3AEGC

Crystal structure of porcine heart mitochondrial complex ii bound with n-biphenyl-3-yl-2-iodo-benzamide
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
138
structure length
138
Chain Sequence
b'TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with N-Biphenyl-3-yl-2-iodo-benzamide
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 48
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3aegC01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3aegC02
4YSXC 3AEFC 2BS2C 2WU5D 1ZOYD 3AE9D 1QLBC 2B76D 2FBWD 3AE1D 1KF6D 2WDVD 3SFED 4KX6D 3CIRC 1K04A 1NEND 2WDRD 3VR9D 2WS3C 1KFYC 3AEBD 3P4SD 4YSZD 1YQ4C 3P4RC 3SFDC 3AE2C 2WDQC 1L0VC 4YTPD 3AEDC 3S9OA 4YTNC 2WU5C 3AECC 3AE9C 3VRBD 3AE1C 2B76C 3P4PD 3AEAC 3AE8C 2WDVC 3P4QD 3SFEC 4KX6C 1OW6A 4YTMC 5C3JD 1YQ3D 2BS4C 3AE5D 1NENC 2WDRC 1NEKC 5C2TD 3AE7D 3P4SC 1E7PC 4YSZC 2BS3C 3ABVD 1K05A 4YTPC 2WQYD 2H89D 3AE4D 3AEGD 1KTMA 3VRBC 1ZP0D 2ACZD 3AEED 3AE6D 2WP9D 1ZOYC 5C3JC 1YQ3C 4YXDD 1OW7A 2FBWC 1KF6C 4YSYD 3AE5C 5C2TC 3VR8D 3AE3D 1L0VD 3B71A 3CIRD 3VR9C 3ABVC 2WU2D 3AEBC 2WQYC 1KFYD 2H88D 3AEGC 4YT0D 3AE2D 3AE6C 3VRAD 1OW8A 3P4PC 4YSYC 4YTND 2G3AA 3P4QC 3AECD 3AEAD 3AE8D 1PV3A 4YSXD 3AEFD 3VR8C 3AE3C 4YTMD 2WU2C 3AE7C 1NEKD 2H88C 4YT0C 2WS3D 2H89C 3AE4C 3VRAC 1YQ4D 3P4RD 1ZP0C 2ACZC 3AEEC 3SFDD 2WDQD 2WP9C 3AEDD 4YXDC
chains in the Genus database with same CATH superfamily
4PD4E 1VPCA 1N73A 4DDIA 1KF6D 3CI9A 1FZGA 3E1IA 3HUSA 3L74J 1SQXE 3BCCD 1RQVA 1J1EC 1LTJA 1SQVG 4D6TG 1OXZA 1FDOA 2FXPA 1KYOD 1KB9E 2QA4P 1ZLLA 2WSSH 2YXQB 1SQXK 5KLIB 2BS3C 5CCGD 3ABVD 4ZKPA 2HLOA 3VMZA 1VQLP 5GTHE 3IN6A 3MGNA 4R4MA 1J1DC 1YQ3C 3WU2H 2AXCA 2Q5UA 1MV8A 2O3JA 1BGYE 