1YBKA 1FC2C 3QWOC 1OW8A 1PPJG 1SQQK 1KILE 3CC4P 1EXJA 1PV3A 3HD7C 4H0LB 3NTNA 2M5AA 3P7KA 4R4LA 2NPSD 3B5ND 1NKZB 2PRRA 2WPVB 1JMBA 3H1JJ 1TU3F 1FS0E 3H1KJ 2XZRA 3R4YA 5CMZA 1J1DC 1J1DB 1VDFA 1GTWA 3HD7D 2A06G 2J59M 2O01N 3GF7A 3VP9A 3BATA 2O01J 1NAFA 3AE5C 2IPPA 1BE3D 1BCCD 3OA7A 3CX5I 3MTUE 2D2CD 3HE5B 2FYZA 1H0TB 3AEFD 4IL6E 1ZV8A 1NTZD 3HUSC 1CW5A 1ZW0A 4D6TD 1QVFO 1LT9C 1VQ5P 1KB9D 2POHA 1LNQA 2B87A 4H13B 3BCCG 1JMMA 3P8CD 4CPGA 4IL6H 1KYOH 1XTGB 2O01H 1YQ3C 4GOFA 1YJNP 3WMM0 2YMKA 3BCCE 1NOHA 2K9JB 1SQPD 3H1IG 2H7HA 3VR8D 1X9VA 2XNXA 2R44A 3GHGB 2YO3A 4OVNF 4DHIB 2WSCJ 5APQA 5KAFH 2KK7A 1KFNA 4I6LA 2N1TD 3P4RC 1QL1A 4GOEA 1AQ5A 2P2UA 3VMYA 1JNMA 3MP7B 3G6EP 4U3FD 2XV5A 1FDIA 3VR9D 2NRGA 3L70D 1BGYG 2QJPB 2KZJA 1LTSC 3CWBJ 3P4PC 2JO1A 1SQPJ 2YXQB 1QEXA 2RKLA 3II6A 1G1JA 3JSVC 3I56P 4HH2A 1VQLP 2G3AA 2YNYA 1CZQA 2XDJA 1KYOI 1RE4A 2M5AB 1S9KD 2Q6QA 3HRNA 4LDTA 2E5TA 4UB6H 3AEAC 4WVZA 3WUVA 3H1LG 3Q5PA 5M1BA 2LXCB 1SFCC 3HE4A 2JR8A 5AW7B 3Q3DA 1FZEA 1BSNA 2IBZG 2WPQA 1FE6A 2IBZI 2YKOA 3VN0A 5CCHA 2OTKE 1NU1G 4XE5B 1SQBD 4WWIA 1DEEG 1OFCX 5CCHD 4LC1A 3D70A 2H43A 4WY4A 3A0BH 3I55P 1AVYA 3RBXA 5L8RJ 1VF5C 2E76D 1FBMA 1S9KE 2B88A 3P4SD 1VQ9P 3M0DC 5CCHC 1RQUA 1KTMA 1RE3C 4YSYC 4HJGH 1H89A 1M57D 3H1JD 2OYHB 3VRBD 2QSIA 1GMJA 4DDGA 1SQXE 1A02J 4BXLA 1YQ4C 1KFMA 1KYOE 2BCCD 3FXDA 3V4QA 4HB1A 4AYCA 3AE4D 2Y9YA 1QX8A 3H1HG 1JCDA 4PD4H 4WY4B 3GHGC 2MKVA 3EWKA 2PGDA 2FYUK 2QJYB 3KDPB 3VTPC 2Q5UA 3VMAA 3H25A 1AV1A 1VQ6P 3TYYA 2WVRA 3C9IA 3AEFC 2FYUD 1QLBC 2Z5HA 1SQVK 3L35A 4NPDA 2WPRA 1L4AB 3BCCD 1KILA 3VMXA 3CCMP 4W7ZA 2AXCA 2P58A 1MUUA 1K73Q 1IFMA 1FOSF 1EDIA 4C46A 1L0NE 4OWFA 1EZVI 2XNDH 1N7SD 5C2TD 3P8CE 4B86A 1K05A 3IN6A 2HODB 2H88C 1HBWA 1G1IA 2WDQD 3PP5A 2WP9C 1KB9E 3CCRP 2ZXEB 1IFIA 4YXDD 3GHGA 2K3RA 1KMIZ 4YT0C 1GK4A 1DD3A 1OZHA 1SQVD 3L74D 2B76C 4DDIA 1BE3E 2Q1KA 1E5WA 2BCCG 3M0AA 1M1JB 1SP4A 3KHUA 1NU1K 2ZT9D 2WITA 1ZOYD 1U7MA 1L0NK 5GTHH 2YIUB 1SS1A 1L0NG 3TDKA 2I1JA 3L75G 3M0DA 3AEDD 1HH0A 2GA1A 3KZIE 1FZFA 2OYOA 2WT7A 2GUVA 2WU5C 3H1HJ 1SQBJ 2QG4A 4DJGA 3S4RA 4YSZD 2K9JA 3AE8C 2C9NY 1JEKA 1YI2P 1K04A 4NPFX 2KSJA 3T97B 3AEGD 1BGYD 3GG2A 5GTIH 1JB0J 3A3YB 3W68A 2QIWA 3AE6C 4H44B 3H1LJ 3TF5A 1FDOA 1N7LA 3EQ2A 1T2KD 2WPSA 4JPZB 3AE3C 5B66H 3CCSP 2ZYGA 2YMYA 4PV1C 2D2CC 3TGUJ 1S3JA 4BWNA 3I5CA 3L70E 3E7KA 1RHZB 4HKZH 5AW4B 4U3FE 1NTKD 4W80A 2ACZC 1RE4C 3CD6P 2C0WA 2L5GB 3RL0g 2I8DA 2NPSC 2PP6A 1SVFA 3L72D 3P4QC 2P7JA 1RY3A 2KOGA 4YTND 3H1HE 1AQTA 3D6ZA 1W2EA 3A0BE 1KQGB 1USEA 2K88A 2IX7C 2WS3C 1LP1B 3H32B 1NENC 3B5NB 2OYHC 1IC2A 2E75C 1H8AA 2MJZA 3CMAP 3H1LE 4DZOA 1SQQE 2JKVA 1URQC 1QVGO 5B66E 5AW5B 3CX5E 3H1IJ 1LTGC 4L74A 1L0LJ 1N8RQ 1Q81Q 4LGDE 4AQRD 1JY2O 2C0XA 2CPBA 3CPWO 2WS3D 2J58A 2OYHA 3SWYA 1LTAC 2P67A 1GU5A 1EXIA 1OMIA 1UIIA 5CCGA 1MV8A 4U3FG 4R4MA 1L0VC 1N73C 3L71E 3LIEA 1DIPA 4D6TG 4HYTB 2A45I 1NEKD 5KTBA 2WQYD 3HE4B 4I7ZC 3AEGC 4YXWH 1KC8Q 1YJWP 3L36A 5KJ7A 3WUUA 1P84E 1SLQA 1NTKJ 2IZ1A 3H1IE 3BRVB 1FAVA 3N4XA 2A45G 3H1KG 2JP3A 1FU1A 2IYPA 1R8EA 3CXHD 5E79H 2GUSA 2IDBA 4PV1B 1E79H 1NHLA 4NPEA 4OGQD 1YJ9P 3L72E 3AE2D 1S4XA 4YTPD 3CL3D 