3AEGC

Crystal structure of porcine heart mitochondrial complex ii bound with n-biphenyl-3-yl-2-iodo-benzamide
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with N-Biphenyl-3-yl-2-iodo-benzamide
rcsb
total genus 48
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3aegC01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3aegC02
3AEAD 2WDRD 2FBWC 3P4SD 2WDVD 2WQYC 3P4RD 2G3AA 3VRBD 1OW6A 2WS3D 4YT0D 2WU2C 5C2TC 3P4QD 3SFED 1NEKC 1OW7A 1L0VD 1YQ4D 2WDQD 4YSYC 1KTMA 3AE8D 3AEED 5C3JC 3S9OA 2B76C 3AEGD 3AE7D 3ABVD 4KX6D 1K05A 3AE4D 3AE3C 4YTND 4YSXC 2BS2C 4YTMC 4YTNC 3AEAC 2WDRC 3P4SC 2WDVC 2WU5D 3P4RC 3VRBC 3VRAD 1KF6D 2WS3C 1ZP0D 4YT0C 3P4QC 1ZP0C 3P4PD 3SFEC 1L0VC 1YQ4C 2WDQC 3AEFD 3AE8C 3AEEC 3CIRD 2H88D 3VR8D 3AE2D 3AEGC 3AE7C 3ABVC 3AEDD 1NEND 2H89D 4KX6C 3AECD 3AE4C 3AEBD 1E7PC 1K04A 3AE9D 1PV3A 3AEBC 3AE9C 2WP9D 2WU5C 3B71A 4YTPD 3AE6D 3VR9D 3VRAC 1KF6C 1KFYD 1QLBC 1KFYC 2BS4C 3P4PC 3AE5D 3SFDD 2BS3C 3AE5C 3AEFC 2WQYD 3CIRC 2H88C 1ZOYD 3VR8C 3AE2C 1YQ3D 3AEDC 1ZOYC 1NENC 2H89C 1YQ3C 2WU2D 5C2TD 1NEKD 3AECC 1OW8A 4YSYD 4YXDD 2ACZD 5C3JD 4YXDC 2B76D 2ACZC 2WP9C 4YTPC 3AE6C 3VR9C 3AE1D 4YSZD 3AE1C 4YSZC 3AE3D 4YSXD 2FBWD 4YTMD 3SFDC
chains in the Genus database with same CATH superfamily
3AEAD 4U3FD 5KLVG 3VRBD 1SQBG 5AW7B 1Q7YQ 1PP9J 3TF5A 4WB4A 1FE6A 5APSA 1X79B 2W6BA 4W80A 1NWQA 2LXCB 2R5BA 1GL2A 2OYHC 3P8CE 2WVRA 3CPWO 2POHA 1PPJE 2H43A 3H1HJ 5H2FE 3HD7A 1NU1E 5AVVB 1VQ9P 1EZVD 2M3EA 2W90A 3CXHI 2ZYAA 1FDIA 3AEFD 1PP9E 3VMYA 1U7MA 3H1KJ 5AW6B 1OX3A 3AE9C 1PZQA 2XZRA 1YI2P 3P7KA 3PLNA 3H1HE 2DW3A 2QG4A 5TISE 2MJZA 2Q3EA 1L4AB 1LTJC 1ZR2A 3CIRC 1L4AD 4C7NA 1NEKD 3AECC 2QRXA 3PP5A 5GTHE 2YXQB 3O6QA 2QVAA 3H1KE 1KQGB 4YTPC 2ZAEB 4PD4I 1NTZJ 3VN0A 3TGUD 3AE1C 3WUUA 2B87A 3K5BA 5AW3B 3HUSC 4YSXD 2OTJP 1L0ND 1RE4A 1LT9C 3L75J 2YMYA 4N3YB 2ZVOB 2K88A 2Y9YA 1SFCA 3L73G 2JWDA 3KYQA 2LXBA 1RF1B 2B76C 1HGZA 1GD2E 1R5SA 3FGAD 3L35A 1K05A 2ZJSE 3USSA 1NTZE 4PD4E 4YTMC 1VQLP 1LP1B 2Q5UA 1IFNA 4DHIB 4XE5B 1G1JA 3L75E 2Q7CA 2JJLA 1ZP0C 4IFDK 2BASA 1H8AA 4QMAA 3FXEA 3AEGC 3HE4B 2NPSB 1AV1A 3TNUB 2FKWB 2FFDC 1Y9BA 2IFMA 3T97A 2V7QJ 3D71A 3CWBD 1XTCC 5AVZB 1KF6C 1S2EA 3L70J 4DJGA 1W2EA 3P4PC 3SWKA 1UIXA 2HODA 3AE5C 4RESB 2E74B 1LTBC 3G4SP 2E74D 4I6LA 3G6EP 1PPJG 3H1LD 4YSYD 1J1DB 4EIJA 4WY4A 1P84H 3L71J 2GA1A 2RH0A 2LR2A 2MKVA 2A45H 4JQ0D 2WDVD 2D2CD 3RK3B 5B66H 1M1JA 3P8MC 1N2DC 1SQPJ 3RK3D 1YQ4D 5KLIB 1S3JA 2HR3A 2AXTE 3AEED 3H1HG 1GMJA 3AE7D 3L37A 3CCUP 2CK3H 1NTKD 1AJYA 2I1JA 3BCCD 3L71E 5AVTB 3AEAC 4JBZA 3RL0B 2E43A 3VRBC 1SVFA 3RL0D 2WSFJ 1SQPE 3H1IJ 5AVXB 3V2NA 1XTGB 1HGVA 2W6JH 1KYOD 2GUSA 1JY2O 4I1LA 1MZ9A 2XNDH 4Y28J 5KKZB 3B71A 3H1JD 5AVYB 1H89A 3CCVP 1FZCA 1NH4A 2KP8A 1RH5B 1T3UA 2O01J 3AEFC 1DD3A 4WVZA 2FYNB 1YQ3D 2HODB 2JEEA 2PAJA 3CX5I 1NTZG 2M3BA 2AEMA 3RBXA 2W27A 3EWKA 4L74A 3L75G 1IFPA 4I6MC 4YSZD 2VRSA 4AYCA 4BWNA 1EDIA 5E79E 3RL0g 4PJ0H 2Q1KA 1NO4A 1GU5A 2CPSA 4WY4D 3GHGB 1HJ0A 2Q9IA 1BE3G 1M7LA 1VQKP 1L4AC 4H44B 2RMZA 1NEKC 2R3CA 1L0VD 2OYHB 4ASVA 4H44D 3CX5E 3A7OA 1HJBA 1IFMA 1JNMA 5KLVD 1SQBD 1UIIA 3BVHA 4YSXC 1FBMA 4YTNC 1S5LX 3Q5RA 1OWAA 5CCHA 1QGKB 2C9NY 2IBZI 3I55P 1JUNA 1KN7A 4YXWH 2KIKA 2WSCH 2HYNA 3CMEP 3B5NA 3L70G 4N78E 1NOHA 3AE9D 1T6AA 2R3SA 1MFTA 2IDBA 1JEKA 1GL2C 3CC2P 4EOTA 4OVNF 2YKOA 1FZCB 3KXDA 3MUDA 2W83C 1AA0A 3L71G 3D6ZA 5DJUB 3AE1D 4UB6E 1YITP 1J1EC 1SQPG 4M3LA 3V6IA 3JCUE 1WRGA 1JCDA 4ZMDA 1URQA 2ZXXA 3IFMA 2E74C 1FZEA 5CBOA 4ZKPA 2O1JA 4YSYC 4DCKA 1KB9D 3EFGA 1AQTA 1J1DC 1NTMK 3VONA 4MN4C 3L73D 5DJTB 1NU1K 4A7PA 1ZV8A 2BCCJ 2WDVC 2D2CC 1K73Q 5K5GB 3H1IG 1ZP0D 2Y0DA 3RK3C 1YQ4C 1BCCJ 1RE3C 2QJKC 4NPDA 3AEEC 2N9BA 2P58A 3PTZA 