2HR3A 3L75E 3TK1A 1Y47A 1IC2A 2KS1A 1RE3A 5TISH 2NPSA 1MUUA 5KLVE 3WUTA 1L0NK 3P4PC 1EC5A 4H13D 3D6ZA 1A02F 3BRVB 1N8RQ 1SFCB 4PD4H 3KXDA 1USDA 3R2PA 2JJLA 1YQ4D 3IR9A 3RGUA 1OMIA 3TGUG 5KLVK 3VYIA 1PPJG 3AE9D 3AE1D 2AXTE 3U1AA 1LNQA 3KYQA 4I6MC 1Y9BA 2B9BA 2OYIC 1DEEG 3W68A 3USSA 1BE3D 2KK7A 1BCCE 1KB9H 2C9LY 1Q86Q 3MUDC 2J5UA 3A2AA 4YTNC 1KILA 3RK3E 1L0LD 3AE8C 1BGYJ 2L5GB 2M8RA 5AW9B 3L74G 1DD3A 3C9IA 2H8PD 5GTHH 2IBZI 1RF1A 5CHXA 1RF0C 5AW8B 2H89D 1CZQA 1AJYA 2OTLP 1EDJA 1FZCB 3M9HA 1VQNP 2ZVNB 2I1JA 1TFFA 2YO3A 1Q90D 5APYA 1VQKP 3CIRD 2A45H 3OAKA 5KKZB 2XNXA 2H88D 4K35A 2W90A 3Q5SA 2HG5D 3TDKA 2AEMA 1L4AD 3GF7A 1W2BO 2E74D 4RKUJ 4Y28J 2OYHB 3WUVA 1BDDA 2AXTH 4ASWA 3H1IE 1GL2A 2YIUB 1ZRTD 3G3ZA 1SFCC 3B8EB 2BEQD 5APSA 1SQVD 3QWOC 1PFIA 4D6TD 1DH3A 5AVQB 4N3YB 3P4SD 5H2FE 1IK7A 1KQLA 1RHZB 1IFJA 3SFEC 4C7RA 2LXCB 1SQBE 3CX5E 2QM7A 1FU1A 4JYBA 1KORA 1JMMA 4JQ0D 2FYNB 2WQYD 1NJIQ 1PZQA 3O8ZA 3TNUB 2IDBA 1T2KD 3RK2B 1DEBA 4YXDD 1NTZD 1HF9A 3AE3D 2JR8A 4U7JA 1FZCC 1LT9A 3P7KA 3CXHI 2A45G 3H1IJ 2E75D 1NTMD 2C0XA 1NKNA 4MN4C 3F89A 2NPSD 3VRAD 5KTBA 5CBOA 1A02J 1SLQA 4BRYB 1EDIA 4N78E 1S9KD 5KKZC 2FFDA 4KT0J 3TGUD 1VF5D 5M1BA 4WY4B 1PPJD 1ZR2A 2K9JB 2WTYA 3P4RD 2XZRA 2KB7P 1NU1E 5EFWB 1SQBJ 1QLBC 2B87A 4OWFA 3SWYA 3L70G 1MFTA 4DCKA 4ZKUA 1L0LK 2RKLA 3L74D 3CX5H 2WDQC 2A06E 1M1JA 1SQPE 1EDKA 2B76C 3TSIA 3AEAC 1KILD 3CLQA 1K9MQ 3H32B 3AE5D 2M5AA 4GODA 4I6LA 2N1TB 3Q1MA 1K05A 2YKOA 3VTPC 1SP4A 3CMEP 3RL0B 1FS0E 1L2PA 3A0BE 3AE6D 3Q2YA 1YYCA 1Q2NA 3B5NA 2FYNC 2HPCB 3MZWB 3RK2C 1NTKE 1HGVA 3HD7B 5KJ7A 3AEGC 2FYUK 2Y0EA 1NU1J 2QE7H 3GHGA 5GTIE 4HB1A 5KAFE 4YSXD 2E76D 3HTKB 1KV4A 1USEA 1GK4A 1R5LA 2QJKB 3AE7C 2BCCE 3L4FA 