1KB9I 2HLOA 2JWDA 4IFFA 1CI6B 2WU2D 1R5LA 3P8MC 2WU5D 3CXHE 1GL2A 5CJ4A 1X0TA 1GW3A 3EFGA 4Y99C 4DT0A 4ZKUA 2OYIB 1OIPA 1H88A 2BASA 1LTIC 1GL2D 3H1ID 5KLVD 2W6AA 4PD4I 3SSUA 2RN0A 3QH9A 5CCGC 1Q7YQ 1ZN5A 1SQXG 4FJVA 5BVZA 3P32A 3FXEA 4Y28J 1L0LK 3O6QB 1NO4A 2FYNB 2W6JH 3L71G 3VYIA 1VF5B 4GODA 1K8AQ 4KX6D 1JM0A 2LXBA 3P4SC 1DX7A 3MHVA 2YO2A 1JTHB 3Q5SA 4H13D 1W5CE 4C7NA 4BRYA 1ZRTE 4L76A 4AUWA 3AE1C 5APYA 1RQVA 4YSXD 3L73E 1FJKA 2L91A 3MUDA 3KQGA 5AW6B 3P4QD 2P1JA 4M3LA 2ZYDA 3U1CA 3USSA 1ZR4A 1KF6C 1JO5A 1EZVG 2LKMA 2J5UA 3M06A 1GK6A 3Q5RA 1PP9G 4ASVA 2KUBA 1PGPA 1SQVE 3CWBG 2B89A 3HD7B 5APTA 3AE4C 1WRGA 1LT1A 3H1LD 2IBZD 5C3JC 5KLIC 4IFMA 1WMKA 4YSXC 1HWTC 1SQBG 2HFED 4DHZA 2W8ZA 3JCUH 1LWUB 2BS2C 1KB9H 2WDQC 1KILB 1M1JC 1HTLC 3UIAA 1S72P 1N7SC 5C2TC 4KX6C 3H1HD 4DOJA 2KZIA 3SFDC 2FBWC 5CBOA 1A02F 4U7JA 4WB4A 4ZNCA 3L73J 3B5NA 4Y99B 2OYIC 1J2JB 3CWBE 5K5GB 1VQ4P 1D7MA 1QGKB 1DH3A 2QJYC 5H2FH 1HGZA 3HE5A 3WU2H 1KN7A 2M3EA 2WU2C 4WY4C 3IR9A 2BCCE 3L75E 4PJ0E 1SQXD 3RL0C 2UWJE 2P10A 4EIJA 1FZGA 4JQ0D 3PH0A 1QLED 5AVTB 3H1JE 1HUCA 1NU1J 1S5LH 3NMDA 1E7PC 3V2PA 1BGYE 2WZ7A 2AEMA 1LJ2A 5GTIE 4MN4C 1Y9BA 3M9QA 1NJIQ 5AVUB 1NTZG 2LR2A 3FWNA 1NTMJ 2OYIA 1SQBE 5TISH 3G9RA 2ZVNB 1N86A 3A0HE 1IJDB 2ZYAA 3TNUB 1VQMP 2N1TA 2YKQA 2HPCB 3AECD 1GZLA 1T3UA 1T3JA 2K9YA 3L74E 2QE7H 2PAJA 5CJ0A 3BRTB 3F5HA 1HJBA 2A06E 1AA0A 1LWUA 1JTHA 1ZR2A 2IFMA 1IK9A 3MIWA 4N78D 4U3FJ 1R5SA 1EZVE 1AJYA 1SQBK 1NTZK 1MFZA 3AEBD 1N73A 1LTJA 3CXHH 5KLVK 1BE3G 1L0ND 4IOIH 3VRAD 2HR3A 4JBZA 3TNUA 3AECC 4H0LC 3MUDC 2E75D 3L4FA 3SFEC 1NEND 1KQSO 2XU6A 2FYUE 3GF3A 2WWWA 1WT6A 2OTLP 1URQB 2R3SA 1VQNP 1PPJE 1YITP 2CK3H 1KQFB 1MKMA 1SFCD 4EYYQ 3RK2D 5KKZB 2QEXP 2W6BA 4TT3H 5AW9B 1IO4A 1KYOD 1L4AC 3M9BA 3V6IA 4BRYB 4W7YA 1BE3J 1LP1A 5APUA 1KD1Q 1JY2N 3GW6A 1BCCG 3RK2B 2ZXXA 5H2FE 3B4SA 3A0HH 3B5NC 1ZMEC 1OVRA 4D6TE 3C1LA 1GW4A 3HUSB 1NKNA 4I7ZB 3AE3D 1IZNB 4XFJA 3RK2C 3TGUG 5TISE 1KFYD 3S1KA 3L72G 1J1EC 2VRSA 4I2LC 3RBZA 3HD7A 1BCCE 1NEKC 5TJHA 3VRAC 2Q3IA 3VRBC 2JJLA 1YHQP 2QJKB 2ZJSE 1LTJB 5AVSB 1EC5A 2AXTE 1LWUC 2WDRC 1RF1C 3CCEP 2M8RA 1G2CB 2ZFCA 3V2RA 3AE6D 1ZP0C 1JCCA 5KJ7C 1MZ9A 1KILD 1NTKK 2V7QH 1H0TA 1PGQA 1HGVA 3BASA 4RO0A 3T97A 3HTKA 5KLVJ 1KORA 1VQ8P 1Q82Q 5APXA 1NTZJ 4H44C 2ZVOB 1M90Q 3A5TA 2FXMA 1L2PA 4EOTA 3AEDC 1BDCA 2E43A 1KV4A 1LTBC 4L73A 5AVWB 1FZCA 1L0LG 1BCCJ 3D6YA 1RF0A 2HYNA 2JWAA 4I1LA 4UB6E 1FZAA 1VQ7P 1L0NJ 3RL0B 4YXDC 1EDLA 3CXHI 2QM7A 2Z5IA 1USDA 2N9YB 3JCUE 2FYNC 1X79B 3E1RA 4YTNC 2AXTH 1GD2E 3O8ZA 1FZCC 1SQPE 3L70G 1SQQJ 3OW2O 3M9HA 1L0VD 4KT0J 1M56D 2M0BA 3RL0D 4A7PA 1UIXA 3PHLA 2H8PD 1SQPK 1GL2C 3U1AA 1JY3P
chains in the Genus database with same CATH topology
