3AEGC

Crystal structure of porcine heart mitochondrial complex ii bound with n-biphenyl-3-yl-2-iodo-benzamide
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of porcine heart mitochondrial complex II bound with N-Biphenyl-3-yl-2-iodo-benzamide
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
total genus 48
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3aegC01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3aegC02
4YTPC 3AE2C 1YQ4D 1KTMA 3AE7D 3AE1D 3VR9C 3AEFC 3SFED 3AE6D 4YSYC 2WDRD 2FBWC 3VRAD 3AEGC 2WQYD 4YTNC 2H89D 5C3JC 3SFDD 3ABVC 1OW7A 1L0VC 4YXDC 2WS3D 3AEDC 1NEKC 3VRBC 2WU2D 4YTPD 2ACZC 3AEAC 1OW6A 3P4PD 3AE8D 1NEND 2WP9C 3SFEC 3AEFD 4KX6D 4YSZC 2WDQD 3AEED 3P4QC 4YTMC 1YQ3D 1ZP0D 3AEBC 3AE5C 2WDVC 3P4RC 4YTND 3AE9D 3S9OA 1L0VD 3B71A 2B76C 3AE4D 2FBWD 3AECD 1ZOYD 3VR8D 3P4SC 3P4PC 4YT0C 3AE6C 3AE7C 2H89C 1YQ4C 3AE2D 1KFYD 2H88D 3VRAC 3CIRD 3VR9D 4YSYD 2G3AA 4YSXD 2BS3C 5C3JD 3AE8C 5C2TD 1NENC 2WDVD 2BS2C 3AEGD 1E7PC 2WU5D 2ACZD 3AEAD 3SFDC 1YQ3C 2H88C 3AECC 3VRBD 3AEBD 3ABVD 3VR8C 1K05A 3AE1C 1KF6D 2WQYC 2WDQC 3AE9C 3AE3D 1OW8A 1ZP0C 2WDRC 3AEEC 1PV3A 4YTMD 3AE5D 2WS3C 4YXDD 2WP9D 4KX6C 4YSZD 3P4RD 3CIRC 1K04A 3P4SD 3P4QD 4YT0D 4YSXC 3AE4C 2B76D 5C2TC 1KF6C 1QLBC 1NEKD 3AEDD 1KFYC 2WU2C 2BS4C 1ZOYC 2WU5C 3AE3C
chains in the Genus database with same CATH superfamily
5GTHH 1URQA 2E42A 3AEFC 3D71A 2W83C 4U3FG 1G2CA 1BGYJ 3BCCE 4I6LA 1SQVD 1GK6A 1CI6B 2N1TD 3KHUA 3B8EB 4YPCA 3GHGA 4YXDC 2WS3D 3VRBC 1EC5A 3L71G 3CMEP 1GD2E 1EXJA 2ZYAA 1IO4A 5APUA 3AE8D 2JDIH 2WP9C 3AEFD 1FOSF 3WUVA 1SQXE 2WDQD 1L4AA 3C1LA 4YTMC 1U7JA 2P2UA 3CCJP 2A45G 3PH0A 4I1LA 4DDGA 1L0LE 1PP9E 2ITAA 2WSEH 1N73B 2B76C 2YMKA 3MP7B 4YT0C 1NJIQ 3A3YB 3CCEP 1H89A 4DZOA 3CCQP 2D2CB 2ZT9C 3WU2H 3CXHI 3RK3C 1PFIA 2L5GB 1L0LJ 2V7QH 4BRYB 2OTJP 2AEMA 1P84H 3AEBD 1P84D 5AW6B 1IFIA 3L36A 2YO2A 2KP8A 2QE7H 5CCGC 3KZIH 2Q6QA 3HE5B 5CJ4A 1HWTC 5AVSB 1EZVE 3HRNA 3GF7A 2ZVNB 3CD6P 2Z4EA 1HGZA 2M5AB 2FYUK 4U3FE 1NTZE 3BRVB 3NTNA 1KQFB 1GU4A 4QMAA 5GTIH 1QLBC 2JWDA 3Q3DA 1L0NG 1PGPA 3K5BA 2W8ZA 2WDRD 5APXA 1JTHA 1YJ9P 3VRAD 3I5CA 2PAJA 1NTMJ 2QM8A 1PPJD 2LR2A 1WRGA 4PJ0H 1FDIA 3D6ZA 2M5AA 2IX7C 5KLIB 3TGUE 2C9LY 3T97A 1YTZI 2JO1A 1OFCX 4L76A 3L70G 2QSIA 3L75D 1LTSC 1LT9C 1UIXA 1PGJA 5APWA 4OGQB 3CI9A 1SQVE 3LW5H 3HUSC 1VQNP 3L73G 1IJDB 1LWUA 3IR9A 4YSYD 2O3JA 4HKZH 4DHJA 1GL2D 1NENC 4NPEA 2O01N 1S5LE 4HJGH 1NTKE 1LWUC 1OX3A 2WPVB 1RY3A 1L0NE 2FFDA 3ABVD 3CWBJ 2YKQA 1Q82Q 1K73Q 1MFZA 1SQQG 1S4XA 2FY8A 5KAIE 1SQBD 1FZCB 1KILA 1GK4A 3V2RA 1NU1D 2B89A 2WVRA 2IPPA 1SQQJ 2IYOA 2OTKE 2E76C 3ZDMA 2WQYD 3CWBG 4U3FD 1S3JA 3MD0A 2FFDC 5AVTB 3P4PD 3KQGA 3RL0C 3SFEC 2E74C 3RK3E 5B5EH 2WSEJ 2YMYA 1QX8A 1IC2A 2FKWB 1KYOE 4RESB 4Y99C 1A02F 3GW6A 4UB6E 3L70J 4Z1MH 1T2KC 1MZ9A 1LJ2A 3EWKA 4TLFA 1DEBA 1E5WA 4D6TD 3H1JG 3D70A 1NTKG 3SFDC 4WY4A 2OQQA 3CLQA 2K37A 1T2KD 1SQPD 3VONA 4BXLA 2QJYB 3CCMP 4ZMDA 2KUBA 3WUUA 3M0DC 4GDOA 2V4HA 4ASWA 4WWIA 1FOSE 4XE5B 1L0NJ 1RE4A 2A06D 1FDMA 3P8CE 2OTLP 4R4MA 5BU8B 1RF1C 3RL0D 2JJLA 3AEDD 3CX5D 1YBKA 3AE3C 1N2DC 3AE2C 2N9YB 1M1JC 4PD4I 4IFDK 4R4LA 2JKVA 1FZBA 1KZUB 2I1JA 5AVXB 2QJYC 4YTNC 3WU2E 3L74D 5C3JC 1JY3O 3F89A 4NPFX 2WU2D 5CCHD 1NWQA 1LTTC 2Q1KA 5APTA 2W6JH 2KIKA 1BE3E 2P7JA 3L74J 3KYQA 3CMAP 3UIAA 1PIXA 4C7NB 2WITA 1W5CE 1TFFA 2ZFCA 4EDFA 4WY4B 2K1AA 1RQUA 1SQXK 5APSA 2RMZA 2H88D 2PRRA 3VRAC 1OMIA 3H1IG 1M1KQ 1J1EB 1IFPA 1ZN5A 1HTLC 3VYIA 3RL0B 2FYUG 5KLVG 3II6A 3RK2B 3AE3D 3U59A 1OW8A 2KNCA 1KYOD 1RE3C 1J1EC 2Q5UA 4YTMD 3V5BA 1M57D 3TYYA 1SQXG 1S2EA 4DJGA 1IFMA 4YSXC 2LKMA 2E43A 4H44B 2HG5D 1KB9I 4UB6H 3L71J 3B5NB 2HFED 1KYOH 3HTKA 1X8YA 1FZEA 3CX5I 2FBWC 1W2EA 1VQ7P 2WZ7A 