2IBZE 3H1IG 2R5DA 5BU8B 1KQFB 1HJBA 1JCDA 1H8AA 3M9QA 2ZFYA 3S4RA 2NRGA 1SQPJ 1T6AA 1H0TA 3SFDD 4IFMA 2ITAA 3LIEA 1WMKA 2WSCH 3HE4A 1HVVA 2YMKA 4WY4C 1GL2D 2GUSA 2FYZA 3GW6A 1KB9D 2L91A 1KFYC 1JB0J 2HFED 2IZ0A 3H1LE 3H1HE 2Q7CA 2WVRA 2GUVA 1GDTA 3AEDC 4W7ZA 3S9OA 1SQBG 4AYCA 3AECC 3RBZA 2QEXP 3CPWO 2W8ZA 3R4YA 2N9YB 1RH5B 5AVWB 1NTKJ 1NEKC 1LWUB 1X9VA 3A0BH 1BGYD 1JO5A 3BASA 3FWLA 3N4XA 3L71E 1SS1A 1URQA 1PGQA 3AE4D 3NMDA 3VP9A 3T97B 1DX7A 1X8YA 1Y8AA 2N1TC 3OW2O 1MFZA 2CPSA 2O01J 2BCCJ 2KLUA 3RL0C 5GTIH 3CCVP 3ABVC 4FJVA 2WU2D 3AEBC 2RMZA 3O6QB 5KAFH 1IZNB 4L76A 1X0TA 1VQ7P 2O01H 4PJ0E 3WMM0 1SQQE 1NO4A 3CWBJ 3JSVC 2SPZA 1HH0A 1M56D 2Q1KA 5AVVB 3L73E 3FWNA 4L74A 2XNDH 4DDGA 4U3FE 2JDIH 1NU1G 3H1HJ 4EIJA 1BDCA 4HYTB 3D6YA 2E5TA 2YO2A 4H13C 1PGPA 1LTGC 4PV1B 1FE6A 3Q5RA 2A06G 1OX3A 3L71J 1YQ4C 1N73B 3CXHE 3I5CA 5AW5B 2D2CD 2OYIB 3AE9C 3VRBD 3AE1C 2CK3H 4H0LB 3Q3DA 3CC4P 4YTMC 5C3JD 1FAVA 2BS4C 3MIWA 3SSUA 1LTJB 1S4XA 3M06A 1S1CX 2FXMA 2JP3A 1HJ0A 1SQQJ 2AEFA 4BXLA 1FJPA 1LWUC 5K5GB 1M1KQ 1KZUB 2WP9D 2RN0A 2ZXXA 1NTKG 3PH0A 3L73J 1GZLA 3LW5J 3B5ND 3VR8D 4QMAA 4PJ0H 2Y9YA 5E79E 4YT0D 5AW6B 5KJ7D 3G71P 2PP6A 1EXIA 4ZNCA 3AE2D 4BWNA 3LW5H 4IL6X 3A7OA 2FKWB 1L0NE 1OZHA 2BCCG 2P2UA 2WSFH 2KS1B 3H1ID 4LC1A 2E75B 4IL6E 1QL1A 2C0WA 2IBZG 3AEFD 2NPSB 4RO0A 3H25A 3GLMA 1JUNA 2QVAA 1U7JA 4H44D 1RF0A 2H88C 2IYOA 1GU5A 1NTZG 4I2LC 1VF5B 3CWBG 1L4AC 2WPQA 1ZP0C 1L0VD 2UWJE 3CXHH 3G6EP 2C9NY 1AV1A 5AW2B 1NTMG 1IK9A 3H1HG 3F5HA 1SQXJ 1SQBD 3CX5D 3L36A 2WDRD 3VR9D 2GA1A 5AVTB 3M91A 2P1JA 2WPSA 2Z5IA 3V6IA 4PV1C 2KLVA 1N73C 4OGQD 2H43A 3L71G 3C8VA 3P4SC 2R32A 4DOJA 4H0LC 1OFCX 5TJHA 1X79B 5CJ4A 1LTJC 1WRGA 4XA4A 2E42A 1L0NJ 1J2JB 