3GF7A 3S9OA 3P4PC 2JO1A 2WS3C 4YTMD 2QJPC 2WDRC 3AEDD 3P4QD 3VRAD 2O01J 2H89C 3AECC 1NYHA 4H0LC 2JP3A 4GDOA 2E75D 1NENC 3AE4D 3SFEC 3AE5C 1R8EA 2V7QJ 2G8YA 2E75C 1KF6C 1NEND 2E74C 3AE8D 3AE6D 2J5UA 1KF6D 4YT0D 3GF3A 2G3AA 3AE9C 1ZP0C 3D71A 2IDBA 4PV1B 3Q5RA 3LW5J 1E7PC 3GMAA 2BS4C 2WU5C 3Q1MA 4OGQD 4OGQB 2D2CD 1NGMB 2MKVA 4OGQC 3AE2D 1KFYC 2D2CB 3EWKA 2WP9D 3VR8C 2NZ2A 4YTPC 4YSZD 3Q2YA 2H88D 3AE8C 1YQ4D 2WDVC 2E76B 5KKZC 4YTPD 3AEED 2E74B 1K04A 3AE4C 3H25A 3AEAC 4Z1MH 3AEFD 1IK7A 1KQFB 3P4RD 3T97B 1Y9BA 3AEGD 2WU2D 1MKMA 1PIXA 3Q5PA 1PL5A 1ZOYC 1HF9A 3ABVD 1KORA 3CIRD 5C3JC 5M1BA 3AEFC 5KLIC 2WU5D 1QLBC 1JB0J 3AEEC 2E75B 4H13B 1WMKA 3AE7D 4IL6X 4H44D 2E76C 2QIWA 4YSXC 3AE6C 4H44B 4H44C 2BEZF 4H13C 4TT3H 3Q3DA 1FDOA 2BS2C 3P4PD 2WSEJ 3AEDC 3G9RA 2WDRD 2WDQC 3AEBC 2WS3D 2FBWD 2BEQD 2WDVD 3AEAD 3VR9C 1Q90D 2BS3C 3AE3C 4H0LD 3CIRC 5C2TD 1YQ3C 4PV1C 3D6YA 1EXIA 5C2TC 1OMIA 2OQQA 2D2CC 3AE2C 1U57A 4KX6C 1K05A 3IN6A 2YMKA 3SFDD 2H88C 3D70A 2WDQD 3SFDC 2H89D 2WP9C 2FBWC 3VR8D 4RKUJ 3RK3E 1HJ0A 4Y28J 3B71A 1ZMEC 4U7JA 4YXDD 4R4MA 3AECD 4YXDC 1L0VC 2ACZC 2K9YA 2WSCJ 1KMIZ 4I7ZB 4YT0C 3AE3D 5L8RJ 3AE9D 4XFJA 1VF5D 1OW8A 2QJKC 2WQYC 3RL0g 3P4RC 1VF5B 1DD3A 3AE7C 1VF5C 1KILE 2E74D 2E76D 2WSFJ 1EXJA 1VL2A 1PV3A 1DIPA 1KFYD 2FYNC 1OW6A 3O6QA 4H0LB 4KX6D 2QJYC 4YSZC 1DD4A 3P4SC 2B76D 4YTMC 3P4SD 3P4QC 3GLMA 2B76C 4R4LA 4YTNC 3Q5SA 1RQUA 1S5LX 1KTMA 4H13D 1NEKC 2WPVB 3IAOA 3SFED 1FDIA 1NEKD 3VR9D 1OW7A 2YIUC 1AJYA 4YSYC 4YTND 4YSYD 1TU3F 3ABVC 2WQYD 3C8VA 3VRBD 3AE5D 4I7ZC 3AEBD 3VRAC 2QSIA 3R4YA 2WU2C 2ZT9D 3AEGC 2FXPA 1GMJA 4PV1D 1ZRTE 2ZT9B 1YQ3D 5C3JD 1S1CX 2ZT9C 4KT0J 1L0VD 1ZOYD 2ACZD 1ZP0D 3AE1C 3D6ZA 3VRBC 3FGAD 1RQVA 4YSXD 1UIXA 1KQGB 3AE1D 2P10A 1YQ4C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S9O A;  3P4P C;  2WS3 C;  4YTM D;  2WDR C;  3AED D;  3P4Q D;  3VRA D;  2H89 C;  3AEC C;  1NEN C;  3AE4 D;  3SFE C;  3AE5 C;  1NEN D;  1KF6 C;  3AE8 D;  3AE6 D;  1KF6 D;  4YT0 D;  2G3A A;  3AE9 C;  1ZP0 C;  2BS4 C;  3AEE D;  1E7P C;  2WU5 C;  3AE2 D;  1KFY C;  2WP9 D;  3VR8 C;  4YSZ D;  4YTP C;  2H88 D;  3AE8 C;  1YQ4 D;  2WDV C;  4YTP D;  1K04 A;  3AE4 C;  3AEA C;  3AEF D;  3P4R D;  3AEG D;  2WU2 D;  1ZOY C;  3CIR D;  3ABV D;  5C3J C;  2WU5 D;  3AEF C;  1QLB C;  3AEE C;  3AE7 D;  4YSX C;  3AE6 C;  2BS2 C;  3P4P D;  3AED C;  2WDR D;  2WDQ C;  3AEB C;  2WS3 D;  2FBW D;  2WDV D;  3AEA D;  3VR9 C;  2BS3 C;  3AE3 C;  3CIR C;  5C2T D;  1YQ3 C;  5C2T C;  3AE2 C;  4KX6 C;  1K05 A;  3SFD D;  2H88 C;  2WDQ D;  3SFD C;  2H89 D;  2WP9 C;  2FBW C;  3VR8 D;  4YXD D;  3B71 A;  3AEC D;  4YXD C;  1L0V C;  2ACZ C;  4YT0 C;  3AE3 D;  3AE9 D;  3P4R C;  1OW8 A;  2WQY C;  3AE7 C;  1PV3 A;  1KFY D;  1OW6 A;  4KX6 D;  4YSZ C;  3P4S C;  2B76 D;  4YTM C;  3P4S D;  3P4Q C;  2B76 C;  4YTN C;  1KTM A;  1NEK C;  3SFE D;  3VR9 D;  1NEK D;  4YSY C;  1OW7 A;  4YTN D;  4YSY D;  3ABV C;  2WQY D;  3VRB D;  3VRA C;  3AE5 D;  3AEB D;  2WU2 C;  3AEG C;  1YQ3 D;  5C3J D;  1L0V D;  2ACZ D;  1ZOY D;  1ZP0 D;  3AE1 C;  3VRB C;  4YSX D;  3AE1 D;  1YQ4 C; 
#chains in the Genus database with same CATH topology