3O8ZA 4BRYA 2FFDB 5KLIC 3AE7C 5CCHD 5AVWB 1KV4A 3CI9A 1P84I 2K9YA 1DEEG 1NHLA 2M5AB 3M9BA 5GTIH 1Y8AA 3FX0A 2BCCE 2A45I 2FYUJ 3A0BH 3Q2YA 3RL0C 3B5ND 1JY3N 1VF5D 3AE5D 1YJ9P 1AQ5A 5AVRB 4GKGA 4IL6X 5AW2B 1BCCE 4N6JA 1ZOYC 2E5YA 1NGMB 1EQ7A 3F89A 4YXDC 1P84E 2KSJA 3V2QA 1JTHB 3P8CD 5APTA 3VP8A 2BEZF 2KNCA 1VQ8P 1PPJD 5APVA 1NU1D 3CCQP 2WS3D 2J59M 1EC5A 4W7ZA 1KILE 2WITA 1L2PA 2HPCA 4EYYQ 4JF7A 1NAYA 1PP9D 1YBKA 1OZHA 3S9OA 2GUVA 1VQ5P 3ABVD 2P67A 2HFED 3TDKA 2ZT9D 1HVVA 3AE4D 1RF0A 2KYVA 4WY4C 2WMMA 4HH2A 3M9QA 3KZIE 2XDJA 3H1HD 5CJ4A 3GHGC 1L0VC 2H8PD 5KJ7A 1H0TA 4H44C 1S5LH 4BXLA 2H88D 1SQXJ 4K3AA 1QLED 2LKMA 2W8ZA 1L0NK 1U7JA 4I7ZB 2GM4A 1E7PC 3P32A 4R4MA 1KYOH 2KI7B 3R4YA 3H1KD 3WU2E 4ZNCA 5CCGA 1KFYC 1MUUA 3SFDD 3L74J 4LLHA 1FDMA 3Q3DA 1PFIA 3FXDA 1IFDA 1SQXE 3W67A 1PGOA 2WPQA 2JR8A 2N1TA 2ACZC 3OAKA 1Q90D 4LC1A 2P10A 2JWAA 4L76A 1NTZD 4PD4D 1X9VA 1SQQJ 5KAIH 2IFNA 2QJPC 3CXHE 4XFJA 2KNCB 1ZRTE 3OJAB 1M8OB 1FZBA 3L75D 3L74E 5AW4B 1OXZA 3Q1MA 4UB8E 1MFZA 1FZCC 3SFED 1E79H 3MGNA 1N86A 1VDFA 2WT7A 1G1IA 2BCCG 2HPCB 1JY3P 3TK1A 4W7YA 3S4RA 4YTND 2XV5A 1G2CA 1MKMA 1BCCG 2OYIB 2Q6QA 1T2KC 1SQQE 3ITKA 3A3YB 3D70A 4RKUJ 2QE7H 4D6TJ 5TJHA 1M1KQ 3NFQA 1BE3J 3A0HH 1M57D 3VR8D 1H0TB 2BEQD 2A45G 2FYUG 3VMZA 2PRRA 1GL2B 5KJ7D 3V2PA 1JCCA 3SWYA 2KUBA 4JYCA 1PV3A 3M0DA 1GL2D 5KAFE 3TGUJ 1RHZB 2NRGA 3HD7B 4O9BA 3MIWA 1QLBC 1EDLA 3M9HA 1DH3A 3HD7D 4D6TE 1GK4A 1NTKK 2KS1A 3M06A 1IFIA 1USDA 1GTWA 1SS1A 1BE3E 5CCGD 3VYIA 5CCHC 3CCMP 3GF3A 2Y0CA 1Z56A 2CPBA 2JO1A 5EFWB 1J1EB 4IL6H 3B5NC 3AE3D 1VF5C 2KK7A 3L71D 1JMMA 1SQVJ 4OGQB 3A2AA 1Q82Q 1LWUA 4H13B 4KJMA 2C0XA 2Q3IA 4OGQD 1ZLLA 2NZ2A 4YT0D 1MV8A 4C7NB 1VQNP 1FS0E 4H13D 1SQPD 2QIWA 4GDOA 1JMBA 2WT7B 3MUDC 3O6QB 2D2CB 2FXPA 1KB9H 3H6PA 3L70E 2B87B 4OH8B 1QL2A 1SQXG 2QJKB 1IO4A 1SQVE 2WS3C 1GK6A 3E1RA 1SFCB 3KQGA 1BSNA 1H88A 1HUCA 1AFOA 1Q2NA 1N7SA 1GZLA 2KOGA 3PJSK 1SFCD 5BVZA 3KPEA 1PGJA 1URQC 3CCSP 3ABVC 2IZ1A 1NEND 2ZT9C 1IC2A 1GW3A 3AE4C 5APYA 1YIJP 2WP9D 5APQA 3L74G 3A0BE 1OIPA 3H32A 5KLVK 1SQBK 1LTAC 1J2JB 1R5LA 2A06E 2H88C 1ZOYD 4ZKUA 5C2TD 1GW4A 2FYZA 3CX5D 4I7ZC 4YXDD 1SQQG 5L8RJ 3T97B 2YMKA 4RJTA 3LW5H 5CBNA 2WSEH 1EXIA 4GT1A 3SFDC 3CLQA 3QWOC 1NJIQ 2FBWC 1OVRA 4AQRD 3P4RD 3V5BA 1LTJA 2G3AA 5H2FH 2HLOA 1TFFA 5APXA 3H1IE 3P4QD 1X0TA 1KTMA 3HE5A 2KSEA 1KYOI 4WY4B 2R44A 4N78D 2P2UA 1QVFO 4D6TG 3MTUE 1FJPA 2KB7P 2YKQA 1LGHB 1VL2A 3BASA 1M1JB 3SFEC 1JB0J 5TISH 3L72J 1N7SB 3TGUG 5APWA 1WT6A 1WMKA 2K3RA 2YXRB 1N7SD 1LNQA 3PHLA 1QX8A 2K9JA 3L4FA 2XU6A 5GTHH 2ZXEB 1KFYD 2Z4EA 2OYIC 1N8RQ 1K9MQ 1RF0C 1KILA 4C46A 1S9KE 1L0LJ 3H32B 4PV1B 3VR8C 3TSIA 1BGYJ 1EXJA 1CW5A 3L72E 1GDTA 3WUTA 4PV1D 1ZW0A 5KJ7C 2ACZD 3B4SA 1SQVG 4FJVA 2O01N 2C9LY 2QJPB 1VQ7P 1JO5A 4R4LA 3HD7C 3ZDMA 3CCRP 4AUWA 2IBZE 1L0LE 5CCGC 1W2BO 1USEA 3HTKA 1BGYE 1KD1Q 1LTIC 3FWLA 1CZQA 1KQSO 2KZIA 3I56P 4DDIA 3AE3C 4YPCA 2A06G 5KTBA 1T2KD 3V2RA 3IF4A 1Y47A 3E7KA 1ZR4A 2BCCD 1GU4A 4H0LD 3EFFK 3VRAD 4LDTA 4OGQC 2E42A 4YT0C 1DD4A 4H13C 3R2PA 4TT3H 1OMIA 1JY2N 4HJGH 3SWFA 1JOCA 4JYBA 5C39A 2O1KA 1M56D 3VTPC 2WWWA 1P84D 1Q86Q 3AE6D 2WSSH 1D7MA 1RE4C 2M0BA 1U57A 2BS3C 2IYOA 1SQXK 1KILB 1SFCC 1NENC 1E5WA 1T8ZA 1KILD 3N7NA 1FOSF 3BRTB 3B5NB 1KB9I 1VF5B 2WP9C 1AVOA 2AXTH 2ZFCA 2IZ0A 2YIUB 2WDRD 3P4SD 3M0DC 4HYTB 4TLFA 3S1KA 3E1IA 2O3JA 5C2TC 3B8EB 2OTLP 2Y9ZA 2R5DA 3QH9A 1ZMEC 1BSHA 3HTKB 2P7JA 3NMDA 3CC7P 2FYUE 2FXMA 2BS2C 3M91A 1KC8Q 5B66E 2WU5D 3P4RC 3L72G 1URQB 1L4AA 3P4QC 1NYHA 1X22A 2QJYC 4RO0A 2ZT9B 3BATA 1URQD 1LWUC 1NTZK 3AE2D 3MP7B 3PH0A 2QA4P 1SQXD 2RN0A 1S1CX 1S72P 4HKZH 2IBZG 2ZFYA 1ZN5A 5APUA 2Z5IA 3AEBC 1L0LG 4NPFX 3V4WA 1BGYG 2YNYA 2IYPA 1NTMJ 1FZFA 1A02F 2B9BA 