1URQD 3AEED 3LIDA 2QIWA 1NH4A 2G8YA 5E79H 2FBWC 2QJYB 1PP9E 4N78D 3L75J 2K1AA 2R44A 3H1JE 1VQ4P 1SQQG 2WQYC 4IL6H 1T2KC 2KZJA 5KLVJ 4HJGH 4I1LA 1NU1D 1PV3A 3H6PA 3AE3C 1GTWA 3JC22 2E76B 2IZ1A 2E75C 3TF5A 4RESB 2NPSC 3VRAC 1QVFO 3BRTB 2A06D 2WU5D 1JM0A 1SQPD 2KYVA 3P32A 1CW5A 3A3YB 3BCCE 1YI2P 2WDVD 1VF5C 2J58A 1FZCA 3M0DC 1BCCJ 2ZVOB 3P4RC 2KSJA 3H1KE 4L75A 2Z4EA 5AW7B 1VDFA 2Q3EA 5AVSB 3P4PD 1GK6A 1PP9J 1OW6A 1SQXG 1IFNA 1T3UA 3H1JJ 1S2EA 5C2TD 1S5LX 1IO4A 1KQSO 4GDOA 1S5LE 3HE5A 2WT7B 2OYHA 1NTKD 4I7ZB 2MKVA 2Y9ZA 3E7KA 3AE5C 5KAIE 3N7NA 4DHJA 1IJDB 1Z56A 1AQ5A 1RF1C 2BCCD 1L0NG 1OIPA 3D70A 2IBZD 2QJYC 2QSIA 1JMBA 1AVOA 2I1KA 3AE6C 1BGYG 4YTND 2Y0DA 3L75G 1NVOA 3AE8D 2DW3A 4UB8E 3CWBD 2WWWA 1YBKA 1UIIA 5KLVG 1AFOA 2ACZC 1Q81Q 1N7SB 3CCEP 3H1LD 1EZVI 3H1HD 4GKGA 4OH8B 4YSXC 2E76C 2BS2C 1XTGB 3TNUA 3S1KA 4OVNF 5CCHC 4ZMDA 1FBMA 1L0LE 2B87B 3SFDC 4YTPD 3L71D 4C7NB 2D2CB 2FY8A 1S5LH 1RE4C 1LTAC 5H2FH 1BCCG 3FXEA 1HTLC 3CMAP 1VQMP 3EFGA 4DHIB 5KAIH 1FZFA 2HODA 2M5AB 4NPFX 3NFQA 4EYYQ 4WY4A 3JCUE 1ZOYC 3H1JG 1SQQD 3NXSA 2K9JA 5AW0B 1GU4A 4EI2A 2W6JH 4I7ZC 1LT1A 1IFMA 3L73D 1AVYA 3VN0A 4UB8H 1EQ7A 2FYUE 1N2DC 3P4QC 1Q82Q 4HKZH 1YTZI 2IYPA 3V2NA 3GHGB 2WU2C 3KHUA 2WZ7A 3L37A 1LT9C 1N86A 2WS3D 1YTZT 4H44B 1JTHA 2A45I 1PGOA 1QL2A 3CXHD 1G2CB 2N1TA 2XKMA 2B88A 4IOIH 4XFJA 4YXWH 4PD4D 3GMAA 3PP5A 1N7SC 2WSCJ 1K04A 1NEND 3HE4B 4H13B 1DD4A 2AEJA 1PL5A 2HPCA 1MZ9A 3PLNA 1SQXD 1KFNA 2PAJA 1OVRA 3HD7A 2ZT9D 1SQVK 4TT3H 3IFMA 2WPRA 3CD6P 3CCRP 3OJAB 1HWTC 3EWKA 4XE5B 2D2CC 3HTKA 2FYUJ 3CC2P 1JY2O 3MHVA 1P84I 3VRBC 5C3JC 1KF6C 2PRRA 1QLED 1L0ND 3V2RA 3L75D 1AA0A 3PJSK 1NTZK 1S9KE 3A0HE 1JY2P 2KNCB 1LTTC 3TGUE 5KLVD 3AEAD 3CL3D 