 2R5B A;  2Q7C A;  5DJU B;  2WSC H;  4GDO A;  1P84 I;  2G8Y A;  2E74 C;  3VOP A;  3GMA A;  1NTZ E;  2OTJ P;  2DW3 A;  3KZI H;  3VR8 C;  1KIL C;  3Q2Y A;  1K9M Q;  2WDV C;  2E76 B;  2SPZ A;  4L75 A;  2B9B A;  3CX5 H;  2KIK A;  3PTZ A;  2B87 B;  1NTM D;  4C7N B;  1GDT A;  4H44 D;  1M1J A;  4PD4 D;  2AEF A;  1EQ7 A;  4GKG A;  3L71 J;  2FYU J;  2WSE J;  1GL2 B;  1T8Z A;  2C9L Y;  2FBW D;  2AEJ A;  1ZLL A;  1N2D C;  1LTT C;  2E5Y A;  1NU1 D;  3IF4 A;  4YPC A;  1TFF A;  3RK3 B;  3SFD D;  3MGN A;  2QVA A;  4PJ0 H;  1FDM A;  5AVV B;  3VMZ A;  1PPJ D;  3N7N A;  3IFM A;  3L75 J;  5B5E E;  1IFP A;  4YSZ C;  2ITA A;  1JUN A;  3OJA B;  2FXO A;  1FZB A;  5APV A;  1L4A A;  3C8V A;  2RMZ A;  5AVZ B;  3L70 J;  1FZC B;  4QMA A;  3ZDM A;  5C3J D;  4GIF A;  3PJS K;  5C39 A;  1PP9 E;  3AE1 D;  2KS1 A;  4UB8 H;  4DHJ A;  4KHX A;  2HG5 D;  1SFC B;  4XA4 A;  4EI2 A;  1EZV D;  4K35 A;  4N78 E;  1URQ A;  2WSS H;  1FOS E;  3V5B A;  2A06 D;  3TK1 A;  1OXZ A;  2NZ2 A;  1URQ D;  1NTK G;  3NXS A;  5AW1 B;  2Y0D A;  5AVY B;  1J1E B;  3FWL A;  1RF0 C;  1HF9 A;  3RK3 D;  1SQV G;  2E75 B;  3CCL P;  4IL6 X;  2E76 C;  1BGY J;  2BEZ F;  3L37 A;  3TSI A;  1LTJ C;  2IYO A;  5CCG D;  4H0L D;  2KNC B;  3F89 A;  1U57 A;  1OX3 A;  2NPS A;  3CC2 P;  3CCJ P;  1Q86 Q;  1KZU B;  1PGO A;  1PP9 J;  1MFT A;  2E74 D;  2WSF H;  5AW8 B;  2GM4 A;  1OW6 A;  3L74 G;  4JYC A;  2B76 D;  4YTM C;  3R2P A;  5AW2 B;  1S5L X;  3G3Z A;  3ABV C;  2FKW B;  3KPE A;  1HVV A;  3HTK B;  2FXP A;  4PV1 D;  1YTZ I;  2ZT9 B;  2ZT9 C;  1ZP0 D;  5KAI H;  3A2A A;  2KB7 P;  1N73 B;  3L75 D;  4N3Y B;  2Y0E A;  2FFD A;  5KJ7 D;  3PRJ A;  2Q9I A;  4YT0 D;  5AVQ B;  3D71 A;  3VP8 A;  3AE9 C;  3LW5 J;  3Q1M A;  2HPC A;  2W27 A;  1RH5 B;  3H32 A;  2D2C B;  4RES B;  1KFY C;  2WP9 D;  2OAR A;  1BSH A;  2H88 D;  1LT9 A;  4EDF A;  1NWQ A;  4Z1M H;  1IFD A;  1N7S B;  1PL5 A;  2O1K A;  3ABV D;  3AE7 D;  3TGU E;  4D6T J;  3AEB C;  4KJM A;  2Z4E A;  2V4H A;  5KLI B;  1IFJ A;  3M91 A;  1W2B O;  2RH0 A;  4GT1 A;  2E42 A;  5BU5 A;  2HOD A;  3CI9 A;  3KXD A;  1M8O B;  2H89 D;  3CLQ A;  2IBZ E;  4RKU J;  4DCK A;  4WY4 D;  1DEB A;  1NAY A;  2QJK C;  3AE7 C;  1OVV A;  1VL2 A;  4IFD K;  3KYQ A;  3LW5 H;  3GLM A;  5CHX A;  3IAO A;  2K37 A;  3SFE D;  1OW7 A;  2YIU C;  3SWF A;  1PZQ A;  3RK3 C;  3H1K D;  1RF1 B;  3JC2 2;  5DJT B;  2FYU G;  3V2Q A;  4OH8 B;  1XTC C;  3L73 D;  2QJP C;  3V4W A;  2H89 C;  3RGU A;  1QL2 A;  3K5B A;  1L0L E;  2R32 A;  5AW0 B;  2QA4 P;  1Z56 A;  2M3B A;  1Y8A A;  2Y0C A;  4OGQ B;  5GTH E;  5KKZ C;  4JF7 A;  3NFQ A;  2CPS A;  2N1T C;  3P4R D;  4C7R A;  3H1J G;  1L0L D;  2ZAE B;  2QRX A;  2I1K A;  2WTY A;  2OGU A;  1JOC A;  3B8E B;  1AVO A;  4LLH A;  2JEE A;  1G2C A;  2BS3 C;  1FJP A;  1P84 H;  3ITK A;  4TLF A;  3H1K E;  3CC7 P;  3OAK A;  3SWK A;  2KLU A;  1VQP P;  2KYV A;  1LT9 B;  2KI7 B;  3RK3 E;  4RJT A;  1T2K C;  2R5D A;  1YTZ T;  3H6P A;  3AE9 D;  1VF5 D;  2WQY C;  3CCV P;  2WT7 B;  5E79 E;  2WSF J;  4N6J A;  3CWB D;  3LID A;  4WBA A;  1Y47 A;  3O6Q A;  1EDK A;  1DD4 A;  3HUS A;  1SQX J;  2JDI H;  2KP8 A;  2WSE H;  2Y9Z A;  5AVX B;  3VON A;  4YSY D;  1LGH B;  3AE5 D;  3G4S P;  3WU2 E;  1S1C X;  1ZXG A;  2IZ0 A;  1SQQ G;  1S5L E;  3FGA D;  5APS A;  3L72 J;  1PP9 D;  4ZKP A;  1GU4 A;  5KLV G;  3AE8 D;  2Q3E A;  3S9O A;  1T6A A;  5KAI E;  2FFD C;  2FFD B;  1NYH A;  3TGU D;  3AEE D;  2BS4 C;  1VQK P;  3MD0 A;  1KQL A;  4YTP C;  2KLV A;  2R3C A;  2N9B A;  3L71 D;  2KXP B;  1N7S A;  3BCC J;  1ZOY C;  3PLN A;  3V2N A;  3AEE