2O1KA 3Q5PA 4PD4D 4N78E 2A45H 2E5YA 2H89D 1JO5A 1GU5A 3A0HH 2PFXA 1GMJA 3L73J 1T3JA 2OYIA 2OYHA 3CWBD 3L71E 3CC7P 2XNDH 1EXIA 2L91A 2WSCJ 3Q5SA 4NPDA 1YQ3D 2W90A 5CCGA 3AE5C 3M0DA 1M1JB 2WDVC 4KT0J 2KZIA 3BRTB 1Y47A 1RF1B 3C9IA 3L73E 1SVFA 3O6QB 1ZMEC 3WUTA 1LT9B 1EDKA 1EQ7A 2HODB 2B88A 1NH4A 5KLVE 1NAYA 5KLIC 5C3JD 1QVGO 3Q2YA 3H6PA 1NKZB 1CW5A 2ACZD 2R5DA 3LIEA 2BEQD 3V6IA 4IFMA 3MTUE 5TISH 1BSNA 3A0BH 4D6TG 2IBZD 1VQKP 4DT0A 1T8ZA 3QWOC 5C39A 1FZCA 2YKOA 3G9RA 3U1CA 1KC8Q 4WB4A 5AW5B 1P84E 5CCHC 4GKGA 2NPSA 1M56D 4Y99B 1J1DB 2E5TA 1QLED 5KJ7D 1YQ4D 3L70D 5AW0B 3AE7D 2E74B 3RBZA 1D7MA 1AQTA 3SSUA 1EZVG 3E1RA 2KS1B 1JY2N 1GDTA 4PV1C 2HODA 3Q1MA 1RE3A 3FXDA 1OW6A 4W80A 4IL6E 2O01H 2E76B 2M3EA 2O01J 2DW3A 3W67A 3L72J 3BVHA 2ZT9B 3L37A 3HD7D 4LDTA 2P67A 2K3RA 4W7YA 3H1JE 1KORA 2Y9YA 3IFMA 2KSEA 2IZ0A 3G71P 3HE4A 5GTHE 1P84I 5AVQB 4DCKA 1VQLP 1DIPA 1FU1A 3CL3D 3H1KD 1NU1E 5KKZB 1LWUB 5TISE 5KLVJ 3FXEA 2FYUD 1N7SD 1N7SA 2KS1A 2XNXA 3L74G 1M90Q 1URQD 5H2FE 3VN0A 1R8EA 1H88A 1YHQP 4YT0D 4ZKPA 1FS0E 5APVA 4OGQC 1NEKD 2AXCA 4OH8B 1GTWA 5AVYB 3OJAB 1YTZT 1RHZB 1BCCG 4UB8H 3MHVA 4AUWA 2C0XA 1YI2P 3KDPB 3MZWB 4IFFA 3L4FA 1KQSO 2Y0DA 1PP9G 3CXHE 3G6EP 2WSFH 1NGMB 3I55P 3PHLA 1ZR2A 4DHIB 3H1JD 4L74A 1NEND 2XKMA 1NTZJ 5KTBA 2Y9ZA 1JB0J 3S1KA 1HJBA 2QG4A 1MV8A 1BCCD 1LT9A 3AE4D 3CCUP 1MKMA 3I56P 3GMAA 1PGOA 2KLUA 1N7SB 1KFYD 1URQB 2A06G 1OVRA 1SQQK 1QGKB 5B66H 2BS3C 1Y9BA 2POHA 2P58A 1VF5D 1YQ3C 4C46A 3L70E 5CMZA 2BASA 2QJKB 2WSSH 1U57A 3R2PA 5APYA 2D2CC 3AE5D 3OA7A 4CPGA 2QIWA 1BGYG 1DEEG 3HTKB 4GIFA 2Q7CA 2R3SA 2N1TA 2YKPA 3G3ZA 1SFCC 1N73C 2WU5C 5AW9B 1WMKA 2QEXP 1OIPA 3GHGB 3L74E 5BU5A 2WPSA 2AXTH 3VP9A 3MUDA 2IFNA 2XV5A 1NO4A 1NHLA 1DD4A 1XTGB 1NOHA 1M8OB 3CX5E 3VMXA 2WMMA 2OYOA 5AW8B 3P4QC 1URQC 4RO0A 1USEA 1N7SC 2K9JA 2IBZG 4H13D 3H1IJ 2HPCA 3ITKA 2M0BA 3D6YA 3CCLP 2YIUC 2KYVA 1SQPJ 5TJHA 5KJ7C 2E75B 3L75G 1EDLA 4JPZB 2XDJA 4OGQD 4OVNF 3CIRD 1SQBK 2H8PD 1W2BO 2WDVD 1FJKA 1K05A 1IZNB 2BCCD 1LTGC 1R5LA 4ZKUA 3AEEC 1GW4A 3H32B 2B9BA 3O6QA 4N6JA 3TNUB 2KB7P 5KAFE 2Q9IA 2P1JA 1L0ND 3B4SA 1BSHA 1Q81Q 1KF6C 2YIUB 1GW3A 1Z56A 5KJ7A 4DOJA 1NTKJ 3AE1D 1SQQE 3JCUE 3LIDA 3VR9C 3L72G 3TNUA 3M91A 3HE5A 5KKZC 1VQ6P 3HUSA 1OWAA 4YTPD 4JYCA 3G4SP 2AEFA 2ZT9D 1XTCC 2MJZA 3FWNA 3V4QA 4TT3H 3GHGC 3EFFK 1JOCA 1SFCB 4WVZA 3LW5J 3AE7C 1NU1J 1NTME 4KJMA 2RKLA 5AW3B 2N9BA 2C9NY 3WMM0 1Q90D 2G3AA 1JMMA 2FXOA 2QJKC 2AXTE 2WU5D 3CXHH 4O9BA 3A5TA 3H1ID 3HD7A 3MUDC 2GM4A 2GA1A 4PV1B 1HGVA 3L72E 4I7ZB 1VL2A 1LTJB 1SQVJ 4H44D 4KX6C 4YSZD 3BCCG 1K8AQ 3E7KA 3B5ND 5AVWB 2H88C 4AYCA 4C7NA 4MN4C 2NRGA 2AEJA 3T97B 3L35A 1OZHA 4PD4H 2LXCB 1L0LK 1SLQA 2NPSB 3AEGC 1HH0A 1S5LH 2HYNA 2KOGA 1JY3N 1VQPP 3QH9A 1H0TA 3L71D 2V7QJ 3NXSA 3W68A 3AEED 1QEXA 3H1KG 3AEBC 1LP1B 3TK1A 2FYNC 4DDIA 2FYUJ 3V4WA 1J2JB 1OXZA 3AECD 3TF5A 2WT7B 4LGDE 5AW4B 3PTZA 3P4PC 2R3CA 5AW2B 3PLNA 2WPRA 5AVRB 5GTIE 3RGUA 1BDCA 5K5GB 3V2QA 5CJ0A 4YSXD 2E76D 3H1KJ 4JF7A 1SQPG 4H0LC 1NTMD 3VOPA 2R44A 1ZR4A 3BCCJ 1KD1Q 1YJWP 5E79H 4JBZA 2WDQC 3A7OA 2IYPA 3M06A 1PP9D 2K9YA 2YO3A 2JWAA 5H2FH 1IFDA 2WS3C 4YXDD 2M3BA 1DX7A 3AE4C 4I6MC 1N8RQ 3TDKA 4RJTA 1JY2P 3H1KE 4GT1A 3GLMA 4GOFA 1L2PA 5AVZB 1FJPA 2OARA 1M1JA 2VRSA 3TSIA 1EZVD 2ACZC 5CCGD 1Y8AA 1RF1A 1G2CB 2CPBA 1X22A 3RBXA 1GL2B 1JMBA 2IBZE 4K35A 4OWFA 4XFJA 5L8RJ 1L0NK 3H1IE 4GODA 3S9OA 1J1DC 1KV4A 4IL6H 3V2PA 1R5SA 3CPWO 4WY4C 3VP8A 4HYTB 1Q86Q 2H89C 3PJSK 1SFCA 2KK7A 2KZJA 4L73A 1KB9H 1AA0A 4B86A 1VF5B 2O1JA 1KILC 3L73D 1JCDA 2GUVA 4EI2A 1RH5B 1ZRTD 1VPCA 1OVUA 4H13C 2I8DA 1X0TA 1ZP0C 1SQXD 4M3LA 1S1CX 1VQ9P 5APQA 1CI6A 1ZV8A 4DHZA 1OVVA 1SQPE 4C7RA 3CCVP 2WSCH 1GZLA 3CC4P 4U3FJ 3P4SD 2KXPB 2OYIB 2OYHB 2W6AA 