1NU1J 1RQUA 3CXHD 1KFNA 2V4HA 4GODA 1ZRTD 1M1JC 2I1KA 2AXCA 3KHUA 3L74D 4BRYB 2O01H 1AVYA 1RF1A 1OW8A 1N7SC 4B86A 2JP3A 5C3JD 4DHJA 3CX5H 3JSVC 1KQLA 1BDDA 3KDPB 1YTZI 1VPCA 2ZVNB 1T3JA 2WPRA 4U3FJ 2FBWD 5B5EH 1LP1A 1JY2P 1NTME 1SQQD 3WUVA 2B89A 4PV1C 1OFCX 5BU5A 4GOEA 1A02J 1VQ6P 2WDQD 1LTTC 2WZ7A 4L73A 3HE4A 2NPSA 1LJ2A 2OGUA 3TNUA 1IZNB 3G9RA 4PJ0E 4KX6D 1SQVK 1EZVI 1KORA 1FAVA 2R32A 4U3FE 5AW0B 1NKNA 1JM0A 3UIAA 3IR9A 2WSCJ 1M90Q 1S4XA 1KFMA 3VMAA 4U7JA 4EDFA 3IAOA 4D6TD 1IFJA 3U59A 3U1CA 1BE3D 3AEDD 3I5CA 5AVSB 1VQPP 1CI6A 1K04A 2K37A 1SQPK 2N9YB 1EZVE 2ZYGA 4H0LC 3VRAC 3CMAP 4Y99C 4UB6H 3IN6A 1YYCA 3HRNA 3JCUH 2WQYD 1RE3A 1DX7A 2WU2D 4ASWA 3V4QA 3D6YA 3CL3D 1K8AQ 1OVUA 3CD6P 3AE6C 4WBAA 1N73A 1L0NJ 3L70D 1N7LA 2E75C 3GW6A 2QM8A 3CCLP 2HG5D 1SQVD 1FDOA 1KILC 1YTZT 4Z1MH 3AE8D 1HTLC 2YO3A 3VP9A 2N1TB 3TGUE 4GOFA 5AW8B 3M0AA 3RBZA 3TYYA 2N1TD 2WDRC 3OW2O 2NPSD 3P4SC 1L0NE 2C0WA 2YIUC 1PIXA 1NKZB 2YKPA 2RKLA 2UWJE 2E5TA 2A06D 3OA7A 2AEJA 1OVVA 1FU1A 2ZYDA 1NTMG 3CWBJ 1KQFB 1NU1G 1G2CB 2I8DA 2WU5C 1CI6B 3VR9D 2IX7C 2E76C 3GHGA 1PP9G 1HBWA 3CCEP 3MD0A 4EI2A 3AE2C 3H1ID 2OYHA 2XKMA 3H1LJ 3C8VA 5GTIE 3L36A 4U3FG 3N4XA 1KMIZ 4LGDE 1IK7A 1RY3A 3CWBE 4IFFA 2L91A 5BU8B 2PFXA 1N73B 1L0LK 4DHZA 2FY8A 2P1JA 1HWTC 5AW5B 2KS1B 3KZIH 1EDJA 1IJDB 3H1LE 1EZVG 5C3JC 4OWFA 1YHQP 3H1KG 3Q5PA 1VQOP 1NTKJ 3BCCJ 1EDKA 1PGPA 2KLUA 3G3ZA 2AEFA 4GIFA 2QJYB 1X8YA 1LWUB 2G8YA 3RK3E 3WU2H 1LTGC 1HH0A 1S9KD 2WDQC 3RK2B 2H89D 3L72D 3FWNA 4KX6C 3RK2D 4DOJA 1NTKE 3AEBD 3HUSA 3BCCE 2H7HA 4XA4A 3H1JJ 1LT9A 3PRJA 5AW9B 1NVOA 3Q5SA 1S5LE 1QEXA 2IPPA 2OTKE 2XNXA 2IBZD 1JY3O 2PP6A 1LTSC 3CXHH 1L0LD 3AEDC 4IFMA 3CC4P 1KYOE 1BGYD 3RGUA 1L0NG 4UB8H 1SP4A 2J58A 3F5HA 2Y0EA 3H1JE 2KXPB 1RQVA 5B5EE 2M8RA 1TU3F 5AVUB 2WQYC 1QVGO 5M1BA 2WU2C 3JC22 1R8EA 1OW7A 2JDIH 2FFDA 2FYUK 5KLVJ 1SQBJ 5AVQB 1HF9A 5KAIE 2M5AA 1RF1C 2Z5HA 3EQ2A 3GLMA 4PD4H 2L5GB 2WTYA 3C1LA 4DZOA 4DDGA 2QSIA 2OYOA 1LTJB 5KAFH 5CJ0A 5AW1B 2YO2A 2J5UA 3AE8C 1PGQA 3CWBG 3CIRD 3CCJP 2WPVB 3HE5B 1Q81Q 5KLVE 1SQBE 3AECD 4H0LB 2KZJA 2N1TC 4Y99B 2NPSC 2JKVA 1JTHA 3HUSB 4YTPD 2OQQA 3A5TA 1LT9B 2PGDA 3H1LG 5CHXA 3A0HE 4K35A 3WMM0 4I2LC 3SSUA 4IOIH 1BCCD 2FXOA 3C9IA 2B88A 4JPZB 3VMXA 1W5CE 1LT1A 1IK9A 1DEBA 2K1AA 2B76D 3VOPA 2E75B 2K9JB 3VR9C 3II6A 2FYUD 1VQMP 2V7QH 1FZGA 2E75D 4YTMD 3GG2A 1KZUB 1PL5A 1OW6A 1NTKG 3BCCG 4IL6E 4CPGA 1BDCA 1FZAA 4KHXA 3AEGD 2SPZA 2OARA 1QL1A 3BRVB 3L73J 4KT0J 3W68A 1SLQA 1YJNP 3MHVA 2QM7A 3LIEA 1FJKA 4C7RA 1N73C 1KF6D 3P4PD 4DT0A 4HB1A 2ITAA 2WPSA 3GMAA 3H1JG 1KB9E 3MZWB 1SQQK 3L73E 2KLVA 4WWIA 2E76B 1DIPA 3NTNA 2E76D 3GF7A 3H25A 2BS4C 1VQ4P 1FC2C 5KKZC 1YJWP 1NTMD 2W6AA 2WSFH 3LIDA 3NXSA 1CSBA 5CMZA 2H89C 3U1AA 1YQ3C 3RK2C 2QEXP 3LW5J 2FYNC 3G71P 1FOSE 2WSEJ 4L75A 1NAFA 4YSZC 4NPEA 5E79H 1ZXGA 2OYIA
chains in the Genus database with same CATH topology
3AEAD 2WDRD 4OGQB 2FBWC 3P4SD 2QJPC 2WDVD 1TU3F 1PL5A 2D2CD 2WQYC 4XFJA 3P4RD 1ZRTE 1HJ0A 2G3AA 3VRBD 4H13B 1OW6A 5M1BA 1FDOA 2WS3D 4H44B 4OGQD 2NZ2A 4YT0D 3Q1MA 2E74C 2WU2C 3P4QD 1KILE 5C2TC 1R8EA 3SFED 1NEKC 1OW7A 4PV1C 1L0VD 4Z1MH 4H13D 1YQ4D 4H44D 2WDQD 4YSYC 2QIWA 1KTMA 3AE8D 1ZMEC 3AEED 5C3JC 3S9OA 2B76C 4GDOA 3AEGD 1GMJA 3ABVD 4KT0J 3Q5PA 3FGAD 3AE7D 2ZT9D 2D2CB 2FXPA 3G9RA 4KX6D 1HF9A 1K05A 3AE4D 3AE3C 4YTND 4YSXC 1AJYA 2FBWD 3GLMA 2BS2C 4YTMC 1KORA 4YTNC 1MKMA 3AEAC 2WDRC 1S5LX 3P4SC 3Q5RA 2WDVC 2D2CC 2WU5D 3P4RC 3VRBC 4H0LD 3VRAD 1KF6D 2QSIA 3D70A 1ZP0D 2YIUC 4RKUJ 1PIXA 2G8YA 4OGQC 2WS3C 2WSCJ 4YT0C 3P4QC 1VL2A 1DD4A 1ZP0C 3P4PD 2WSFJ 3RK3E 3SFEC 1NYHA 2QJYC 1L0VC 1YQ4C 2ZT9B 4H13C 4U7JA 1JB0J 2J5UA 1FDIA 3IAOA 4H44C 2WDQC 2QJKC 3AE8C 3AEFD 4TT3H 3AEEC 3CIRD 