C;  1YYC A;  3MZW B;  1PFI A;  1NU1 E;  1AFO A;  3P4P D;  3AEA D;  1Q90 D;  2W90 A;  2KS1 B;  5B5E H;  1CSB A;  1ZRT D;  3AE2 C;  3A7O A;  1M7L A;  5AW3 B;  3CCU P;  4PD4 E;  2YXR B;  3FX0 A;  1NTM E;  1OVU A;  2W83 C;  3B71 A;  3CX5 D;  3EFF K;  4K3A A;  3CCQ P;  1PGJ A;  5EFW B;  1SQQ D;  4ZMD A;  1JY2 P;  4O9B A;  2PFX A;  1JY3 N;  1SQX K;  1X22 A;  1SQV J;  1IFN A;  1YQ3 D;  2ACZ D;  4UB8 E;  2ZFY A;  1S2E A;  1EDJ A;  3L73 G;  3L74 J;  1SQP G;  1RE3 A;  2K1A A;  1X8Y A;  5KLV E;  2A45 H;  2XKM A;  5CBN A;  2O1J A;  2YKP A;  4YTM D;  2KNC A;  2O3J A;  5APW A;  2NPS B;  1L4A D;  3W67 A;  1NTM K;  2V7Q J;  1Q2N A;  3E1I A;  1KF6 D;  1OWA A;  5KAF E;  1NTM G;  3U59 A;  1NGM B;  4OGQ C;  1YQ4 D;  4I6M C;  3G71 P;  1YIJ P;  1M1K Q;  1VQO P;  2E74 B;  1IK7 A;  1CI6 A;  1PIX A;  1NTK E;  3CIR D;  2WMM A;  2IFN A;  1JY3 O;  4ASW A;  2QM8 A;  3WUT A;  4H13 C;  3BVH A;  2WDR D;  1BDD A;  2BEQ D;  2N1T B;  2WDV D;  3VR9 C;  1SFC A;  1P84 D;  2KSE A;  5AVR B;  3CIR C;  1NVO A;  1RF1 A;  5BU8 B;  2OQQ A;  4JYB A;  1VPC A;  3CME P;  2FY8 A;  1NH4 A;  2BCC J;  1U7J A;  1HJ0 A;  1YBK A;  1FC2 C;  3QWO C;  1OW8 A;  1PPJ G;  1SQQ K;  1KIL E;  3CC4 P;  1EXJ A;  1PV3 A;  3HD7 C;  4H0L B;  3NTN A;  2M5A A;  3P7K A;  4R4L A;  2NPS D;  3B5N D;  1NKZ B;  2PRR A;  2WPV B;  1JMB A;  3H1J J;  1TU3 F;  1FS0 E;  3H1K J;  2XZR A;  3R4Y A;  5CMZ A;  1J1D C;  1J1D B;  1VDF A;  1GTW A;  3HD7 D;  2A06 G;  2J59 M;  2O01 N;  3GF7 A;  3VP9 A;  3BAT A;  2O01 J;  1NAF A;  3AE5 C;  2IPP A;  1BE3 D;  1BCC D;  3OA7 A;  3CX5 I;  3MTU E;  2D2C D;  3HE5 B;  2FYZ A;  1H0T B;  3AEF D;  4IL6 E;  1ZV8 A;  1NTZ D;  3HUS C;  1CW5 A;  1ZW0 A;  4D6T D;  1QVF O;  1LT9 C;  1VQ5 P;  1KB9 D;  2POH A;  1LNQ A;  2B87 A;  4H13 B;  3BCC G;  1JMM A;  3P8C D;  4CPG A;  4IL6 H;  1KYO H;  1XTG B;  2O01 H;  1YQ3 C;  4GOF A;  1YJN P;  3WMM 0;  2YMK A;  3BCC E;  1NOH A;  2K9J B;  1SQP D;  3H1I G;  2H7H A;  3VR8 D;  1X9V A;  2XNX A;  2R44 A;  3GHG B;  2YO3 A;  4OVN F;  4DHI B;  2WSC J;  5APQ A;  5KAF H;  2KK7 A;  1KFN A;  4I6L A;  2N1T D;  3P4R C;  1QL1 A;  4GOE A;  1AQ5 A;  2P2U A;  3VMY A;  1JNM A;  3MP7 B;  3G6E P;  4U3F D;  2XV5 A;  1FDI A;  3VR9 D;  2NRG A;  3L70 D;  1BGY G;  2QJP B;  2KZJ A;  1LTS C;  3CWB J;  3P4P C;  2JO1 A;  1SQP J;  2YXQ B;  1QEX A;  2RKL A;  3II6 A;  1G1J A;  3JSV C;  3I56 P;  4HH2 A;  1VQL P;  2G3A A;  2YNY A;  1CZQ A;  2XDJ A;  1KYO I;  1RE4 A;  2M5A B;  1S9K D;  2Q6Q A;  3HRN A;  4LDT A;  2E5T A;  4UB6 H;  3AEA C;  4WVZ A;  3WUV A;  3H1L G;  3Q5P A;  5M1B A;  2LXC B;  1SFC C;  3HE4 A;  2JR8 A;  5AW7 B;  3Q3D A;  1FZE A;  1BSN A;  2IBZ G;  2WPQ A;  1FE6 A;  2IBZ I;  2YKO A;  3VN0 A;  5CCH A;  2OTK E;  1NU1 G;  4XE5 B;  1SQB D;  4WWI A;  1DEE G;  1OFC X;  5CCH D;  4LC1 A;  3D70 A;  2H43 A;  4WY4 A;  3A0B H;  3I55 P;  1AVY A;  3RBX A;  5L8R J;  1VF5 C;  2E76 D;  1FBM A;  1S9K E;  2B88 A;  3P4S D;  1VQ9 P;  3M0D C;  5CCH C;  1RQU A;  1KTM A;  1RE3 C;  4YSY C;  4HJG H;  1H89 A;  1M57 D;  3H1J D;  2OYH B;  3VRB D;  2QSI A;  1GMJ A;  4DDG A;  1SQX E;  1A02 J;  4BXL A;  1YQ4 C;  1KFM A;  