2OYIC 4EYYQ 2OYHC 2ZXEB 5CBNA 1HBWA 1HF9A 1JEKA 1HVVA 1SQVG 3OW2O 4Y28J 2Z5IA 3CCSP 3AE6D 2IDBA 2ZYGA 3H32A 2E74D 2FYZA 2IFMA 2ZXXA 1N73A 3OAKA 3H1HE 3P8MC 3Q5RA 1NTZG 1L0VC 2IZ1A 3IAOA 3KXDA 3AEDC 3M9BA 4D6TJ 1IFJA 2MKVA 1S5LX 2H43A 1SQBG 2QVAA 1YJNP 4KX6D 4YSZC 2YNYA 1N7LA 2HR3A 1MUUA 1VF5C 3B5NC 1FBMA 1AVYA 3GF3A 4AQRD 4YTND 3H1HG 1L0VD 4H44C 2FBWD 3NFQA 3N4XA 3O8ZA 2KNCB 3NMDA 3C8VA 2ZFYA 2KLVA 1KYOI 2FFDB 3RK2C 3U1AA 1SQBE 4JQ0D 1JY2O 2G8YA 1BGYE 1G1JA 2ZYDA 2QM7A 2FYUE 2SPZA 5KAFH 1BE3D 2R32A 5EFWB 3PP5A 2WPQA 1RF0A 4WY4D 1S9KE 3TGUJ 1NYHA 1UIIA 5C2TC 3TGUG 1SQXJ 1KB9E 1T3UA 1KFYC 1VQ4P 2NZ2A 2FXMA 4WBAA 1KILD 1T6AA 1PPJG 1PP9J 3SFDD 1OW7A 2P10A 1FZGA 1EDIA 1NAFA 2W27A 4HB1A 4JYBA 3TGUD 2W6BA 4I2LC 5BVZA 1IFNA 1PGQA 4BWNA 4IL6X 2I1KA 2D2CD 3B71A 3RK2D 2YXQB 1VQ8P 1JNMA 3CX5H 3P4SC 3VTPC 4IOIH 3S4RA 3H1HJ 1DH3A 1JUNA 1BCCJ 2JEEA 1NTKK 1FC2C 2BEZF 1LTJA 1NTKD 1QVFO 5M1BA 2E75D 3VMAA 1LTBC 2WT7A 1NTMK 4H13B 1KF6D 2B87A 1LP1A 3SWYA 3MIWA 2WQYC 1DD3A 5E79E 1KILB 1AJYA 3FWLA 3BATA 4FJVA 2BCCG 1L0LG 1JTHB 1KQGB 1PL5A 5AW1B 3P4RD 1K04A 5AVUB 3P4QD 3MGNA 5DJTB 3B5NA 5KAIH 4K3AA 3M9QA 1PPJE 2BS4C 3P7KA 1Q2NA 4YTPC 1IK9A 1GL2A 1NU1K 3M9HA 3M0AA 5KLVD 1GL2C 3H1LE 1LGHB 2RN0A 3H1LD 5B66E 4I7ZC 5CHXA 3VMZA 3F5HA 2C0WA 3ABVC 1L0LD 1YYCA 1KFNA 1CSBA 2J59M 2R5BA 3E1IA 5KLVK 1SS1A 1YIJP 1NTZD 1BCCE 1RF0C 3CWBE 3RK3D 1SQVK 3GG2A 1ZP0D 1AV1A 3P4RC 2ZVOB 4PD4E 1ZOYD 4BRYA 1FZCC 1IK7A 1AFOA 2NPSD 3AE6C 1KQLA 3FX0A 1YQ4C 1BDDA 3FGAD 1CZQA 3H1JJ 4PJ0E 3VR9D 2J5UA 3IF4A 5C2TD 1JM0A 1MFTA 2JP3A 1E7PC 4RKUJ 4N3YB 3AECC 1WT6A 2Q3EA 3CC2P 3AE1C 1H8AA 4H0LB 1EDJA 1E79H 2UWJE 1FZFA 3USSA 2WDRC 1NTZK 2PGDA 1VQOP 2QA4P 1G1IA 2BCCE 3EQ2A 2WP9D 1FAVA 1BE3J 1FDOA 3RL0g 3HUSB 1BE3G 2Q3IA 3L75J 3KZIE 2FYNB 1KTMA 3VMYA 1YITP 4N78D 3HD7B 5AVVB 2FXPA 3SFED 4YSYC 1K9MQ 2KSJA 5CBOA 1SQQD 2GUSA 2XU6A 1NEKC 3AEAC 2NPSC 1N86A 3SWFA 1VQMP 1AVOA 4GOEA 1FZAA 1LTAC 2QJPB 3L75E 3CCRP 3EFGA 4HH2A 3JCUH 2Y0CA 4H0LD 4YXWH 4ZNCA 3VR8D 2QRXA 4A7PA 3JSVC 1JCCA 3P32A 1X9VA 3H25A 3V2NA 1AQ5A 3AE8C 1LTJC 2BS2C 3SWKA 1X79B 1H0TB 3P8CD 1S72P 2JR8A 2A06E 1LT1A 3VRBD 3VR8C 2BCCJ 2N1TC 1QL2A 3AE9C 3HE4B 1VQ5P 1RQVA 1NTMG 1KFMA 2HLOA 1TU3F 2WWWA 3RK3B 1QL1A 2J58A 2LXBA 3CIRC 5AW7B 2ZJSE 3L72D 1ZOYC 1USDA 3A0BE 3BCCD 1ZLLA 1HUCA 2CPSA 2H7HA 2PP6A 3KPEA 2M8RA 3H1HD 1KMIZ 1SQBJ 2OGUA 2XZRA 1EZVI 1FE6A 1L4AD 3N7NA 1KB9D 2A45I 4U7JA 2HPCB 2N1TB 2K9JB 4EIJA 1HJ0A 5B5EE 1RE4C 3H1LG 5CCHA 3A2AA 2RH0A 1NU1G 5DJUB 2CK3H 2Z5HA 3AE9D 1KN7A 3CXHD 1VDFA 1SFCD 3H1LJ 3A0HE 4KHXA 1ZW0A 4UB8E 3AE2D 1LTIC 1ZRTE 4D6TE 1KILE 3PRJA 1NVOA 4LC1A 2B87B 2QJPC 1L4AB 3AEGD 1A02J 2ZAEB 3AEAD 3IN6A 1SP4A 4ASVA 1LNQA 4L75A 4W7ZA 4EOTA 1PZQA 4LLHA 1NKNA 2WTYA 4PV1D 1M7LA 3JC22 1Q7YQ 1L4AC 1S9KD 3BASA 1JY3P 1PV3A 2K88A 2YXRB 2IBZI 3HD7C 2KI7B 3R4YA 2Y0EA 2E75C 2B76D 2WSFJ 1ZXGA 4XA4A 1SQPK 1U7MA 2WU2C 1BGYD
chains in the Genus database with same CATH topology
3Q3DA 4YTPC 3AE2C 1YQ4D 1KTMA 3AE7D 4H44B 2E74B 4Y28J 3GLMA 3AE1D 3T97B 2FXPA 1KMIZ 2NZ2A 3VR9C 3AEFC 3SFED 4R4LA 3D71A 3AE6D 4YSYC 2IDBA 2WDRD 2FBWC 3VRAD 2E76C 4I7ZC 2E74D 2QJYC 3AEGC 5KKZC 3Q5PA 2WQYD 4YTNC 4U7JA 2H89D 3Q5RA 4PV1C 5C3JC 3SFDD 3ABVC 1OW7A 1L0VC 3IAOA 4YXDC 3AEDC 1NEKC 1HJ0A 2P10A 3Q1MA 2WS3D 2WU2D 3VRBC 4YXDD 2MKVA 1DD4A 1S5LX 4YTPD 1GMJA 2ACZC 1EXJA 3AEAC 1NGMB 1OW6A 3P4PD 1FDIA 2E76B 3AE8D 3D6ZA 1NEND 1EXIA 3SFEC 2WP9C 3AEFD 4KX6D 4YSZC 2O01J 2ZT9D 2V7QJ 1HF9A 2WSCJ 1JB0J 2WDQD 3Q5SA 3AEED 3P4QC 1VF5C 4YTMC 2JO1A 1YQ3D 1PIXA 1ZP0D 2ZT9B 2QSIA 4TT3H 3AEBC 2E74C 3RK3E 3AE5C 3GF3A 4XFJA 2WSEJ 2WDVC 1UIXA 4H13D 2FYNC 5L8RJ 3P4RC 4KT0J 4IL6X 4YTND 3AE9D 3S9OA 1KORA 1L0VD 4H44C 3D6YA 2D2CD 2YIUC 