2H88D 3GMAA 1OMIA 3VR8D 2WPVB 3AE2D 3AEGC 5KLIC 3AE7C 3ABVC 3AEDD 2BEQD 1NEND 2H89D 4I7ZB 2ZT9C 1WMKA 4KX6C 1S1CX 3AECD 4H0LB 3AE4C 2K9YA 3AEBD 1E7PC 1K04A 3AE9D 4R4MA 1KQFB 1PV3A 3AEBC 1Y9BA 3R4YA 2E76B 3AE9C 2V7QJ 4Y28J 3D71A 1DIPA 2WP9D 2WU5C 3B71A 2IDBA 4YTPD 3AE6D 3VR9D 4H0LC 3VRAC 3Q2YA 1KF6C 1KFYD 2OQQA 1QLBC 2E76D 3Q5SA 3GF7A 3H25A 1KFYC 2BS4C 3P4PC 2E76C 1VF5D 3AE5D 3IN6A 3SFDD 1U57A 5KKZC 1UIXA 2BS3C 1RQUA 2O01J 3AE5C 3AEFC 2E74B 1DD3A 2WQYD 3CIRC 2H88C 4IL6X 1ZOYD 4PV1B 3Q3DA 3VR8C 3AE2C 1YQ3D 3AEDC 1ZOYC 1NENC 1EXJA 2H89C 1YQ3C 2E74D 2WU2D 5C2TD 1NEKD 3GF3A 4PV1D 3AECC 1NGMB 3C8VA 3D6ZA 1OW8A 2JO1A 3LW5J 4YSYD 1KMIZ 2FYNC 4I7ZC 2ACZD 3D6YA 4YXDD 2JP3A 3EWKA 5C3JD 3O6QA 1VF5B 2WSEJ 1IK7A 4YXDC 2ACZC 5L8RJ 2B76D 2E75B 2WP9C 1KQGB 3AE6C 4YTPC 1Q90D 3T97B 2YMKA 3AE1D 3VR9C 4YSZD 3AE1C 1RQVA 2P10A 3RL0g 4YSZC 3AE3D 2E75D 2BEZF 2MKVA 1VF5C 4R4LA 1EXIA 4YTMD 4YSXD 3SFDC 2E75C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AEA D;  2WDR D;  2FBW C;  3P4S D;  2WDV D;  2WQY C;  3P4R D;  2G3A A;  3VRB D;  1OW6 A;  2WS3 D;  4YT0 D;  2WU2 C;  5C2T C;  3P4Q D;  3SFE D;  1NEK C;  1OW7 A;  1L0V D;  1YQ4 D;  2WDQ D;  4YSY C;  1KTM A;  3AE8 D;  3AEE D;  5C3J C;  3S9O A;  2B76 C;  3AEG D;  3AE7 D;  3ABV D;  4KX6 D;  1K05 A;  3AE4 D;  3AE3 C;  4YTN D;  4YSX C;  2BS2 C;  4YTM C;  4YTN C;  3AEA C;  2WDR C;  3P4S C;  2WDV C;  2WU5 D;  3P4R C;  3VRB C;  3VRA D;  1KF6 D;  2WS3 C;  1ZP0 D;  4YT0 C;  3P4Q C;  1ZP0 C;  3P4P D;  3SFE C;  1L0V C;  1YQ4 C;  2WDQ C;  3AEF D;  3AE8 C;  3AEE C;  3CIR D;  2H88 D;  3VR8 D;  3AE2 D;  3AEG C;  3AE7 C;  3ABV C;  3AED D;  1NEN D;  2H89 D;  4KX6 C;  3AEC D;  3AE4 C;  3AEB D;  1E7P C;  1K04 A;  3AE9 D;  1PV3 A;  3AEB C;  3AE9 C;  2WP9 D;  2WU5 C;  3B71 A;  4YTP D;  3AE6 D;  3VR9 D;  3VRA C;  1KF6 C;  1KFY D;  1QLB C;  1KFY C;  2BS4 C;  3P4P C;  3AE5 D;  3SFD D;  2BS3 C;  3AE5 C;  3AEF C;  2WQY D;  3CIR C;  2H88 C;  1ZOY D;  3VR8 C;  3AE2 C;  1YQ3 D;  3AED C;  1ZOY C;  1NEN C;  2H89 C;  1YQ3 C;  2WU2 D;  5C2T D;  1NEK D;  3AEC C;  1OW8 A;  4YSY D;  4YXD D;  2ACZ D;  5C3J D;  4YXD C;  2B76 D;  2ACZ C;  2WP9 C;  4YTP C;  3AE6 C;  3VR9 C;  3AE1 D;  4YSZ D;  3AE1 C;  4YSZ C;  3AE3 D;  4YSX D;  2FBW D;  4YTM D;  3SFD C; 
#chains in the Genus database with same CATH topology
 3AEA D;  4U3F D;  5KLV G;  3VRB D;  1SQB G;  5AW7 B;  1Q7Y Q;  1PP9 J;  3TF5 A;  4WB4 A;  1FE6 A;  5APS A;  1X79 B;  2W6B A;  4W80 A;  1NWQ A;  2LXC B;  2R5B A;  1GL2 A;  2OYH C;  3P8C E;  2WVR A;  3CPW O;  2POH A;  1PPJ E;  2H43 A;  3H1H J;  5H2F E;  3HD7 A;  1NU1 E;  5AVV B;  1VQ9 P;  1EZV D;  2M3E A;  2W90 A;  3CXH I;  2ZYA A;  1FDI A;  3AEF D;  1PP9 E;  3VMY A;  1U7M A;  3H1K J;  5AW6 B;  1OX3 A;  3AE9 C;  1PZQ A;  2XZR A;  1YI2 P;  3P7K A;  3PLN A;  3H1H E;  2DW3 A;  2QG4 A;  5TIS E;  2MJZ A;  2Q3E A;  1L4A B;  1LTJ C;  1ZR2 A;  3CIR C;  1L4A D;  4C7N A;  1NEK D;  3AEC C;  2QRX A;  3PP5 A;  5GTH E;  2YXQ B;  3O6Q A;  2QVA A;  3H1K E;  1KQG B;  4YTP C;  2ZAE B;  4PD4 I;  1NTZ J;  3VN0 A;  3TGU D;  3AE1 C;  3WUU A;  2B87 A;  3K5B A;  5AW3 B;  3HUS C;  4YSX D;  2OTJ P;  1L0N D;  1RE4 A;  1LT9 C;  3L75 J;  2YMY A;  4N3Y B;  2ZVO B;  2K88 A;  2Y9Y A;  1SFC A;  3L73 G;  2JWD A;  3KYQ A;  2LXB A;  1RF1 B;  2B76 C;  1HGZ A;  1GD2 E;  1R5S A;  3FGA D;  3L35 A;  1K05 A;  2ZJS E;  3USS A;  1NTZ E;  4PD4 E;  4YTM C;  1VQL P;  1LP1 B;  2Q5U A;  1IFN A;  4DHI B;  4XE5 B;  1G1J A;  3L75 E;  2Q7C A;  2JJL A;  1ZP0 C;  4IFD K;  2BAS A;  1H8A A;  4QMA A;  3FXE A;  3AEG C;  3HE4 B;  2NPS B;  1AV1 A;  3TNU B;  2FKW B;  2FFD C;  1Y9B A;  2IFM A;  3T97 A;  2V7Q J;  3D71 A;  3CWB D;  1XTC C;  