1KYO E;  2BCC D;  3FXD A;  3V4Q A;  4HB1 A;  4AYC A;  3AE4 D;  2Y9Y A;  1QX8 A;  3H1H G;  1JCD A;  4PD4 H;  4WY4 B;  3GHG C;  2MKV A;  3EWK A;  2PGD A;  2FYU K;  2QJY B;  3KDP B;  3VTP C;  2Q5U A;  3VMA A;  3H25 A;  1AV1 A;  1VQ6 P;  3TYY A;  2WVR A;  3C9I A;  3AEF C;  2FYU D;  1QLB C;  2Z5H A;  1SQV K;  3L35 A;  4NPD A;  2WPR A;  1L4A B;  3BCC D;  1KIL A;  3VMX A;  3CCM P;  4W7Z A;  2AXC A;  2P58 A;  1MUU A;  1K73 Q;  1IFM A;  1FOS F;  1EDI A;  4C46 A;  1L0N E;  4OWF A;  1EZV I;  2XND H;  1N7S D;  5C2T D;  3P8C E;  4B86 A;  1K05 A;  3IN6 A;  2HOD B;  2H88 C;  1HBW A;  1G1I A;  2WDQ D;  3PP5 A;  2WP9 C;  1KB9 E;  3CCR P;  2ZXE B;  1IFI A;  4YXD D;  3GHG A;  2K3R A;  1KMI Z;  4YT0 C;  1GK4 A;  1DD3 A;  1OZH A;  1SQV D;  3L74 D;  2B76 C;  4DDI A;  1BE3 E;  2Q1K A;  1E5W A;  2BCC G;  3M0A A;  1M1J B;  1SP4 A;  3KHU A;  1NU1 K;  2ZT9 D;  2WIT A;  1ZOY D;  1U7M A;  1L0N K;  5GTH H;  2YIU B;  1SS1 A;  1L0N G;  3TDK A;  2I1J A;  3L75 G;  3M0D A;  3AED D;  1HH0 A;  2GA1 A;  3KZI E;  1FZF A;  2OYO A;  2WT7 A;  2GUV A;  2WU5 C;  3H1H J;  1SQB J;  2QG4 A;  4DJG A;  3S4R A;  4YSZ D;  2K9J A;  3AE8 C;  2C9N Y;  1JEK A;  1YI2 P;  1K04 A;  4NPF X;  2KSJ A;  3T97 B;  3AEG D;  1BGY D;  3GG2 A;  5GTI H;  1JB0 J;  3A3Y B;  3W68 A;  2QIW A;  3AE6 C;  4H44 B;  3H1L J;  3TF5 A;  1FDO A;  1N7L A;  3EQ2 A;  1T2K D;  2WPS A;  4JPZ B;  3AE3 C;  5B66 H;  3CCS P;  2ZYG A;  2YMY A;  4PV1 C;  2D2C C;  3TGU J;  1S3J A;  4BWN A;  3I5C A;  3L70 E;  3E7K A;  1RHZ B;  4HKZ H;  5AW4 B;  4U3F E;  1NTK D;  4W80 A;  2ACZ C;  1RE4 C;  3CD6 P;  2C0W A;  2L5G B;  3RL0 g;  2I8D A;  2NPS C;  2PP6 A;  1SVF A;  3L72 D;  3P4Q C;  2P7J A;  1RY3 A;  2KOG A;  4YTN D;  3H1H E;  1AQT A;  3D6Z A;  1W2E A;  3A0B E;  1KQG B;  1USE A;  2K88 A;  2IX7 C;  2WS3 C;  1LP1 B;  3H32 B;  1NEN C;  3B5N B;  2OYH C;  1IC2 A;  2E75 C;  1H8A A;  2MJZ A;  3CMA P;  3H1L E;  4DZO A;  1SQQ E;  2JKV A;  1URQ C;  1QVG O;  5B66 E;  5AW5 B;  3CX5 E;  3H1I J;  1LTG C;  4L74 A;  1L0L J;  1N8R Q;  1Q81 Q;  4LGD E;  4AQR D;  1JY2 O;  2C0X A;  2CPB A;  3CPW O;  2WS3 D;  2J58 A;  2OYH A;  3SWY A;  1LTA C;  2P67 A;  1GU5 A;  1EXI A;  1OMI A;  1UII A;  5CCG A;  1MV8 A;  4U3F G;  4R4M A;  1L0V C;  1N73 C;  3L71 E;  3LIE A;  1DIP A;  4D6T G;  4HYT B;  2A45 I;  1NEK D;  5KTB A;  2WQY D;  3HE4 B;  4I7Z C;  3AEG C;  4YXW H;  1KC8 Q;  1YJW P;  3L36 A;  5KJ7 A;  3WUU A;  1P84 E;  1SLQ A;  1NTK J;  2IZ1 A;  3H1I E;  3BRV B;  1FAV A;  3N4X A;  2A45 G;  3H1K G;  2JP3 A;  1FU1 A;  2IYP A;  1R8E A;  3CXH D;  5E79 H;  2GUS A;  2IDB A;  4PV1 B;  1E79 H;  1NHL A;  4NPE A;  4OGQ D;  1YJ9 P;  3L72 E;  3AE2 D;  1S4X A;  4YTP D;  3CL3 D;  1KB9 I;  2HLO A;  2JWD A;  4IFF A;  1CI6 B;  2WU2 D;  1R5L A;  3P8M C;  2WU5 D;  3CXH E;  1GL2 A;  5CJ4 A;  1X0T A;  1GW3 A;  3EFG A;  4Y99 C;  4DT0 A;  4ZKU A;  2OYI B;  1OIP A;  1H88 A;  2BAS A;  1LTI C;  1GL2 D;  3H1I D;  5KLV D;  2W6A A;  4PD4 I;  3SSU A;  2RN0 A;  3QH9 A;  5CCG C;  1Q7Y Q;  1ZN5 A;  1SQX G;  4FJV A;  5BVZ A;  3P32 A;  3FXE A;  4Y28 J;  1L0L K;  3O6Q B;  1NO4 A;  2FYN B;  2W6J H;  3L71 G;  3VYI