1CI6B 3VR8C 3SWKA 1VQ6P 1DIPA 1ZW0A 1PPJE 3KDPB 5APUA 1NTMK 2JO1A 5CCGC 4YT0C 4N6JA 5KJ7C 3HRNA 2JEEA 1KYOI 1KD1Q 3GHGC 1RY3A 1LP1A 1TU3F 2M0BA 3AEFC 4LLHA 4DT0A 1ZN5A 2K9YA 3CC7P 3T97A 1L4AB 3MTUE 4H44C 1KFMA 5AVZB 2E74B 1M90Q 1KN7A 3EFFK 3H1LJ 4YSZD 1ZXGA 2P7JA 3U1CA 1L0VC 2W27A 2P10A 1BCCD 2J59M 4WVZA 2P58A 3O6QA 1R5SA 5AVRB 1S3JA 3RK3D 1GW4A 1VQ9P 2VRSA 3CCLP 1W2EA 2WDRC 4O9BA 2POHA 5APXA 1PP9D 2M3EA 3AE7D 1YITP 2OGUA 3VMYA 3G4SP 1SQPG 3H1JD 1IFPA 1LGHB 4JBZA 2R3CA 3M9BA 4NPDA 3HUSB 1EZVE 4KJMA 2PGDA 1VQ5P 3CX5I 1KMIZ 4WY4D 2KXPB 3FXDA 2NZ2A 1QGKB 2FYUG 3A0HH 2GM4A 4W80A 1Q7YQ 1KFYD 3WUUA 3G9RA 1OW8A 3PHLA 2G3AA 3AECD 2O01N 2YMYA 1M57D 2OYIA 1HGZA 2WITA 4U3FJ 3C1LA 5AW4B 1H88A 2WSFJ 4TLFA 5B66E 3RBXA 1NEKD 2N9BA 1GW3A 5AVUB 1NWQA 4M3LA 2H89C 4Z1MH 3MUDA 1JEKA 4RJTA 4W7YA 3H1KD 4Y99B 3KQGA 4JPZB 1E5WA 1ZMEC 2N1TD 3PRJA 1FC2C 4KX6D 3CIRC 2BASA 3RL0D 3AEBD 3A5TA 4R4LA 2Y0CA 2WU5C 2E74C 2WDVC 1EXJA 3HD7D 1ZV8A 2O1JA 3H1LG 3VOPA 2V7QJ 1HBWA 2QRXA 4WWIA 4JF7A 1NAFA 2P67A 1KTMA 2LXBA 1T3JA 1KQGB 1OW7A 3VONA 4YSYD 2V7QH 2LR2A 2OYOA 2JWDA 3IAOA 5C2TC 3B71A 3M0DA 3HUSC 1UIXA 1VQPP 1KILB 1VL2A 4CPGA 2ZJSE 2YNYA 1MKMA 2CPBA 3P8CE 3L72E 1GD2E 4JYCA 2W83C 5B66H 1SFCA 2ZFCA 1RF1B 1JY2N 4YTMD 2JKVA 1YJWP 2Q9IA 1X22A 2JWAA 2B89A 5CJ0A 3GG2A 3MP7B 3L70E 2V4HA 5BVZA 3FGAD 1P84E 3VMAA 4YXDC 3B4SA 5APWA 5CMZA 3L73G 3MD0A 4U3FG 1KC8Q 1K8AQ 3ZDMA 4Y99C 3P8MC 5CBNA 5APTA 1RE3C 2KOGA 3FX0A 1VQ8P 5KLIC 2K3RA 1PIXA 4AQRD 3QH9A 1G1IA 4YPCA 1OWAA 1QEXA 1YQ3D 4KHXA 3E1RA 5DJUB 2ZT9B 1GL2B 3U59A 1YJ9P 1EZVG 4YTPC 3L72J 4IFFA 1KYOE 1ZP0D 2PFXA 2FYUD 1QVGO 3HE5B 2RH0A 4DHZA 5CCHA 1NHLA 3V2QA 3L70J 1M7LA 2H7HA 4PV1D 2WSEJ 1KILC 2MJZA 1RE4A 