3B71A 4OGQB 4H0LD 2B76C 1RQUA 2FBWD 3AECD 3AE4D 2YMKA 1ZOYD 4Z1MH 3VR8D 2E75B 1IK7A 3LW5J 3P4SC 3P4PC 1MKMA 3AE6C 3AE7C 1ZMEC 4YT0C 2H89C 3GMAA 1YQ4C 3AE2D 3EWKA 3H25A 3FGAD 2D2CB 4OGQD 1ZRTE 2ZT9C 1KFYD 2H88D 3VRAC 3CIRD 1VF5B 1OMIA 2BEZF 3VR9D 4YSYD 1Q90D 1KILE 2G3AA 5M1BA 4YSXD 2E75D 2J5UA 1Y9BA 2QJPC 2BS3C 5KLIC 5C3JD 3AE8C 5C2TD 2E76D 1NENC 3Q2YA 2WDVD 2JP3A 2QJKC 2BS2C 1E7PC 3AEGD 3C8VA 2WPVB 4RKUJ 2WU5D 2ACZD 3D70A 3AEAD 1VF5D 3IN6A 3SFDC 1YQ3C 4H13B 4H0LC 1DIPA 2BEQD 3AECC 3VRBD 2OQQA 3AEBD 3ABVD 3VR8C 1K05A 3AE1C 2G8YA 4PV1B 4H0LB 4H13C 1KF6D 2WQYC 1DD3A 2WDQC 3AE9C 3AE3D 4PV1D 4I7ZB 1OW8A 1ZP0C 1KFYC 1RQVA 1VL2A 2WDRC 1S1CX 1AJYA 2K9YA 1U57A 3AEEC 4GDOA 1PV3A 1TU3F 4YTMD 3G9RA 3O6QA 4H44D 2D2CC 3AE5D 2WS3C 1KQGB 1R8EA 2WP9D 1PL5A 2QIWA 4KX6C 3P4RD 3CIRC 4YSZD 3GF7A 1K04A 1FDOA 3RL0g 3P4SD 3P4QD 3R4YA 4YT0D 4YSXC 3AE4C 2E75C 2B76D 1NYHA 2WSFJ 4R4MA 5C2TC 1KQFB 1KF6C 1QLBC 4OGQC 1NEKD 3AEDD 2H88C 2WU2C 2BS4C 1ZOYC 2WU5C 3AE3C 1WMKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YTP C;  3AE2 C;  1YQ4 D;  1KTM A;  3AE7 D;  3AE1 D;  3VR9 C;  3AEF C;  3SFE D;  3AE6 D;  4YSY C;  2WDR D;  2FBW C;  3VRA D;  3AEG C;  2WQY D;  4YTN C;  2H89 D;  5C3J C;  3SFD D;  3ABV C;  1OW7 A;  1L0V C;  4YXD C;  2WS3 D;  3AED C;  1NEK C;  3VRB C;  2WU2 D;  4YTP D;  2ACZ C;  3AEA C;  1OW6 A;  3P4P D;  3AE8 D;  1NEN D;  2WP9 C;  3SFE C;  3AEF D;  4KX6 D;  4YSZ C;  2WDQ D;  3AEE D;  3P4Q C;  4YTM C;  1YQ3 D;  1ZP0 D;  3AEB C;  3AE5 C;  2WDV C;  3P4R C;  4YTN D;  3AE9 D;  3S9O A;  1L0V D;  3B71 A;  2B76 C;  3AE4 D;  2FBW D;  3AEC D;  1ZOY D;  3VR8 D;  3P4S C;  3P4P C;  4YT0 C;  3AE6 C;  3AE7 C;  2H89 C;  1YQ4 C;  3AE2 D;  1KFY D;  2H88 D;  3VRA C;  3CIR D;  3VR9 D;  4YSY D;  2G3A A;  4YSX D;  2BS3 C;  5C3J D;  3AE8 C;  5C2T D;  1NEN C;  2WDV D;  2BS2 C;  3AEG D;  1E7P C;  2WU5 D;  2ACZ D;  3AEA D;  3SFD C;  1YQ3 C;  2H88 C;  3AEC C;  3VRB D;  3AEB D;  3ABV D;  3VR8 C;  1K05 A;  3AE1 C;  1KF6 D;  2WQY C;  2WDQ C;  3AE9 C;  3AE3 D;  1OW8 A;  1ZP0 C;  2WDR C;  3AEE C;  1PV3 A;  4YTM D;  3AE5 D;  2WS3 C;  4YXD D;  2WP9 D;  4KX6 C;  4YSZ D;  3P4R D;  3CIR C;  1K04 A;  3P4S D;  3P4Q D;  4YT0 D;  4YSX C;  3AE4 C;  2B76 D;  5C2T C;  1KF6 C;  1QLB C;  1NEK D;  3AED D;  1KFY C;  2WU2 C;  2BS4 C;  1ZOY C;  2WU5 C;  3AE3 C; 
#chains in the Genus database with same CATH topology
 5GTH H;  1URQ A;  2E42 A;  3AEF C;  3D71 A;  2W83 C;  4U3F G;  1G2C A;  1BGY J;  3BCC E;  4I6L A;  1SQV D;  1GK6 A;  1CI6 B;  2N1T D;  3KHU A;  3B8E B;  4YPC A;  3GHG A;  4YXD C;  2WS3 D;  3VRB C;  1EC5 A;  3L71 G;  3CME P;  1GD2 E;  1EXJ A;  2ZYA A;  1IO4 A;  5APU A;  3AE8 D;  2JDI H;  2WP9 C;  3AEF D;  1FOS F;  3WUV A;  1SQX E;  2WDQ D;  1L4A A;  3C1L A;  4YTM C;  1U7J A;  2P2U A;  3CCJ P;  2A45 G;  3PH0 A;  4I1L A;  4DDG A;  1L0L E;  1PP9 E;  2ITA A;  2WSE H;  1N73 B;  2B76 C;  2YMK A;  3MP7 B;  4YT0 C;  1NJI Q;  3A3Y B;  3CCE P;  1H89 A;  4DZO A;  3CCQ P;  2D2C B;  2ZT9 C;  3WU2 H;  3CXH I;  3RK3 C;  1PFI A;  2L5G B;  1L0L J;  2V7Q H;  4BRY B;  2OTJ P;  2AEM A;  1P84 H;  3AEB D;  1P84 D;  5AW6 B;  1IFI A;  3L36 A;  2YO2 A;  2KP8 A;  2QE7 H;  5CCG C;  3KZI H;  2Q6Q A;  3HE5 B;  5CJ4 A;  1HWT C;  5AVS B;  1EZV E;  3HRN A;  3GF7 A;  2ZVN B;  3CD6 P;  2Z4E A;  1HGZ A;  2M5A B;  2FYU K;  4U3F E;  1NTZ E;  3BRV B;  3NTN A;  1KQF B;  1GU4 A;  4QMA A;  5GTI H;  1QLB C;  2JWD A;  3Q3D A;  1L0N G;  1PGP A;  3K5B A;  2W8Z A;  2WDR D;  5APX A;  1JTH A;  1YJ9 P;  3VRA D;  3I5C A;  2PAJ A;  1NTM J;  2QM8 A;  1PPJ D;  2LR2 A;  1WRG A;  4PJ0 H;  1FDI A;  3D6Z A;  2M5A A;  2IX7 C;  5KLI B;  3TGU E;  2C9L Y;  3T97 A;  1YTZ I;  2JO1 A;  1OFC X;  