A;  1VF5 B;  4GOD A;  1K8A Q;  4KX6 D;  1JM0 A;  2LXB A;  3P4S C;  1DX7 A;  3MHV A;  2YO2 A;  1JTH B;  3Q5S A;  4H13 D;  1W5C E;  4C7N A;  4BRY A;  1ZRT E;  4L76 A;  4AUW A;  3AE1 C;  5APY A;  1RQV A;  4YSX D;  3L73 E;  1FJK A;  2L91 A;  3MUD A;  3KQG A;  5AW6 B;  3P4Q D;  2P1J A;  4M3L A;  2ZYD A;  3U1C A;  3USS A;  1ZR4 A;  1KF6 C;  1JO5 A;  1EZV G;  2LKM A;  2J5U A;  3M06 A;  1GK6 A;  3Q5R A;  1PP9 G;  4ASV A;  2KUB A;  1PGP A;  1SQV E;  3CWB G;  2B89 A;  3HD7 B;  5APT A;  3AE4 C;  1WRG A;  1LT1 A;  3H1L D;  2IBZ D;  5C3J C;  5KLI C;  4IFM A;  1WMK A;  4YSX C;  1HWT C;  1SQB G;  2HFE D;  4DHZ A;  2W8Z A;  3JCU H;  1LWU B;  2BS2 C;  1KB9 H;  2WDQ C;  1KIL B;  1M1J C;  1HTL C;  3UIA A;  1S72 P;  1N7S C;  5C2T C;  4KX6 C;  3H1H D;  4DOJ A;  2KZI A;  3SFD C;  2FBW C;  5CBO A;  1A02 F;  4U7J A;  4WB4 A;  4ZNC A;  3L73 J;  3B5N A;  4Y99 B;  2OYI C;  1J2J B;  3CWB E;  5K5G B;  1VQ4 P;  1D7M A;  1QGK B;  1DH3 A;  2QJY C;  5H2F H;  1HGZ A;  3HE5 A;  3WU2 H;  1KN7 A;  2M3E A;  2WU2 C;  4WY4 C;  3IR9 A;  2BCC E;  3L75 E;  4PJ0 E;  1SQX D;  3RL0 C;  2UWJ E;  2P10 A;  4EIJ A;  1FZG A;  4JQ0 D;  3PH0 A;  1QLE D;  5AVT B;  3H1J E;  1HUC A;  1NU1 J;  1S5L H;  3NMD A;  1E7P C;  3V2P A;  1BGY E;  2WZ7 A;  2AEM A;  1LJ2 A;  5GTI E;  4MN4 C;  1Y9B A;  3M9Q A;  1NJI Q;  5AVU B;  1NTZ G;  2LR2 A;  3FWN A;  1NTM J;  2OYI A;  1SQB E;  5TIS H;  3G9R A;  2ZVN B;  1N86 A;  3A0H E;  1IJD B;  2ZYA A;  3TNU B;  1VQM P;  2N1T A;  2YKQ A;  2HPC B;  3AEC D;  1GZL A;  1T3U A;  1T3J A;  2K9Y A;  3L74 E;  2QE7 H;  2PAJ A;  5CJ0 A;  3BRT B;  3F5H A;  1HJB A;  2A06 E;  1AA0 A;  1LWU A;  1JTH A;  1ZR2 A;  2IFM A;  1IK9 A;  3MIW A;  4N78 D;  4U3F J;  1R5S A;  1EZV E;  1AJY A;  1SQB K;  1NTZ K;  1MFZ A;  3AEB D;  1N73 A;  1LTJ A;  3CXH H;  5KLV K;  1BE3 G;  1L0N D;  4IOI H;  3VRA D;  2HR3 A;  4JBZ A;  3TNU A;  3AEC C;  4H0L C;  3MUD C;  2E75 D;  3L4F A;  3SFE C;  1NEN D;  1KQS O;  2XU6 A;  2FYU E;  3GF3 A;  2WWW A;  1WT6 A;  2OTL P;  1URQ B;  2R3S A;  1VQN P;  1PPJ E;  1YIT P;  2CK3 H;  1KQF B;  1MKM A;  1SFC D;  4EYY Q;  3RK2 D;  5KKZ B;  2QEX P;  2W6B A;  4TT3 H;  5AW9 B;  1IO4 A;  1KYO D;  1L4A C;  3M9B A;  3V6I A;  4BRY B;  4W7Y A;  1BE3 J;  1LP1 A;  5APU A;  1KD1 Q;  1JY2 N;  3GW6 A;  1BCC G;  3RK2 B;  2ZXX A;  5H2F E;  3B4S A;  3A0H H;  3B5N C;  1ZME C;  1OVR A;  4D6T E;  3C1L A;  1GW4 A;  3HUS B;  1NKN A;  4I7Z B;  3AE3 D;  1IZN B;  4XFJ A;  3RK2 C;  3TGU G;  5TIS E;  1KFY D;  3S1K A;  3L72 G;  1J1E C;  2VRS A;  4I2L C;  3RBZ A;  3HD7 A;  1BCC E;  1NEK C;  5TJH A;  3VRA C;  2Q3I A;  3VRB C;  2JJL A;  1YHQ P;  2QJK B;  2ZJS E;  1LTJ B;  5AVS B;  1EC5 A;  2AXT E;  1LWU C;  2WDR C;  1RF1 C;  3CCE P;  2M8R A;  1G2C B;  2ZFC A;  3V2R A;  3AE6 D;  1ZP0 C;  1JCC A;  5KJ7 C;  1MZ9 A;  1KIL D;  1NTK K;  2V7Q H;  1H0T A;  1PGQ A;  1HGV A;  3BAS A;  4RO0 A;  3T97 A;  3HTK A;  5KLV J;  1KOR A;  1VQ8 P;  1Q82 Q;  5APX A;  1NTZ J;  4H44 C;  2ZVO B;  1M90 Q;  3A5T A;  2FXM A;  1L2P A;  4EOT A;  3AED C;  1BDC A;  2E43 A;  1KV4 A;  1LTB C;  4L73 A;  5AVW B;  1FZC A;  1L0L G;  1BCC J;  3D6Y A;  1RF0 A;  2HYN A;  2JWA A;  4I1L A;  4UB6 E;  1FZA A;  1VQ7 P;  1L0N J;  3RL0 B;  4YXD C;  1EDL A;  3CXH I;  2QM7 A;  2Z5I A;  1USD A;  2N9Y B;  3JCU E;  2FYN C;  1X79 B;  3E1R A;  4YTN C;  2AXT H;  1GD2 E;  3O8Z A;  1FZC C;  1SQP E;  3L70 G;  1SQQ J;  3OW2 O;  3M9H A;  1L0V D;  4KT0 J;  1M56 D;  2M0B A;  3RL0 D;  4A7P A;  1UIX A;  3PHL A;  2H8P D;  1SQP K;  1GL2 C;  3U1A A;  1JY3 P; 