4AUWA 1P84H 1JY3O 1NYHA 3CCJP 1FZAA 3OA7A 2WSEH 4H0LD 2KIKA 1JNMA 4WB4A 1BSNA 2WT7A 1LT9B 2KP8A 3BCCJ 2FBWD 1YIJP 2XV5A 2QJPB 2WS3C 1FDMA 1NAYA 3H1KJ 1JY3P 4EDFA 2FFDB 1PGJA 3V5BA 2KUBA 2W6AA 1SQBK 4IFDK 1NENC 1NOHA 1BE3E 1KYOH 2WMMA 2Q6QA 3RK3B 2WPVB 3TYYA 4GT1A 1FOSF 2ZT9C 4PD4I 5L8RJ 1VQOP 1GL2C 4K3AA 1OVUA 3L35A 1N7SA 2HODB 3CCQP 2IPPA 1CSBA 1M1JB 4BRYA 4L73A 3W67A 3V2PA 3L72G 5DJTB 2OYHC 4HH2A 2IX7C 2O1KA 3CCMP 2OTJP 4NPEA 3BATA 1PP9G 2ZYGA 1KB9I 4GOEA 1SFCD 2ZYDA 2ZAEB 2IFMA 2YIUC 3RL0g 4C7NA 3AE4C 3B5NB 4U3FD 2YXRB 1FZBA 1NU1K 5APQA 1U57A 2OTKE 3GF3A 2YKQA 4GOFA 5B5EE 3Q5PA 2Z5HA 1BE3J 3SFED 1R8EA 1JTHB 4C46A 1L0LJ 3H32A 1JOCA 1ZRTE 3NTNA 1SQPK 3BCCG 2QJPC 2XDJA 1N7LA 5AVYB 3KZIE 1SQVE 1EZVD 4D6TE 2FFDC 4UB6E 1NKZB 5CCGA 2FXOA 1H0TB 3H1KG 2BEZF 3UIAA 4YSZC 3ITKA 5AVXB 3KPEA 1LTSC 4B86A 4LGDE 2ACZD 3V4QA 2K37A 3RK3C 5BU5A 1BSHA 1G1JA 1G2CA 2QM8A 1NTKK 2IFNA 3I56P 3BVHA 5CCHD 3JCUH 2M3BA 4OGQB 1OVVA 4WBAA 1FOSE 2XU6A 1NTZE 3PTZA 1M1JC 3CWBE 1IFIA 5APVA 4A7PA 1T8ZA 3D71A 4EOTA 1URQB 1LTIC 3I55P 1QX8A 1NTME 1FJKA 2K88A 5B5EH 1WT6A 4ASVA 1GMJA 1D7MA 2ZXEB 3CCUP 1NGMB 1FZEA 2WDQD 2WP9C 2I8DA 1J1EB 1SQVJ 2R5BA 1FDIA 2HYNA 1ZR4A 4D6TJ 1ZOYD 2B76D 1LJ2A 2OQQA 3SWFA 3B5NC 2Q3IA 3K5BA 5AW1B 4DJGA 1LP1B 3KZIH 3IF4A 1HUCA 1SVFA 3AE2C 1JY3N 4UB6H 1K73Q 1LWUA 5C39A 3V4WA 1BE3G 4GIFA 3P4QD 4KX6C 1AQTA 1H89A 4DZOA 1L0LG 1J1DB 2KNCA 1E7PC 3L74E 1CI6A 3RK2D 2ZYAA 2R3SA 1NTZJ 3EQ2A 3AEGD 2E43A 2KZIA 2KSEA 2LKMA 1KILE 1YHQP 3HD7C 3P8CD 3L72D 1E79H 2W6BA 3VR9C 1N7SD 1NTMJ 2KI7B 2OARA 3WU2E 1S72P 1EDLA 1L4AA 3VP8A 2QJKC 1RQUA 1SQQK 3II6A 3M0AA 1JCCA 3L70D 4YSYC 5AW3B 1U7MA 3TGUJ 5TISE 1LTBC 4OGQC 1P84D 2QG4A 1IFDA 2E5YA 3VMXA 1YJNP 3CCSP 1XTCC 1URQC 1W5CE 3AEEC 1M8OB 4LDTA 3AEDD 2YKPA
