5C3JC

Crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with ubiquinone-1
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
153
structure length
153
Chain Sequence
EKTPIQVWGWDYLMRQRALKRPIAPHLTIYKPQMTWMVSGLHRVTGCAMAGTLLIGGVGFSVLPLDFTTFVEFIRGLGIPWVILDTFKFIIAFPIAFHTLNGIRFIGFDMAKGTDIPSIYRGAYLVLGLAALISLAVVVYPRWERHKKATLPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
rcsb
total genus 57
structure length 153
sequence length 153
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 5c3jC00
3AEBD 1ZOYD 2H89D 3CIRD 3P4SC 4YTMC 3AE1D 1KF6C 2WU5D 2WU2D 3P4QC 3AEAC 2BS2C 3AEGD 1L0VC 4YT0C 4YTND 2WDVC 1QLBC 2WQYD 3AECD 3P4PC 3VR8D 1KFYD 3AE6C 2WDQD 2FBWD 3VR9C 1NENC 2ACZC 4YXDC 3AE5D 3AE2D 5C2TC 1YQ3D 3AE7D 3VRAD 3SFDD 4KX6D 3AEBC 1YQ4D 2H89C 3AE3C 3AEDC 3CIRC 2WS3D 4YSYD 3AE9C 3AE1C 4YSZD 2H88D 3SFED 2WU5C 2WU2C 3VRBD 1ZP0D 5C3JD 3AEGC 1NEKD 3AE4C 3P4RD 3AEED 2B76D 4YTPC 2WQYC 3AECC 4YSXD 3VR8C 3AE8D 1KFYC 2WDQC 2BS4C 2WDRC 2FBWC 3AEFD 2WP9D 1NEND 1ZOYC 3ABVD 3AE5C 2ACZD 2BS3C 3AE2C 1YQ3C 3VRAC 3P4SD 3SFDC 4YTMD 5C2TD 1YQ4C 1KF6D 2WS3C 3AEDD 3AE3D 3P4QD 4YSYC 3AEAD 4YTNC 4YSZC 2H88C 1L0VD 4YT0D 3AE9D 3SFEC 2WDVD 3VRBC 1ZP0C 1E7PC 3P4PD 5C3JC 3AE6D 1NEKC 3P4RC 3VR9D 3AEEC 3AE4D 2B76C 4YSXC 3AE8C 4YTPD 4YXDD 3AEFC 2WDRD 3AE7C 2WP9C 4KX6C 3ABVC
chains in the Genus database with same CATH superfamily
3VONA 3AEBD 1ZOYD 2H89D 3CIRD 3P4SC 4YTMC 3AE1D 1KF6C 2WU5D 2WU2D 3P4QC 3AEAC 4DHIB 4LDTA 2BS2C 3AEGD 1L0VC 4YT0C 4DDIA 4YTND 2WDVC 1QLBC 2WQYD 3AECD 3P4PC 3VR8D 4I6LA 1KFYD 3AE6C 2WDQD 2FBWD 3VR9C 1NENC 2ACZC 2ZFYA 4YXDC 3AE5D 3AE2D 5C2TC 1YQ3D 3AE7D 3VRAD 3SFDD 4KX6D 3AEBC 1YQ4D 2H89C 3AE3C 3AEDC 3CIRC 2WS3D 4YSYD 3AE9C 3AE1C 4YSZD 2H88D 4DHJA 4FJVA 3SFED 2WU5C 2WU2C 3VRBD 1ZP0D 5C3JD 3AEGC 1NEKD 4DHZA 3AE4C 3P4RD 3AEED 2B76D 4YTPC 2WQYC 3AECC 4YSXD 3VR8C 3AE8D 1KFYC 2WDQC 2BS4C 2WDRC 2FBWC 3AEFD 2WP9D 1TFFA 1NEND 1ZOYC 3ABVD 3AE5C 2ACZD 2BS3C 3AE2C 1YQ3C 3VRAC 3P4SD 3SFDC 4YTMD 5C2TD 1YQ4C 1KF6D 2WS3C 3AEDD 3AE3D 3P4QD 4YSYC 3AEAD 4YTNC 4YSZC 2H88C 1L0VD 4YT0D 3AE9D 3SFEC 2WDVD 4DDGA 3VRBC 1ZP0C 1E7PC 3P4PD 5C3JC 3AE6D 1NEKC 3P4RC 3VR9D 3AEEC 3AE4D 2B76C 4YSXC 3AE8C 4YTPD 4YXDD 3AEFC 2WDRD 3AE7C 2WP9C 4KX6C 3ABVC
chains in the Genus database with same CATH topology