4L76 A;  3L70 G;  2QSI A;  3L75 D;  1LTS C;  1LT9 C;  1UIX A;  1PGJ A;  5APW A;  4OGQ B;  3CI9 A;  1SQV E;  3LW5 H;  3HUS C;  1VQN P;  3L73 G;  1IJD B;  1LWU A;  3IR9 A;  4YSY D;  2O3J A;  4HKZ H;  4DHJ A;  1GL2 D;  1NEN C;  4NPE A;  2O01 N;  1S5L E;  4HJG H;  1NTK E;  1LWU C;  1OX3 A;  2WPV B;  1RY3 A;  1L0N E;  2FFD A;  3ABV D;  3CWB J;  2YKQ A;  1Q82 Q;  1K73 Q;  1MFZ A;  1SQQ G;  1S4X A;  2FY8 A;  5KAI E;  1SQB D;  1FZC B;  1KIL A;  1GK4 A;  3V2R A;  1NU1 D;  2B89 A;  2WVR A;  2IPP A;  1SQQ J;  2IYO A;  2OTK E;  2E76 C;  3ZDM A;  2WQY D;  3CWB G;  4U3F D;  1S3J A;  3MD0 A;  2FFD C;  5AVT B;  3P4P D;  3KQG A;  3RL0 C;  3SFE C;  2E74 C;  3RK3 E;  5B5E H;  2WSE J;  2YMY A;  1QX8 A;  1IC2 A;  2FKW B;  1KYO E;  4RES B;  4Y99 C;  1A02 F;  3GW6 A;  4UB6 E;  3L70 J;  4Z1M H;  1T2K C;  1MZ9 A;  1LJ2 A;  3EWK A;  4TLF A;  1DEB A;  1E5W A;  4D6T D;  3H1J G;  3D70 A;  1NTK G;  3SFD C;  4WY4 A;  2OQQ A;  3CLQ A;  2K37 A;  1T2K D;  1SQP D;  3VON A;  4BXL A;  2QJY B;  3CCM P;  4ZMD A;  2KUB A;  3WUU A;  3M0D C;  4GDO A;  2V4H A;  4ASW A;  4WWI A;  1FOS E;  4XE5 B;  1L0N J;  1RE4 A;  2A06 D;  1FDM A;  3P8C E;  2OTL P;  4R4M A;  5BU8 B;  1RF1 C;  3RL0 D;  2JJL A;  3AED D;  3CX5 D;  1YBK A;  3AE3 C;  1N2D C;  3AE2 C;  2N9Y B;  1M1J C;  4PD4 I;  4IFD K;  4R4L A;  2JKV A;  1FZB A;  1KZU B;  2I1J A;  5AVX B;  2QJY C;  4YTN C;  3WU2 E;  3L74 D;  5C3J C;  1JY3 O;  3F89 A;  4NPF X;  2WU2 D;  5CCH D;  1NWQ A;  1LTT C;  2Q1K A;  5APT A;  2W6J H;  2KIK A;  1BE3 E;  2P7J A;  3L74 J;  3KYQ A;  3CMA P;  3UIA A;  1PIX A;  4C7N B;  2WIT A;  1W5C E;  1TFF A;  2ZFC A;  4EDF A;  4WY4 B;  2K1A A;  1RQU A;  1SQX K;  5APS A;  2RMZ A;  2H88 D;  2PRR A;  3VRA C;  1OMI A;  3H1I G;  1M1K Q;  1J1E B;  1IFP A;  1ZN5 A;  1HTL C;  3VYI A;  3RL0 B;  2FYU G;  5KLV G;  3II6 A;  3RK2 B;  3AE3 D;  3U59 A;  1OW8 A;  2KNC A;  1KYO D;  1RE3 C;  1J1E C;  2Q5U A;  4YTM D;  3V5B A;  1M57 D;  3TYY A;  1SQX G;  1S2E A;  4DJG A;  1IFM A;  4YSX C;  2LKM A;  2E43 A;  4H44 B;  2HG5 D;  1KB9 I;  4UB6 H;  3L71 J;  3B5N B;  2HFE D;  1KYO H;  3HTK A;  1X8Y A;  1FZE A;  3CX5 I;  2FBW C;  1W2E A;  1VQ7 P;  2WZ7 A;  2O1K A;  3Q5P A;  4PD4 D;  4N78 E;  2A45 H;  2E5Y A;  2H89 D;  1JO5 A;  1GU5 A;  3A0H H;  2PFX A;  1GMJ A;  3L73 J;  1T3J A;  2OYI A;  2OYH A;  3CWB D;  3L71 E;  3CC7 P;  2XND H;  1EXI A;  2L91 A;  2WSC J;  3Q5S A;  4NPD A;  1YQ3 D;  2W90 A;  5CCG A;  3AE5 C;  3M0D A;  1M1J B;  2WDV C;  4KT0 J;  2KZI A;  3BRT B;  1Y47 A;  1RF1 B;  3C9I A;  3L73 E;  1SVF A;  3O6Q B;  1ZME C;  3WUT A;  1LT9 B;  1EDK A;  1EQ7 A;  2HOD B;  2B88 A;  1NH4 A;  5KLV E;  1NAY A;  5KLI C;  5C3J D;  1QVG O;  3Q2Y A;  3H6P A;  1NKZ B;  1CW5 A;  2ACZ D;  2R5D A;  3LIE A;  2BEQ D;  3V6I A;  4IFM A;  3MTU E;  5TIS H;  1BSN A;  3A0B H;  4D6T G;  2IBZ D;  1VQK P;  4DT0 A;  1T8Z A;  3QWO C;  5C39 A;  1FZC A;  2YKO A;  3G9R A;  3U1C A;  1KC8 Q;  4WB4 A;  5AW5 B;  1P84 E;  5CCH C;  4GKG A;  2NPS A;  1M56 D;  4Y99 B;  1J1D B;  2E5T A;  1QLE D;  5KJ7 D;  1YQ4 D;  3L70 D;  5AW0 B;  3AE7 D;  2E74 B;  3RBZ A;  1D7M A;  1AQT A;  3SSU A;  1EZV G;  3E1R A;  2KS1 B;  1JY2 N;  1GDT A;  4PV1 C;  2HOD A;  3Q1M A;  1RE3 A;  3FXD A;  1OW6 A;  4W80 A;  4IL6 E;  2O01 H;  2E76 B;  2M3E A;  2O01 J;  2DW3 A;  3W67 A;  3L72 J;  3BVH A;  2ZT9 B;  3L37 A;  3HD7 D;  4LDT A;  2P67 A;  2K3R A;  4W7Y A;  3H1J E;  1KOR A;  2Y9Y A;  3IFM A;  2KSE A;  2IZ0 A;  3G71 P;  3HE4 A;  5GTH E;  1P84 I;  5AVQ B;  4DCK A;  1VQL P;  1DIP A;  1FU1 A;  3CL3 D;  3H1K D;  1NU1 E;  5KKZ B;  1LWU B;  5TIS E;  5KLV J;  3FXE A;  2FYU D;  1N7S D;  1N7S A;  2KS1 A;  2XNX A;  3L74 G;  1M90 Q;  1URQ D;  5H2F E;  3VN0 