chains in the Genus database with same CATH topology
1U57A 2E76C 2YMKA 3AEFC 3GF3A 1FDIA 2BEQD 2BS2C 2WU5D 4YSXC 1ZMEC 3Q5PA 1ZOYD 3AE9D 1QLBC 2K9YA 4PV1B 2B76D 2FBWD 3AE1D 2OQQA 1KF6D 4XFJA 2WDVD 1VF5C 3SFED 1R8EA 4KX6D 3GMAA 4H44C 1Y9BA 3CIRC 2WSCJ 3Q5RA 1K04A 1NEND 2WDRD 2E74B 1RQVA 3VR9D 4H13B 1DD4A 2WS3C 1KFYC 1JB0J 1PL5A 3AEBD 3P4SD 4YSZD 1YQ4C 3P4RC 4PV1C 3SFDC 2D2CD 1ZRTE 3AE2C 2WDQC 1L0VC 4YTPD 3AEDC 2P10A 2J5UA 3S9OA 4R4LA 4YTNC 2WU5C 1IK7A 5KLIC 3O6QA 3RK3E 3AECC 1FDOA 2QJPC 1PIXA 2E74C 3AE1C 3AE9C 2B76C 2FXPA 2ZT9D 3AEAC 3P4PD 2D2CB 3AE8C 4H0LB 3Q3DA 1EXJA 2WDVC 3P4QD 4TT3H 3SFEC 4KX6C 1OW6A 4YTMC 5C3JD 1YQ3D 4OGQD 2BS4C 1DD3A 3R4YA 3AE5D 1NENC 2WDRC 4YXDC 2ZT9B 1NEKC 5C2TD 1S5LX 3AE7D 3C8VA 1E7PC 2BEZF 2V7QJ 3P4SC 4YSZC 1S1CX 2WP9C 1KORA 3EWKA 2BS3C 2D2CC 4H0LC 3Q1MA 2WPVB 4GDOA 3ABVD 1K05A 2JP3A 4YTPC 1HJ0A 2WQYD 2H89D 3AE4D 3IN6A 3AEGD 1KTMA 3T97B 1AJYA 3VRBC 2IDBA 2ZT9C 1ZP0D 1KILE 5L8RJ 4R4MA 2ACZD 4I7ZB 3AEED 2MKVA 3AE6D 2QIWA 2WP9D 1ZOYC 2G8YA 5C3JC 1KQGB 1YQ3C 1OW7A 2FBWC 3Q2YA 4YXDD 1KF6C 1KMIZ 4YSYD 3AE5C 2FYNC 1HF9A 1Q90D 2O01J 3LW5J 3IAOA 5C2TC 3VR8D 2NZ2A 3AE3D 4U7JA 3B71A 3CIRD 3VR9C 4I7ZC 3ABVC 1UIXA 2WU2D 3AEBC 1VL2A 2WQYC 4OGQB 1KFYD 3D70A 2H88D 2QJYC 3AEGC 4YT0D 2QSIA 2E75D 4PV1D 3G9RA 2QJKC 1RQUA 1MKMA 3Q5SA 1EXIA 3AE2D 3AE6C 3VRAD 4IL6X 1OW8A 3P4PC 4YSYC 4YTND 3GF7A 2G3AA 2WSEJ 3P4QC 3AECD 2E74D 2E75B 4RKUJ 4H13D 3D6ZA 3AEAD 4OGQC 4Y28J 3D71A 1PV3A 5KKZC 2E76D 3AE8D 3AEFD 3VR8C 4YSXD 4KT0J 3AE3C 4YTMD 3H25A 1DIPA 3GLMA 2YIUC 3AE7C 2WU2C 1VF5D 3RL0g 2WSFJ 4H44D 5M1BA 2JO1A 1NEKD 1NYHA 2E76B 2H88C 4YT0C 1KQFB 2E75C 3VRBD 