3AEBD 1ZOYD 2H89D 3CIRD 3P4SC 4YTMC 3AE1D 1KF6C 2WU5D 2WU2D 3P4QC 3AEAC 2BS2C 3AEGD 1L0VC 4YT0C 4YTND 2WDVC 1QLBC 2WQYD 3AECD 3P4PC 3VR8D 1KFYD 3AE6C 2WDQD 2FBWD 3VR9C 1NENC 2ACZC 4YXDC 3AE5D 3AE2D 5C2TC 1YQ3D 3AE7D 3VRAD 3SFDD 4KX6D 3AEBC 1YQ4D 2H89C 3AE3C 3AEDC 3CIRC 2WS3D 4YSYD 3AE9C 3AE1C 4YSZD 2H88D 3SFED 2WU5C 2WU2C 3VRBD 1ZP0D 5C3JD 3AEGC 1NEKD 3AE4C 3P4RD 3AEED 2B76D 4YTPC 2WQYC 3AECC 4YSXD 3VR8C 3AE8D 1KFYC 2WDQC 2BS4C 2WDRC 2FBWC 3AEFD 2WP9D 1NEND 1ZOYC 3ABVD 3AE5C 2ACZD 2BS3C 3AE2C 1YQ3C 3VRAC 3P4SD 3SFDC 4YTMD 5C2TD 1YQ4C 1KF6D 2WS3C 3AEDD 3AE3D 3P4QD 4YSYC 3AEAD 4YTNC 4YSZC 2H88C 1L0VD 4YT0D 3AE9D 3SFEC 2WDVD 3VRBC 1ZP0C 1E7PC 3P4PD 5C3JC 3AE6D 1NEKC 3P4RC 3VR9D 3AEEC 3AE4D 2B76C 4YSXC 3AE8C 4YTPD 4YXDD 3AEFC 2WDRD 3AE7C 2WP9C 4KX6C 3ABVC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AEB D;  1ZOY D;  2H89 D;  3CIR D;  3P4S C;  4YTM C;  3AE1 D;  1KF6 C;  2WU5 D;  2WU2 D;  3P4Q C;  3AEA C;  2BS2 C;  3AEG D;  1L0V C;  4YT0 C;  4YTN D;  2WDV C;  1QLB C;  2WQY D;  3AEC D;  3P4P C;  3VR8 D;  1KFY D;  3AE6 C;  2WDQ D;  2FBW D;  3VR9 C;  1NEN C;  2ACZ C;  4YXD C;  3AE5 D;  3AE2 D;  5C2T C;  1YQ3 D;  3AE7 D;  3VRA D;  3SFD D;  4KX6 D;  3AEB C;  1YQ4 D;  2H89 C;  3AE3 C;  3AED C;  3CIR C;  2WS3 D;  4YSY D;  3AE9 C;  3AE1 C;  4YSZ D;  2H88 D;  3SFE D;  2WU5 C;  2WU2 C;  3VRB D;  1ZP0 D;  5C3J D;  3AEG C;  1NEK D;  3AE4 C;  3P4R D;  3AEE D;  2B76 D;  4YTP C;  2WQY C;  3AEC C;  4YSX D;  3VR8 C;  3AE8 D;  1KFY C;  2WDQ C;  2BS4 C;  2WDR C;  2FBW C;  3AEF D;  2WP9 D;  1NEN D;  1ZOY C;  3ABV D;  3AE5 C;  2ACZ D;  2BS3 C;  3AE2 C;  1YQ3 C;  3VRA C;  3P4S D;  3SFD C;  4YTM D;  5C2T D;  1YQ4 C;  1KF6 D;  2WS3 C;  3AED D;  3AE3 D;  3P4Q D;  4YSY C;  3AEA D;  4YTN C;  4YSZ C;  2H88 C;  1L0V D;  4YT0 D;  3AE9 D;  3SFE C;  2WDV D;  3VRB C;  1ZP0 C;  1E7P C;  3P4P D;  5C3J C;  3AE6 D;  1NEK C;  3P4R C;  3VR9 D;  3AEE C;  3AE4 D;  2B76 C;  4YSX C;  3AE8 C;  4YTP D;  4YXD D;  3AEF C;  2WDR D;  3AE7 C;  2WP9 C;  4KX6 C;  3ABV C; 
#chains in the Genus database with same CATH topology