5AVZ B;  1KF6 C;  1S2E A;  3L70 J;  4DJG A;  1W2E A;  3P4P C;  3SWK A;  1UIX A;  2HOD A;  3AE5 C;  4RES B;  2E74 B;  1LTB C;  3G4S P;  2E74 D;  4I6L A;  3G6E P;  1PPJ G;  3H1L D;  4YSY D;  1J1D B;  4EIJ A;  4WY4 A;  1P84 H;  3L71 J;  2GA1 A;  2RH0 A;  2LR2 A;  2MKV A;  2A45 H;  4JQ0 D;  2WDV D;  2D2C D;  3RK3 B;  5B66 H;  1M1J A;  3P8M C;  1N2D C;  1SQP J;  3RK3 D;  1YQ4 D;  5KLI B;  1S3J A;  2HR3 A;  2AXT E;  3AEE D;  3H1H G;  1GMJ A;  3AE7 D;  3L37 A;  3CCU P;  2CK3 H;  1NTK D;  1AJY A;  2I1J A;  3BCC D;  3L71 E;  5AVT B;  3AEA C;  4JBZ A;  3RL0 B;  2E43 A;  3VRB C;  1SVF A;  3RL0 D;  2WSF J;  1SQP E;  3H1I J;  5AVX B;  3V2N A;  1XTG B;  1HGV A;  2W6J H;  1KYO D;  2GUS A;  1JY2 O;  4I1L A;  1MZ9 A;  2XND H;  4Y28 J;  5KKZ B;  3B71 A;  3H1J D;  5AVY B;  1H89 A;  3CCV P;  1FZC A;  1NH4 A;  2KP8 A;  1RH5 B;  1T3U A;  2O01 J;  3AEF C;  1DD3 A;  4WVZ A;  2FYN B;  1YQ3 D;  2HOD B;  2JEE A;  2PAJ A;  3CX5 I;  1NTZ G;  2M3B A;  2AEM A;  3RBX A;  2W27 A;  3EWK A;  4L74 A;  3L75 G;  1IFP A;  4I6M C;  4YSZ D;  2VRS A;  4AYC A;  4BWN A;  1EDI A;  5E79 E;  3RL0 g;  4PJ0 H;  2Q1K A;  1NO4 A;  1GU5 A;  2CPS A;  4WY4 D;  3GHG B;  1HJ0 A;  2Q9I A;  1BE3 G;  1M7L A;  1VQK P;  1L4A C;  4H44 B;  2RMZ A;  1NEK C;  2R3C A;  1L0V D;  2OYH B;  4ASV A;  4H44 D;  3CX5 E;  3A7O A;  1HJB A;  1IFM A;  1JNM A;  5KLV D;  1SQB D;  1UII A;  3BVH A;  4YSX C;  1FBM A;  4YTN C;  1S5L X;  3Q5R A;  1OWA A;  5CCH A;  1QGK B;  2C9N Y;  2IBZ I;  3I55 P;  1JUN A;  1KN7 A;  4YXW H;  2KIK A;  2WSC H;  2HYN A;  3CME P;  3B5N A;  3L70 G;  4N78 E;  1NOH A;  3AE9 D;  1T6A A;  2R3S A;  1MFT A;  2IDB A;  1JEK A;  1GL2 C;  3CC2 P;  4EOT A;  4OVN F;  2YKO A;  1FZC B;  3KXD A;  3MUD A;  2W83 C;  1AA0 A;  3L71 G;  3D6Z A;  5DJU B;  3AE1 D;  4UB6 E;  1YIT P;  1J1E C;  1SQP G;  4M3L A;  3V6I A;  3JCU E;  1WRG A;  1JCD A;  4ZMD A;  1URQ A;  2ZXX A;  3IFM A;  2E74 C;  1FZE A;  5CBO A;  4ZKP A;  2O1J A;  4YSY C;  4DCK A;  1KB9 D;  3EFG A;  1AQT A;  1J1D C;  1NTM K;  3VON A;  4MN4 C;  3L73 D;  5DJT B;  1NU1 K;  4A7P A;  1ZV8 A;  2BCC J;  2WDV C;  2D2C C;  1K73 Q;  5K5G B;  3H1I G;  1ZP0 D;  2Y0D A;  3RK3 C;  1YQ4 C;  1BCC J;  1RE3 C;  2QJK C;  4NPD A;  3AEE C;  2N9B A;  2P58 A;  3PTZ A;  3O8Z A;  4BRY A;  2FFD B;  5KLI C;  3AE7 C;  5CCH D;  5AVW B;  1KV4 A;  3CI9 A;  1P84 I;  2K9Y A;  1DEE G;  1NHL A;  2M5A B;  3M9B A;  5GTI H;  1Y8A A;  3FX0 A;  2BCC E;  2A45 I;  2FYU J;  3A0B H;  3Q2Y A;  3RL0 C;  3B5N D;  1JY3 N;  1VF5 D;  3AE5 D;  1YJ9 P;  1AQ5 A;  5AVR B;  4GKG A;  4IL6 X;  5AW2 B;  1BCC E;  4N6J A;  1ZOY C;  2E5Y A;  1NGM B;  1EQ7 A;  3F89 A;  4YXD C;  1P84 E;  2KSJ A;  3V2Q A;  1JTH B;  3P8C D;  5APT A;  3VP8 A;  2BEZ F;  2KNC A;  1VQ8 P;  1PPJ D;  5APV A;  1NU1 D;  3CCQ P;  2WS3 D;  2J59 M;  1EC5 A;  4W7Z A;  1KIL E;  2WIT A;  1L2P A;  2HPC A;  4EYY Q;  4JF7 A;  1NAY A;  1PP9 D;  1YBK A;  1OZH A;  3S9O A;  2GUV A;  1VQ5 P;  3ABV D;  2P67 A;  2HFE D;  3TDK A;  2ZT9 D;  1HVV A;  3AE4 D;  1RF0 A;  2KYV A;  4WY4 C;  2WMM A;  4HH2 A;  3M9Q A;  3KZI E;  2XDJ A;  3H1H D;  5CJ4 A;  3GHG C;  1L0V C;  2H8P D;  5KJ7 A;  1H0T A;  4H44 C;  1S5L H;  4BXL A;  2H88 D;  1SQX J;  4K3A A;  1QLE D;  2LKM A;  2W8Z A;  1L0N K;  1U7J A;  4I7Z B;  2GM4 A;  1E7P C;  3P32 A;  4R4M A;  1KYO H;  2KI7 B;  3R4Y A;  3H1K D;  3WU2 E;  4ZNC A;  5CCG A;  1KFY C;  1MUU A;  3SFD D;  3L74 J;  4LLH A;  1FDM A;  3Q3D A;  1PFI A;  3FXD A;  1IFD A;  1SQX E;  3W67 A;  1PGO A;  2WPQ A;  2JR8 A;  2N1T A;  2ACZ C;  3OAK A;  1Q90 D;  4LC1 A;  2P10 A;  2JWA A;  4L76 A;  1NTZ D;  4PD4 D;  1X9V A;  1SQQ J;  5KAI H;  2IFN A;  2QJP C;  3CXH E;  4XFJ A;  2KNC B;  1ZRT