#chains in the Genus database with same CATH homology
 3GF7 A;  3S9O A;  3P4P C;  2JO1 A;  2WS3 C;  4YTM D;  2QJP C;  2WDR C;  3AED D;  3P4Q D;  3VRA D;  2O01 J;  2H89 C;  3AEC C;  1NYH A;  4H0L C;  2JP3 A;  4GDO A;  2E75 D;  1NEN C;  3AE4 D;  3SFE C;  3AE5 C;  1R8E A;  2V7Q J;  2G8Y A;  2E75 C;  1KF6 C;  1NEN D;  2E74 C;  3AE8 D;  3AE6 D;  2J5U A;  1KF6 D;  4YT0 D;  3GF3 A;  2G3A A;  3AE9 C;  1ZP0 C;  3D71 A;  2IDB A;  4PV1 B;  3Q5R A;  3LW5 J;  1E7P C;  3GMA A;  2BS4 C;  2WU5 C;  3Q1M A;  4OGQ D;  4OGQ B;  2D2C D;  1NGM B;  2MKV A;  4OGQ C;  3AE2 D;  1KFY C;  2D2C B;  3EWK A;  2WP9 D;  3VR8 C;  2NZ2 A;  4YTP C;  4YSZ D;  3Q2Y A;  2H88 D;  3AE8 C;  1YQ4 D;  2WDV C;  2E76 B;  5KKZ C;  4YTP D;  3AEE D;  2E74 B;  1K04 A;  3AE4 C;  3H25 A;  3AEA C;  4Z1M H;  3AEF D;  1IK7 A;  1KQF B;  3P4R D;  3T97 B;  1Y9B A;  3AEG D;  2WU2 D;  1MKM A;  1PIX A;  3Q5P A;  1PL5 A;  1ZOY C;  1HF9 A;  3ABV D;  1KOR A;  3CIR D;  5C3J C;  5M1B A;  3AEF C;  5KLI C;  2WU5 D;  1QLB C;  1JB0 J;  3AEE C;  2E75 B;  4H13 B;  1WMK A;  3AE7 D;  4IL6 X;  4H44 D;  2E76 C;  2QIW A;  4YSX C;  3AE6 C;  4H44 B;  4H44 C;  2BEZ F;  4H13 C;  4TT3 H;  3Q3D A;  1FDO A;  2BS2 C;  3P4P D;  2WSE J;  3AED C;  3G9R A;  2WDR D;  2WDQ C;  3AEB C;  2WS3 D;  2FBW D;  2BEQ D;  2WDV D;  3AEA D;  3VR9 C;  1Q90 D;  2BS3 C;  3AE3 C;  4H0L D;  3CIR C;  5C2T D;  1YQ3 C;  4PV1 C;  3D6Y A;  1EXI A;  5C2T C;  1OMI A;  2OQQ A;  2D2C C;  3AE2 C;  1U57 A;  4KX6 C;  1K05 A;  3IN6 A;  2YMK A;  3SFD D;  2H88 C;  3D70 A;  2WDQ D;  3SFD C;  2H89 D;  2WP9 C;  2FBW C;  3VR8 D;  4RKU J;  3RK3 E;  1HJ0 A;  4Y28 J;  3B71 A;  1ZME C;  4U7J A;  4YXD D;  4R4M A;  3AEC D;  4YXD C;  1L0V C;  2ACZ C;  2K9Y A;  2WSC J;  1KMI Z;  4I7Z B;  4YT0 C;  3AE3 D;  5L8R J;  3AE9 D;  4XFJ A;  1VF5 D;  1OW8 A;  2QJK C;  2WQY C;  3RL0 g;  3P4R C;  1VF5 B;  1DD3 A;  3AE7 C;  1VF5 C;  1KIL E;  2E74 D;  2E76 D;  2WSF J;  1EXJ A;  1VL2 A;  1PV3 A;  1DIP A;  1KFY D;  2FYN C;  1OW6 A;  3O6Q A;  4H0L B;  4KX6 D;  2QJY C;  4YSZ C;  1DD4 A;  3P4S C;  2B76 D;  4YTM C;  3P4S D;  3P4Q C;  3GLM A;  2B76 C;  4R4L A;  4YTN C;  3Q5S A;  1RQU A;  1S5L X;  1KTM A;  4H13 D;  1NEK C;  2WPV B;  3IAO A;  3SFE D;  1FDI A;  1NEK D;  3VR9 D;  1OW7 A;  2YIU C;  1AJY A;  4YSY C;  4YTN D;  4YSY D;  1TU3 F;  3ABV C;  2WQY D;  3C8V A;  3VRB D;  3AE5 D;  4I7Z C;  3AEB D;  3VRA C;  2QSI A;  3R4Y A;  2WU2 C;  2ZT9 D;  3AEG C;  2FXP A;  1GMJ A;  4PV1 D;  1ZRT E;  2ZT9 B;  1YQ3 D;  5C3J D;  1S1C X;  2ZT9 C;  4KT0 J;  1L0V D;  1ZOY D;  2ACZ D;  1ZP0 D;  3AE1 C;  3D6Z A;  3VRB C;  3FGA D;  1RQV A;  4YSX D;  1UIX A;  1KQG B;  3AE1 D;  2P10 A;  1YQ4 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...