 3VON A;  3AEB D;  1ZOY D;  2H89 D;  3CIR D;  3P4S C;  4YTM C;  3AE1 D;  1KF6 C;  2WU5 D;  2WU2 D;  3P4Q C;  3AEA C;  4DHI B;  4LDT A;  2BS2 C;  3AEG D;  1L0V C;  4YT0 C;  4DDI A;  4YTN D;  2WDV C;  1QLB C;  2WQY D;  3AEC D;  3P4P C;  3VR8 D;  4I6L A;  1KFY D;  3AE6 C;  2WDQ D;  2FBW D;  3VR9 C;  1NEN C;  2ACZ C;  2ZFY A;  4YXD C;  3AE5 D;  3AE2 D;  5C2T C;  1YQ3 D;  3AE7 D;  3VRA D;  3SFD D;  4KX6 D;  3AEB C;  1YQ4 D;  2H89 C;  3AE3 C;  3AED C;  3CIR C;  2WS3 D;  4YSY D;  3AE9 C;  3AE1 C;  4YSZ D;  2H88 D;  4DHJ A;  4FJV A;  3SFE D;  2WU5 C;  2WU2 C;  3VRB D;  1ZP0 D;  5C3J D;  3AEG C;  1NEK D;  4DHZ A;  3AE4 C;  3P4R D;  3AEE D;  2B76 D;  4YTP C;  2WQY C;  3AEC C;  4YSX D;  3VR8 C;  3AE8 D;  1KFY C;  2WDQ C;  2BS4 C;  2WDR C;  2FBW C;  3AEF D;  2WP9 D;  1TFF A;  1NEN D;  1ZOY C;  3ABV D;  3AE5 C;  2ACZ D;  2BS3 C;  3AE2 C;  1YQ3 C;  3VRA C;  3P4S D;  3SFD C;  4YTM D;  5C2T D;  1YQ4 C;  1KF6 D;  2WS3 C;  3AED D;  3AE3 D;  3P4Q D;  4YSY C;  3AEA D;  4YTN C;  4YSZ C;  2H88 C;  1L0V D;  4YT0 D;  3AE9 D;  3SFE C;  2WDV D;  4DDG A;  3VRB C;  1ZP0 C;  1E7P C;  3P4P D;  5C3J C;  3AE6 D;  1NEK C;  3P4R C;  3VR9 D;  3AEE C;  3AE4 D;  2B76 C;  4YSX C;  3AE8 C;  4YTP D;  4YXD D;  3AEF C;  2WDR D;  3AE7 C;  2WP9 C;  4KX6 C;  3ABV C; 
#chains in the Genus database with same CATH homology
 3AEB D;  1ZOY D;  2H89 D;  3CIR D;  3P4S C;  4YTM C;  3AE1 D;  1KF6 C;  2WU5 D;  2WU2 D;  3P4Q C;  3AEA C;  2BS2 C;  3AEG D;  1L0V C;  4YT0 C;  4YTN D;  2WDV C;  1QLB C;  2WQY D;  3AEC D;  3P4P C;  3VR8 D;  1KFY D;  3AE6 C;  2WDQ D;  2FBW D;  3VR9 C;  1NEN C;  2ACZ C;  4YXD C;  3AE5 D;  3AE2 D;  5C2T C;  1YQ3 D;  3AE7 D;  3VRA D;  3SFD D;  4KX6 D;  3AEB C;  1YQ4 D;  2H89 C;  3AE3 C;  3AED C;  3CIR C;  2WS3 D;  4YSY D;  3AE9 C;  3AE1 C;  4YSZ D;  2H88 D;  3SFE D;  2WU5 C;  2WU2 C;  3VRB D;  1ZP0 D;  5C3J D;  3AEG C;  1NEK D;  3AE4 C;  3P4R D;  3AEE D;  2B76 D;  4YTP C;  2WQY C;  3AEC C;  4YSX D;  3VR8 C;  3AE8 D;  1KFY C;  2WDQ C;  2BS4 C;  2WDR C;  2FBW C;  3AEF D;  2WP9 D;  1NEN D;  1ZOY C;  3ABV D;  3AE5 C;  2ACZ D;  2BS3 C;  3AE2 C;  1YQ3 C;  3VRA C;  3P4S D;  3SFD C;  4YTM D;  5C2T D;  1YQ4 C;  1KF6 D;  2WS3 C;  3AED D;  3AE3 D;  3P4Q D;  4YSY C;  3AEA D;  4YTN C;  4YSZ C;  2H88 C;  1L0V D;  4YT0 D;  3AE9 D;  3SFE C;  2WDV D;  3VRB C;  1ZP0 C;  1E7P C;  3P4P D;  5C3J C;  3AE6 D;  1NEK C;  3P4R C;  3VR9 D;  3AEE C;  3AE4 D;  2B76 C;  4YSX C;  3AE8 C;  4YTP D;  4YXD D;  3AEF C;  2WDR D;  3AE7 C;  2WP9 C;  4KX6 C;  3ABV C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...