A;  1R8E A;  1H88 A;  1YHQ P;  4YT0 D;  4ZKP A;  1FS0 E;  5APV A;  4OGQ C;  1NEK D;  2AXC A;  4OH8 B;  1GTW A;  5AVY B;  3OJA B;  1YTZ T;  1RHZ B;  1BCC G;  4UB8 H;  3MHV A;  4AUW A;  2C0X A;  1YI2 P;  3KDP B;  3MZW B;  4IFF A;  3L4F A;  1KQS O;  2Y0D A;  1PP9 G;  3CXH E;  3G6E P;  2WSF H;  1NGM B;  3I55 P;  3PHL A;  1ZR2 A;  4DHI B;  3H1J D;  4L74 A;  1NEN D;  2XKM A;  1NTZ J;  5KTB A;  2Y9Z A;  1JB0 J;  3S1K A;  1HJB A;  2QG4 A;  1MV8 A;  1BCC D;  1LT9 A;  3AE4 D;  3CCU P;  1MKM A;  3I56 P;  3GMA A;  1PGO A;  2KLU A;  1N7S B;  1KFY D;  1URQ B;  2A06 G;  1OVR A;  1SQQ K;  1QGK B;  5B66 H;  2BS3 C;  1Y9B A;  2POH A;  2P58 A;  1VF5 D;  1YQ3 C;  4C46 A;  3L70 E;  5CMZ A;  2BAS A;  2QJK B;  2WSS H;  1U57 A;  3R2P A;  5APY A;  2D2C C;  3AE5 D;  3OA7 A;  4CPG A;  2QIW A;  1BGY G;  1DEE G;  3HTK B;  4GIF A;  2Q7C A;  2R3S A;  2N1T A;  2YKP A;  3G3Z A;  1SFC C;  1N73 C;  2WU5 C;  5AW9 B;  1WMK A;  2QEX P;  1OIP A;  3GHG B;  3L74 E;  5BU5 A;  2WPS A;  2AXT H;  3VP9 A;  3MUD A;  2IFN A;  2XV5 A;  1NO4 A;  1NHL A;  1DD4 A;  1XTG B;  1NOH A;  1M8O B;  3CX5 E;  3VMX A;  2WMM A;  2OYO A;  5AW8 B;  3P4Q C;  1URQ C;  4RO0 A;  1USE A;  1N7S C;  2K9J A;  2IBZ G;  4H13 D;  3H1I J;  2HPC A;  3ITK A;  2M0B A;  3D6Y A;  3CCL P;  2YIU C;  2KYV A;  1SQP J;  5TJH A;  5KJ7 C;  2E75 B;  3L75 G;  1EDL A;  4JPZ B;  2XDJ A;  4OGQ D;  4OVN F;  3CIR D;  1SQB K;  2H8P D;  1W2B O;  2WDV D;  1FJK A;  1K05 A;  1IZN B;  2BCC D;  1LTG C;  1R5L A;  4ZKU A;  3AEE C;  1GW4 A;  3H32 B;  2B9B A;  3O6Q A;  4N6J A;  3TNU B;  2KB7 P;  5KAF E;  2Q9I A;  2P1J A;  1L0N D;  3B4S A;  1BSH A;  1Q81 Q;  1KF6 C;  2YIU B;  1GW3 A;  1Z56 A;  5KJ7 A;  4DOJ A;  1NTK J;  3AE1 D;  1SQQ E;  3JCU E;  3LID A;  3VR9 C;  3L72 G;  3TNU A;  3M91 A;  3HE5 A;  5KKZ C;  1VQ6 P;  3HUS A;  1OWA A;  4YTP D;  4JYC A;  3G4S P;  2AEF A;  2ZT9 D;  1XTC C;  2MJZ A;  3FWN A;  3V4Q A;  4TT3 H;  3GHG C;  3EFF K;  1JOC A;  1SFC B;  4WVZ A;  3LW5 J;  3AE7 C;  1NU1 J;  1NTM E;  4KJM A;  2RKL A;  5AW3 B;  2N9B A;  2C9N Y;  3WMM 0;  1Q90 D;  2G3A A;  1JMM A;  2FXO A;  2QJK C;  2AXT E;  2WU5 D;  3CXH H;  4O9B A;  3A5T A;  3H1I D;  3HD7 A;  3MUD C;  2GM4 A;  2GA1 A;  4PV1 B;  1HGV A;  3L72 E;  4I7Z B;  1VL2 A;  1LTJ B;  1SQV J;  4H44 D;  4KX6 C;  4YSZ D;  3BCC G;  1K8A Q;  3E7K A;  3B5N D;  5AVW B;  2H88 C;  4AYC A;  4C7N A;  4MN4 C;  2NRG A;  2AEJ A;  3T97 B;  3L35 A;  1OZH A;  4PD4 H;  2LXC B;  1L0L K;  1SLQ A;  2NPS B;  3AEG C;  1HH0 A;  1S5L H;  2HYN A;  2KOG A;  1JY3 N;  1VQP P;  3QH9 A;  1H0T A;  3L71 D;  2V7Q J;  3NXS A;  3W68 A;  3AEE D;  1QEX A;  3H1K G;  3AEB C;  1LP1 B;  3TK1 A;  2FYN C;  4DDI A;  2FYU J;  3V4W A;  1J2J B;  1OXZ A;  3AEC D;  3TF5 A;  2WT7 B;  4LGD E;  5AW4 B;  3PTZ A;  3P4P C;  2R3C A;  5AW2 B;  3PLN A;  2WPR A;  5AVR B;  5GTI E;  3RGU A;  1BDC A;  5K5G B;  3V2Q A;  5CJ0 A;  4YSX D;  2E76 D;  3H1K J;  4JF7 A;  1SQP G;  4H0L C;  1NTM D;  3VOP A;  2R44 A;  1ZR4 A;  3BCC J;  1KD1 Q;  1YJW P;  5E79 H;  4JBZ A;  2WDQ C;  3A7O A;  2IYP A;  3M06 A;  1PP9 D;  2K9Y A;  2YO3 A;  2JWA A;  5H2F H;  1IFD A;  2WS3 C;  4YXD D;  2M3B A;  1DX7 A;  3AE4 C;  4I6M C;  1N8R Q;  3TDK A;  4RJT A;  1JY2 P;  3H1K E;  4GT1 A;  3GLM A;  4GOF A;  1L2P A;  5AVZ B;  1FJP A;  2OAR A;  1M1J A;  2VRS A;  3TSI A;  1EZV D;  2ACZ C;  5CCG D;  1Y8A A;  1RF1 A;  1G2C B;  2CPB A;  1X22 A;  3RBX A;  1GL2 B;  1JMB A;  2IBZ E;  4K35 A;  4OWF A;  4XFJ A;  5L8R J;  1L0N K;  3H1I E;  4GOD A;  3S9O A;  1J1D C;  1KV4 A;  4IL6 H;  3V2P A;  1R5S A;  3CPW O;  4WY4 C;  3VP8 A;  4HYT B;  1Q86 Q;  2H89 C;  3PJS K;  1SFC A;  2KK7 A;  2KZJ A;  4L73 A;  1KB9 H;  1AA0 A;  4B86 A;  1VF5 B;  