E;  3OJA B;  1M8O B;  1FZB A;  3L75 D;  3L74 E;  5AW4 B;  1OXZ A;  3Q1M A;  4UB8 E;  1MFZ A;  1FZC C;  3SFE D;  1E79 H;  3MGN A;  1N86 A;  1VDF A;  2WT7 A;  1G1I A;  2BCC G;  2HPC B;  1JY3 P;  3TK1 A;  4W7Y A;  3S4R A;  4YTN D;  2XV5 A;  1G2C A;  1MKM A;  1BCC G;  2OYI B;  2Q6Q A;  1T2K C;  1SQQ E;  3ITK A;  3A3Y B;  3D70 A;  4RKU J;  2QE7 H;  4D6T J;  5TJH A;  1M1K Q;  3NFQ A;  1BE3 J;  3A0H H;  1M57 D;  3VR8 D;  1H0T B;  2BEQ D;  2A45 G;  2FYU G;  3VMZ A;  2PRR A;  1GL2 B;  5KJ7 D;  3V2P A;  1JCC A;  3SWY A;  2KUB A;  4JYC A;  1PV3 A;  3M0D A;  1GL2 D;  5KAF E;  3TGU J;  1RHZ B;  2NRG A;  3HD7 B;  4O9B A;  3MIW A;  1QLB C;  1EDL A;  3M9H A;  1DH3 A;  3HD7 D;  4D6T E;  1GK4 A;  1NTK K;  2KS1 A;  3M06 A;  1IFI A;  1USD A;  1GTW A;  1SS1 A;  1BE3 E;  5CCG D;  3VYI A;  5CCH C;  3CCM P;  3GF3 A;  2Y0C A;  1Z56 A;  2CPB A;  2JO1 A;  5EFW B;  1J1E B;  4IL6 H;  3B5N C;  3AE3 D;  1VF5 C;  2KK7 A;  3L71 D;  1JMM A;  1SQV J;  4OGQ B;  3A2A A;  1Q82 Q;  1LWU A;  4H13 B;  4KJM A;  2C0X A;  2Q3I A;  4OGQ D;  1ZLL A;  2NZ2 A;  4YT0 D;  1MV8 A;  4C7N B;  1VQN P;  1FS0 E;  4H13 D;  1SQP D;  2QIW A;  4GDO A;  1JMB A;  2WT7 B;  3MUD C;  3O6Q B;  2D2C B;  2FXP A;  1KB9 H;  3H6P A;  3L70 E;  2B87 B;  4OH8 B;  1QL2 A;  1SQX G;  2QJK B;  1IO4 A;  1SQV E;  2WS3 C;  1GK6 A;  3E1R A;  1SFC B;  3KQG A;  1BSN A;  1H88 A;  1HUC A;  1AFO A;  1Q2N A;  1N7S A;  1GZL A;  2KOG A;  3PJS K;  1SFC D;  5BVZ A;  3KPE A;  1PGJ A;  1URQ C;  3CCS P;  3ABV C;  2IZ1 A;  1NEN D;  2ZT9 C;  1IC2 A;  1GW3 A;  3AE4 C;  5APY A;  1YIJ P;  2WP9 D;  5APQ A;  3L74 G;  3A0B E;  1OIP A;  3H32 A;  5KLV K;  1SQB K;  1LTA C;  1J2J B;  1R5L A;  2A06 E;  2H88 C;  1ZOY D;  4ZKU A;  5C2T D;  1GW4 A;  2FYZ A;  3CX5 D;  4I7Z C;  4YXD D;  1SQQ G;  5L8R J;  3T97 B;  2YMK A;  4RJT A;  3LW5 H;  5CBN A;  2WSE H;  1EXI A;  4GT1 A;  3SFD C;  3CLQ A;  3QWO C;  1NJI Q;  2FBW C;  1OVR A;  4AQR D;  3P4R D;  3V5B A;  1LTJ A;  2G3A A;  5H2F H;  2HLO A;  1TFF A;  5APX A;  3H1I E;  3P4Q D;  1X0T A;  1KTM A;  3HE5 A;  2KSE A;  1KYO I;  4WY4 B;  2R44 A;  4N78 D;  2P2U A;  1QVF O;  4D6T G;  3MTU E;  1FJP A;  2KB7 P;  2YKQ A;  1LGH B;  1VL2 A;  3BAS A;  1M1J B;  3SFE C;  1JB0 J;  5TIS H;  3L72 J;  1N7S B;  3TGU G;  5APW A;  1WT6 A;  1WMK A;  2K3R A;  2YXR B;  1N7S D;  1LNQ A;  3PHL A;  1QX8 A;  2K9J A;  3L4F A;  2XU6 A;  5GTH H;  2ZXE B;  1KFY D;  2Z4E A;  2OYI C;  1N8R Q;  1K9M Q;  1RF0 C;  1KIL A;  4C46 A;  1S9K E;  1L0L J;  3H32 B;  4PV1 B;  3VR8 C;  3TSI A;  1BGY J;  1EXJ A;  1CW5 A;  3L72 E;  1GDT A;  3WUT A;  4PV1 D;  1ZW0 A;  5KJ7 C;  2ACZ D;  3B4S A;  1SQV G;  4FJV A;  2O01 N;  2C9L Y;  2QJP B;  1VQ7 P;  1JO5 A;  4R4L A;  3HD7 C;  3ZDM A;  3CCR P;  4AUW A;  2IBZ E;  1L0L E;  5CCG C;  1W2B O;  1USE A;  3HTK A;  1BGY E;  1KD1 Q;  1LTI C;  3FWL A;  1CZQ A;  1KQS O;  2KZI A;  3I56 P;  4DDI A;  3AE3 C;  4YPC A;  2A06 G;  5KTB A;  1T2K D;  3V2R A;  3IF4 A;  1Y47 A;  3E7K A;  1ZR4 A;  2BCC D;  1GU4 A;  4H0L D;  3EFF K;  3VRA D;  4LDT A;  4OGQ C;  2E42 A;  4YT0 C;  1DD4 A;  4H13 C;  3R2P A;  4TT3 H;  1OMI A;  1JY2 N;  4HJG H;  3SWF A;  1JOC A;  4JYB A;  5C39 A;  2O1K A;  1M56 D;  3VTP C;  2WWW A;  1P84 D;  1Q86 Q;  3AE6 D;  2WSS H;  1D7M A;  1RE4 C;  2M0B A;  1U57 A;  2BS3 C;  2IYO A;  1SQX K;  1KIL B;  1SFC C;  1NEN C;  1E5W A;  1T8Z A;  1KIL D;  3N7N A;  1FOS F;  3BRT B;  3B5N B;  1KB9 I;  1VF5 B;  2WP9 C;  1AVO A;  2AXT H;  2ZFC A;  2IZ0 A;  2YIU B;  2WDR D;  3P4S D;  3M0D C;  4HYT B;  4TLF A;  3S1K A;  3E1I A;  2O3J A;  5C2T C;  3B8E B;  2OTL P;  2Y9Z A;  2R5D A;  3QH9 A;  1ZME C;  1BSH A;  3HTK B;  2P7J A;  3NMD A;  3CC7 P;  2FYU E;  2FXM