2O1J A;  1KIL C;  3L73 D;  1JCD A;  2GUV A;  4EI2 A;  1RH5 B;  1ZRT D;  1VPC A;  1OVU A;  4H13 C;  2I8D A;  1X0T A;  1ZP0 C;  1SQX D;  4M3L A;  1S1C X;  1VQ9 P;  5APQ A;  1CI6 A;  1ZV8 A;  4DHZ A;  1OVV A;  1SQP E;  4C7R A;  3CCV P;  2WSC H;  1GZL A;  3CC4 P;  4U3F J;  3P4S D;  2KXP B;  2OYI B;  2OYH B;  2W6A A;  2OYI C;  4EYY Q;  2OYH C;  2ZXE B;  5CBN A;  1HBW A;  1HF9 A;  1JEK A;  1HVV A;  1SQV G;  3OW2 O;  4Y28 J;  2Z5I A;  3CCS P;  3AE6 D;  2IDB A;  2ZYG A;  3H32 A;  2E74 D;  2FYZ A;  2IFM A;  2ZXX A;  1N73 A;  3OAK A;  3H1H E;  3P8M C;  3Q5R A;  1NTZ G;  1L0V C;  2IZ1 A;  3IAO A;  3KXD A;  3AED C;  3M9B A;  4D6T J;  1IFJ A;  2MKV A;  1S5L X;  2H43 A;  1SQB G;  2QVA A;  1YJN P;  4KX6 D;  4YSZ C;  2YNY A;  1N7L A;  2HR3 A;  1MUU A;  1VF5 C;  3B5N C;  1FBM A;  1AVY A;  3GF3 A;  4AQR D;  4YTN D;  3H1H G;  1L0V D;  4H44 C;  2FBW D;  3NFQ A;  3N4X A;  3O8Z A;  2KNC B;  3NMD A;  3C8V A;  2ZFY A;  2KLV A;  1KYO I;  2FFD B;  3RK2 C;  3U1A A;  1SQB E;  4JQ0 D;  1JY2 O;  2G8Y A;  1BGY E;  1G1J A;  2ZYD A;  2QM7 A;  2FYU E;  2SPZ A;  5KAF H;  1BE3 D;  2R32 A;  5EFW B;  3PP5 A;  2WPQ A;  1RF0 A;  4WY4 D;  1S9K E;  3TGU J;  1NYH A;  1UII A;  5C2T C;  3TGU G;  1SQX J;  1KB9 E;  1T3U A;  1KFY C;  1VQ4 P;  2NZ2 A;  2FXM A;  4WBA A;  1KIL D;  1T6A A;  1PPJ G;  1PP9 J;  3SFD D;  1OW7 A;  2P10 A;  1FZG A;  1EDI A;  1NAF A;  2W27 A;  4HB1 A;  4JYB A;  3TGU D;  2W6B A;  4I2L C;  5BVZ A;  1IFN A;  1PGQ A;  4BWN A;  4IL6 X;  2I1K A;  2D2C D;  3B71 A;  3RK2 D;  2YXQ B;  1VQ8 P;  1JNM A;  3CX5 H;  3P4S C;  3VTP C;  4IOI H;  3S4R A;  3H1H J;  1DH3 A;  1JUN A;  1BCC J;  2JEE A;  1NTK K;  1FC2 C;  2BEZ F;  1LTJ A;  1NTK D;  1QVF O;  5M1B A;  2E75 D;  3VMA A;  1LTB C;  2WT7 A;  1NTM K;  4H13 B;  1KF6 D;  2B87 A;  1LP1 A;  3SWY A;  3MIW A;  2WQY C;  1DD3 A;  5E79 E;  1KIL B;  1AJY A;  3FWL A;  3BAT A;  4FJV A;  2BCC G;  1L0L G;  1JTH B;  1KQG B;  1PL5 A;  5AW1 B;  3P4R D;  1K04 A;  5AVU B;  3P4Q D;  3MGN A;  5DJT B;  3B5N A;  5KAI H;  4K3A A;  3M9Q A;  1PPJ E;  2BS4 C;  3P7K A;  1Q2N A;  4YTP C;  1IK9 A;  1GL2 A;  1NU1 K;  3M9H A;  3M0A A;  5KLV D;  1GL2 C;  3H1L E;  1LGH B;  2RN0 A;  3H1L D;  5B66 E;  4I7Z C;  5CHX A;  3VMZ A;  3F5H A;  2C0W A;  3ABV C;  1L0L D;  1YYC A;  1KFN A;  1CSB A;  2J59 M;  2R5B A;  3E1I A;  5KLV K;  1SS1 A;  1YIJ P;  1NTZ D;  1BCC E;  1RF0 C;  3CWB E;  3RK3 D;  1SQV K;  3GG2 A;  1ZP0 D;  1AV1 A;  3P4R C;  2ZVO B;  4PD4 E;  1ZOY D;  4BRY A;  1FZC C;  1IK7 A;  1AFO A;  2NPS D;  3AE6 C;  1KQL A;  3FX0 A;  1YQ4 C;  1BDD A;  3FGA D;  1CZQ A;  3H1J J;  4PJ0 E;  3VR9 D;  2J5U A;  3IF4 A;  5C2T D;  1JM0 A;  1MFT A;  2JP3 A;  1E7P C;  4RKU J;  4N3Y B;  3AEC C;  1WT6 A;  2Q3E A;  3CC2 P;  3AE1 C;  1H8A A;  4H0L B;  1EDJ A;  1E79 H;  2UWJ E;  1FZF A;  3USS A;  2WDR C;  1NTZ K;  2PGD A;  1VQO P;  2QA4 P;  1G1I A;  2BCC E;  3EQ2 A;  2WP9 D;  1FAV A;  1BE3 J;  1FDO A;  3RL0 g;  3HUS B;  1BE3 G;  2Q3I A;  3L75 J;  3KZI E;  2FYN B;  1KTM A;  3VMY A;  1YIT P;  4N78 D;  3HD7 B;  5AVV B;  2FXP A;  3SFE D;  4YSY C;  1K9M Q;  2KSJ A;  5CBO A;  1SQQ D;  2GUS A;  2XU6 A;  1NEK C;  3AEA C;  2NPS C;  1N86 A;  3SWF A;  1VQM P;  1AVO A;  4GOE A;  1FZA A;  1LTA C;  2QJP B;  3L75 E;  3CCR P;  3EFG A;  4HH2 A;  3JCU H;  2Y0C A;  4H0L D;  4YXW H;  4ZNC A;  3VR8 D;  2QRX A;  4A7P A;  3JSV C;  1JCC A;  3P32 A;  1X9V A;  3H25 A;  3V2N A;  1AQ5 A;  3AE8 C;  1LTJ C;  2BS2 C;  3SWK A;  1X79 B;  1H0T B;  3P8C D;  1S72 P;  2JR8 A;  2A06 E;  1LT1 A;  3VRB D;  3VR8 C;  2BCC J;  2N1T C;  1QL2 A;  3AE9 C;  3HE4 B;  1VQ5 P;  1RQV A;  1NTM G;  1KFM A;  2HLO A;  1TU3 F;  2WWW A;  3RK3 B;  1QL1 A;  2J58 A;  2LXB A;  3CIR C;  5AW7 B;  2ZJS E;  3L72 D;  1ZOY C;  1USD A;  3A0B E;  3BCC D;  1ZLL A;  1HUC A;  2CPS A;  2H7H A;  2PP6 A;  3KPE A;  2M8R A;  3H1H D;  1KMI Z;  1SQB J;  2OGU A;  2XZR A;  1EZV I;  1FE6 A;  1L4A D;  3N7N A;  1KB9 D;  2A45 I;  4U7J A;  2HPC B;  2N1T B;  2K9J B;  4EIJ A;  1HJ0 A;  5B5E E;  1RE4 C;  3H1L G;  5CCH A;  3A2A A;  2RH0 A;  1NU1 G;  5DJU B;  2CK3 H;  2Z5H A;  3AE9 D;  1KN7 A;  3CXH D;  1VDF A;  1SFC D;  3H1L J;  3A0H E;  4KHX A;  1ZW0 A;  4UB8 E;  3AE2 D;  1LTI C;  1ZRT E;  4D6T E;  1KIL E;  3PRJ A;  1NVO A;  4LC1 A;  2B87 B;  2QJP C;  1L4A B;  3AEG D;  1A02 J;  2ZAE B;  3AEA D;  3IN6 A;  1SP4 A;  4ASV A;  1LNQ A;  4L75 A;  4W7Z A;  4EOT A;  1PZQ A;  4LLH A;  1NKN A;  2WTY A;  4PV1 D;  1M7L A;  3JC2 2;  1Q7Y Q;  1L4A C;  1S9K D;  3BAS A;  1JY3 P;  1PV3 A;  2K88 A;  2YXR B;  2IBZ I;  3HD7 C;  2KI7 B;  3R4Y A;  2Y0E A;  2E75 C;  2B76 D;  2WSF J;  1ZXG A;  4XA4 A;  1SQP K;  1U7M A;  2WU2 C;  1BGY D; 
#chains in the Genus database with same CATH homology
 3Q3D A;  4YTP C;  3AE2 C;  1YQ4 D;  1KTM A;  3AE7 D;  4H44 B;  2E74 B;  4Y28 J;  3GLM A;  3AE1 D;  3T97 B;  2FXP A;  1KMI Z;  2NZ2 A;  3VR9 C;  3AEF C;  3SFE D;  4R4L A;  3D71 A;  3AE6 D;  4YSY C;  2IDB A;  2WDR D;  2FBW C;  3VRA D;  2E76 C;  4I7Z C;  2E74 D;  2QJY C;  3AEG C;  5KKZ C;  3Q5P A;  2WQY D;  4YTN C;  4U7J A;  2H89 D;  3Q5R A;  4PV1 C;  5C3J C;  3SFD D;  3ABV C;  1OW7 A;  1L0V C;  3IAO A;  4YXD C;  3AED C;  1NEK C;  1HJ0 A;  2P10 A;  3Q1M A;  2WS3 D;  2WU2 D;  3VRB C;  4YXD D;  2MKV A;  1DD4 A;  1S5L X;  4YTP D;  1GMJ A;  2ACZ C;  1EXJ A;  3AEA C;  1NGM B;  1OW6 A;  3P4P D;  1FDI A;  2E76 B;  3AE8 D;  3D6Z A;  1NEN D;  1EXI A;  3SFE C;  2WP9 C;  3AEF D;  4KX6 D;  4YSZ C;  2O01 J;  2ZT9 D;  2V7Q J;  1HF9 A;  2WSC J;  1JB0 J;  2WDQ D;  3Q5S A;  3AEE D;  3P4Q C;  1VF5 C;  4YTM C;  2JO1 A;  1YQ3 D;  1PIX A;  1ZP0 D;  2ZT9 B;  2QSI A;  4TT3 H;  3AEB C;  2E74 C;  3RK3 E;  3AE5 C;  3GF3 A;  4XFJ A;  2WSE J;  2WDV C;  1UIX A;  4H13 D;  2FYN C;  5L8R J;  3P4R C;  4KT0 J;  4IL6 X;  4YTN D;  3AE9 D;  3S9O A;  1KOR A;  1L0V D;  4H44 C;  3D6Y A;  2D2C D;  2YIU C;  3B71 A;  4OGQ B;  4H0L D;  2B76 C;  1RQU A;  2FBW D;  3AEC D;  3AE4 D;  2YMK A;  1ZOY D;  4Z1M H;  3VR8 D;  2E75 B;  1IK7 A;  3LW5 J;  3P4S C;  3P4P C;  1MKM A;  3AE6 C;  3AE7 C;  1ZME C;  4YT0 C;  2H89 C;  3GMA A;  1YQ4 C;  3AE2 D;  3EWK A;  3H25 A;  3FGA D;  2D2C B;  4OGQ D;  1ZRT E;  2ZT9 C;  1KFY D;  2H88 D;  3VRA C;  3CIR D;  1VF5 B;  1OMI A;  2BEZ F;  3VR9 D;  4YSY D;  1Q90 D;  1KIL E;  2G3A A;  5M1B A;  4YSX D;  2E75 D;  2J5U A;  1Y9B A;  2QJP C;  2BS3 C;  5KLI C;  5C3J D;  3AE8 C;  5C2T D;  2E76 D;  1NEN C;  3Q2Y A;  2WDV D;  2JP3 A;  2QJK C;  2BS2 C;  1E7P C;  3AEG D;  3C8V A;  2WPV B;  4RKU J;  2WU5 D;  2ACZ D;  3D70 A;  3AEA D;  1VF5 D;  3IN6 A;  3SFD C;  1YQ3 C;  4H13 B;  4H0L C;  1DIP A;  2BEQ D;  3AEC C;  3VRB D;  2OQQ A;  3AEB D;  3ABV D;  3VR8 C;  1K05 A;  3AE1 C;  2G8Y A;  4PV1 B;  4H0L B;  4H13 C;  1KF6 D;  2WQY C;  1DD3 A;  2WDQ C;  3AE9 C;  3AE3 D;  4PV1 D;  4I7Z B;  1OW8 A;  1ZP0 C;  1KFY C;  1RQV A;  1VL2 A;  2WDR C;  1S1C X;  1AJY A;  2K9Y A;  1U57 A;  3AEE C;  4GDO A;  1PV3 A;  1TU3 F;  4YTM D;  3G9R A;  3O6Q A;  4H44 D;  2D2C C;  3AE5 D;  2WS3 C;  1KQG B;  1R8E A;  2WP9 D;  1PL5 A;  2QIW A;  4KX6 C;  3P4R D;  3CIR C;  4YSZ D;  3GF7 A;  1K04 A;  1FDO A;  3RL0 g;  3P4S D;  3P4Q D;  3R4Y A;  4YT0 D;  4YSX C;  3AE4 C;  2E75 C;  2B76 D;  1NYH A;  2WSF J;  4R4M A;  5C2T C;  1KQF B;  1KF6 C;  1QLB C;  4OGQ C;  1NEK D;  3AED D;  2H88 C;  2WU2 C;  2BS4 C;  1ZOY C;  2WU5 C;  3AE3 C;  1WMK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...