A;  2BS2 C;  3M91 A;  1KC8 Q;  5B66 E;  2WU5 D;  3P4R C;  3L72 G;  1URQ B;  1L4A A;  3P4Q C;  1NYH A;  1X22 A;  2QJY C;  4RO0 A;  2ZT9 B;  3BAT A;  1URQ D;  1LWU C;  1NTZ K;  3AE2 D;  3MP7 B;  3PH0 A;  2QA4 P;  1SQX D;  2RN0 A;  1S1C X;  1S72 P;  4HKZ H;  2IBZ G;  2ZFY A;  1ZN5 A;  5APU A;  2Z5I A;  3AEB C;  1L0L G;  4NPF X;  3V4W A;  1BGY G;  2YNY A;  2IYP A;  1NTM J;  1FZF A;  1A02 F;  2B9B A;  1NU1 J;  1RQU A;  3CXH D;  1KFN A;  2V4H A;  4GOD A;  1ZRT D;  1M1J C;  2I1K A;  2AXC A;  3KHU A;  3L74 D;  4BRY B;  2O01 H;  1AVY A;  1RF1 A;  1OW8 A;  1N7S C;  4B86 A;  2JP3 A;  5C3J D;  4DHJ A;  3CX5 H;  3JSV C;  1KQL A;  1BDD A;  3KDP B;  1YTZ I;  1VPC A;  2ZVN B;  1T3J A;  2WPR A;  4U3F J;  2FBW D;  5B5E H;  1LP1 A;  1JY2 P;  1NTM E;  1SQQ D;  3WUV A;  2B89 A;  4PV1 C;  1OFC X;  5BU5 A;  4GOE A;  1A02 J;  1VQ6 P;  2WDQ D;  1LTT C;  2WZ7 A;  4L73 A;  3HE4 A;  2NPS A;  1LJ2 A;  2OGU A;  3TNU A;  1IZN B;  3G9R A;  4PJ0 E;  4KX6 D;  1SQV K;  1EZV I;  1KOR A;  1FAV A;  2R32 A;  4U3F E;  5AW0 B;  1NKN A;  1JM0 A;  3UIA A;  3IR9 A;  2WSC J;  1M90 Q;  1S4X A;  1KFM A;  3VMA A;  4U7J A;  4EDF A;  3IAO A;  4D6T D;  1IFJ A;  3U59 A;  3U1C A;  1BE3 D;  3AED D;  3I5C A;  5AVS B;  1VQP P;  1CI6 A;  1K04 A;  2K37 A;  1SQP K;  2N9Y B;  1EZV E;  2ZYG A;  4H0L C;  3VRA C;  3CMA P;  4Y99 C;  4UB6 H;  3IN6 A;  1YYC A;  3HRN A;  3JCU H;  2WQY D;  1RE3 A;  1DX7 A;  2WU2 D;  4ASW A;  3V4Q A;  3D6Y A;  3CL3 D;  1K8A Q;  1OVU A;  3CD6 P;  3AE6 C;  4WBA A;  1N73 A;  1L0N J;  3L70 D;  1N7L A;  2E75 C;  3GW6 A;  2QM8 A;  3CCL P;  2HG5 D;  1SQV D;  1FDO A;  1KIL C;  1YTZ T;  4Z1M H;  3AE8 D;  1HTL C;  2YO3 A;  3VP9 A;  2N1T B;  3TGU E;  4GOF A;  5AW8 B;  3M0A A;  3RBZ A;  3TYY A;  2N1T D;  2WDR C;  3OW2 O;  2NPS D;  3P4S C;  1L0N E;  2C0W A;  2YIU C;  1PIX A;  1NKZ B;  2YKP A;  2RKL A;  2UWJ E;  2E5T A;  2A06 D;  3OA7 A;  2AEJ A;  1OVV A;  1FU1 A;  2ZYD A;  1NTM G;  3CWB J;  1KQF B;  1NU1 G;  1G2C B;  2I8D A;  2WU5 C;  1CI6 B;  3VR9 D;  2IX7 C;  2E76 C;  3GHG A;  1PP9 G;  1HBW A;  3CCE P;  3MD0 A;  4EI2 A;  3AE2 C;  3H1I D;  2OYH A;  2XKM A;  3H1L J;  3C8V A;  5GTI E;  3L36 A;  4U3F G;  3N4X A;  1KMI Z;  4LGD E;  1IK7 A;  1RY3 A;  3CWB E;  4IFF A;  2L91 A;  5BU8 B;  2PFX A;  1N73 B;  1L0L K;  4DHZ A;  2FY8 A;  2P1J A;  1HWT C;  5AW5 B;  2KS1 B;  3KZI H;  1EDJ A;  1IJD B;  3H1L E;  1EZV G;  5C3J C;  4OWF A;  1YHQ P;  3H1K G;  3Q5P A;  1VQO P;  1NTK J;  3BCC J;  1EDK A;  1PGP A;  2KLU A;  3G3Z A;  2AEF A;  4GIF A;  2QJY B;  1X8Y A;  1LWU B;  2G8Y A;  3RK3 E;  3WU2 H;  1LTG C;  1HH0 A;  1S9K D;  2WDQ C;  3RK2 B;  2H89 D;  3L72 D;  3FWN A;  4KX6 C;  3RK2 D;  4DOJ A;  1NTK E;  3AEB D;  3HUS A;  3BCC E;  2H7H A;  4XA4 A;  3H1J J;  1LT9 A;  3PRJ A;  5AW9 B;  1NVO A;  3Q5S A;  1S5L E;  1QEX A;  2IPP A;  2OTK E;  2XNX A;  2IBZ D;  1JY3 O;  2PP6 A;  1LTS C;  3CXH H;  1L0L D;  3AED C;  4IFM A;  3CC4 P;  1KYO E;  1BGY D;  3RGU A;  1L0N G;  4UB8 H;  1SP4 A;  2J58 A;  3F5H A;  2Y0E A;  3H1J E;  2KXP B;  1RQV A;  5B5E E;  2M8R A;  1TU3 F;  5AVU B;  2WQY C;  1QVG O;  5M1B A;  2WU2 C;  3JC2 2;  1R8E A;  1OW7 A;  2JDI H;  2FFD A;  2FYU K;  5KLV J;  1SQB J;  5AVQ B;  1HF9 A;  5KAI E;  2M5A A;  1RF1 C;  2Z5H A;  3EQ2 A;  3GLM A;  4PD4 H;  2L5G B;  2WTY A;  3C1L A;  4DZO A;  4DDG A;  2QSI A;  2OYO A;  1LTJ B;  5KAF H;  5CJ0 A;  5AW1 B;  2YO2 A;  2J5U A;  3AE8 C;  1PGQ A;  3CWB G;  3CIR D;  3CCJ P;  2WPV B;  3HE5 B;  1Q81 Q;  5KLV E;  1SQB E;  3AEC D;  4H0L B;  2KZJ A;  2N1T C;  4Y99 B;  2NPS C;  2JKV A;  1JTH A;  3HUS B;  4YTP D;  2OQQ A;  3A5T A;  1LT9 B;  2PGD A;  3H1L G;  5CHX A;  3A0H E;  4K35 A;  3WMM 0;  4I2L C;  3SSU A;  4IOI H;  1BCC D;  2FXO A;  3C9I A;  2B88 A;  4JPZ B;  3VMX A;  1W5C E;  1LT1 A;  1IK9 A;  1DEB A;  2K1A A;  2B76 D;  3VOP A;  2E75 B;  2K9J B;  3VR9 C;  3II6 A;  2FYU D;  1VQM P;  2V7Q H;  1FZG A;  2E75 D;  4YTM D;  3GG2 A;  1KZU B;  1PL5 A;  1OW6 A;  1NTK G;  3BCC G;  4IL6 E;  4CPG A;  1BDC A;  1FZA A;  4KHX A;  3AEG D;  2SPZ A;  2OAR A;  1QL1 A;  3BRV B;  3L73 J;  4KT0 J;  3W68 A;  1SLQ A;  1YJN P;  3MHV A;  2QM7 A;  3LIE A;  1FJK A;  4C7R A;  1N73 C;  1KF6 D;  3P4P D;  4DT0 A;  4HB1 A;  2ITA A;  2WPS A;  3GMA A;  3H1J G;  1KB9 E;  3MZW B;  1SQQ K;  3L73 E;  2KLV A;  4WWI A;  2E76 B;  1DIP A;  3NTN A;  2E76 D;  3GF7 A;  3H25 A;  2BS4 C;  1VQ4 P;  1FC2 C;  5KKZ C;  1YJW P;  1NTM D;  2W6A A;  2WSF H;  3LID A;  3NXS A;  1CSB A;  5CMZ A;  2H89 C;  3U1A A;  1YQ3 C;  3RK2 C;  2QEX P;  3LW5 J;  2FYN C;  3G71 P;  1FOS E;  2WSE J;  4L75 A;  1NAF A;  4YSZ C;  4NPE A;  5E79 H;  1ZXG A;  2OYI A; 
#chains in the Genus database with same CATH homology
 3AEA D;  2WDR D;  4OGQ B;  2FBW C;  3P4S D;  2QJP C;  2WDV D;  1TU3 F;  1PL5 A;  2D2C D;  2WQY C;  4XFJ A;  3P4R D;  1ZRT E;  1HJ0 A;  2G3A A;  3VRB D;  4H13 B;  1OW6 A;  5M1B A;  1FDO A;  2WS3 D;  4H44 B;  4OGQ D;  2NZ2 A;  4YT0 D;  3Q1M A;  2E74 C;  2WU2 C;  3P4Q D;  1KIL E;  5C2T C;  1R8E A;  3SFE D;  1NEK C;  1OW7 A;  4PV1 C;  1L0V D;  4Z1M H;  4H13 D;  1YQ4 D;  4H44 D;  2WDQ D;  4YSY C;  2QIW A;  1KTM A;  3AE8 D;  1ZME C;  3AEE D;  5C3J C;  3S9O A;  2B76 C;  4GDO A;  3AEG D;  1GMJ A;  3ABV D;  4KT0 J;  3Q5P A;  3FGA D;  3AE7 D;  2ZT9 D;  2D2C B;  2FXP A;  3G9R A;  4KX6 D;  1HF9 A;  1K05 A;  3AE4 D;  3AE3 C;  4YTN D;  4YSX C;  1AJY A;  2FBW D;  3GLM A;  2BS2 C;  4YTM C;  1KOR A;  4YTN C;  1MKM A;  3AEA C;  2WDR C;  1S5L X;  3P4S C;  3Q5R A;  2WDV C;  2D2C C;  2WU5 D;  3P4R C;  3VRB C;  4H0L D;  3VRA D;  1KF6 D;  2QSI A;  3D70 A;  1ZP0 D;  2YIU C;  4RKU J;  1PIX A;  2G8Y A;  4OGQ C;  2WS3 C;  2WSC J;  4YT0 C;  3P4Q C;  1VL2 A;  1DD4 A;  1ZP0 C;  3P4P D;  2WSF J;  3RK3 E;  3SFE C;  1NYH A;  2QJY C;  1L0V C;  1YQ4 C;  2ZT9 B;  4H13 C;  4U7J A;  1JB0 J;  2J5U A;  1FDI A;  3IAO A;  4H44 C;  2WDQ C;  2QJK C;  3AE8 C;  3AEF D;  4TT3 H;  3AEE C;  3CIR D;  2H88 D;  3GMA A;  1OMI A;  3VR8 D;  2WPV B;  3AE2 D;  3AEG C;  5KLI C;  3AE7 C;  3ABV C;  3AED D;  2BEQ D;  1NEN D;  2H89 D;  4I7Z B;  2ZT9 C;  1WMK A;  4KX6 C;  1S1C X;  3AEC D;  4H0L B;  3AE4 C;  2K9Y A;  3AEB D;  1E7P C;  1K04 A;  3AE9 D;  4R4M A;  1KQF B;  1PV3 A;  3AEB C;  1Y9B A;  3R4Y A;  2E76 B;  3AE9 C;  2V7Q J;  4Y28 J;  3D71 A;  1DIP A;  2WP9 D;  2WU5 C;  3B71 A;  2IDB A;  4YTP D;  3AE6 D;  3VR9 D;  4H0L C;  3VRA C;  3Q2Y A;  1KF6 C;  1KFY D;  2OQQ A;  1QLB C;  2E76 D;  3Q5S A;  3GF7 A;  3H25 A;  1KFY C;  2BS4 C;  3P4P C;  2E76 C;  1VF5 D;  3AE5 D;  3IN6 A;  3SFD D;  1U57 A;  5KKZ C;  1UIX A;  2BS3 C;  1RQU A;  2O01 J;  3AE5 C;  3AEF C;  2E74 B;  1DD3 A;  2WQY D;  3CIR C;  2H88 C;  4IL6 X;  1ZOY D;  4PV1 B;  3Q3D A;  3VR8 C;  3AE2 C;  1YQ3 D;  3AED C;  1ZOY C;  1NEN C;  1EXJ A;  2H89 C;  1YQ3 C;  2E74 D;  2WU2 D;  5C2T D;  1NEK D;  3GF3 A;  4PV1 D;  3AEC C;  1NGM B;  3C8V A;  3D6Z A;  1OW8 A;  2JO1 A;  3LW5 J;  4YSY D;  1KMI Z;  2FYN C;  4I7Z C;  2ACZ D;  3D6Y A;  4YXD D;  2JP3 A;  3EWK A;  5C3J D;  3O6Q A;  1VF5 B;  2WSE J;  1IK7 A;  4YXD C;  2ACZ C;  5L8R J;  2B76 D;  2E75 B;  2WP9 C;  1KQG B;  3AE6 C;  4YTP C;  1Q90 D;  3T97 B;  2YMK A;  3AE1 D;  3VR9 C;  4YSZ D;  3AE1 C;  1RQV A;  2P10 A;  3RL0 g;  4YSZ C;  3AE3 D;  2E75 D;  2BEZ F;  2MKV A;  1VF5 C;  4R4L A;  1EXI A;  4YTM D;  4YSX D;  3SFD C;  2E75 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...