2WS3D 1GMJA 4H0LD 2H89C 3AE4C 1VF5B 3VRAC 4Z1MH 1YQ4D 3P4RD 1OMIA 1ZP0C 3AEEC 4H44B 3D6YA 2ACZC 3SFDD 3FGAD 1NGMB 1TU3F 2WDQD 1L0VD 1WMKA 3AEDD 4H13C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YSX C;  3AEF C;  2BS2 C;  2WU5 D;  1ZOY D;  3AE9 D;  1QLB C;  2B76 D;  2FBW D;  3AE1 D;  1KF6 D;  2WDV D;  3SFE D;  4KX6 D;  3CIR C;  1K04 A;  1NEN D;  2WDR D;  3VR9 D;  2WS3 C;  1KFY C;  3AEB D;  3P4S D;  4YSZ D;  1YQ4 C;  3P4R C;  3SFD C;  3AE2 C;  2WDQ C;  1L0V C;  4YTP D;  3AED C;  3S9O A;  4YTN C;  2WU5 C;  3AEC C;  3AE9 C;  3VRB D;  3AE1 C;  2B76 C;  3P4P D;  3AEA C;  3AE8 C;  2WDV C;  3P4Q D;  3SFE C;  4KX6 C;  1OW6 A;  4YTM C;  5C3J D;  1YQ3 D;  2BS4 C;  3AE5 D;  1NEN C;  2WDR C;  1NEK C;  5C2T D;  3AE7 D;  3P4S C;  1E7P C;  4YSZ C;  2BS3 C;  3ABV D;  1K05 A;  4YTP C;  2WQY D;  2H89 D;  3AE4 D;  3AEG D;  1KTM A;  3VRB C;  1ZP0 D;  2ACZ D;  3AEE D;  3AE6 D;  2WP9 D;  1ZOY C;  5C3J C;  1YQ3 C;  4YXD D;  1OW7 A;  2FBW C;  1KF6 C;  4YSY D;  3AE5 C;  5C2T C;  3VR8 D;  3AE3 D;  1L0V D;  3B71 A;  3CIR D;  3VR9 C;  3ABV C;  2WU2 D;  3AEB C;  2WQY C;  1KFY D;  2H88 D;  3AEG C;  4YT0 D;  3AE2 D;  3AE6 C;  3VRA D;  1OW8 A;  3P4P C;  4YSY C;  4YTN D;  2G3A A;  3P4Q C;  3AEC D;  3AEA D;  3AE8 D;  1PV3 A;  4YSX D;  3AEF D;  3VR8 C;  3AE3 C;  4YTM D;  2WU2 C;  3AE7 C;  1NEK D;  2H88 C;  4YT0 C;  2WS3 D;  2H89 C;  3AE4 C;  3VRA C;  1YQ4 D;  3P4R D;  1ZP0 C;  2ACZ C;  3AEE C;  3SFD D;  2WDQ D;  2WP9 C;  3AED D;  4YXD C; 
#chains in the Genus database with same CATH topology
 4PD4 E;  1VPC A;  1N73 A;  4DDI A;  1KF6 D;  3CI9 A;  1FZG A;  3E1I A;  3HUS A;  3L74 J;  1SQX E;  3BCC D;  1RQV A;  1J1E C;  1LTJ A;  1SQV G;  4D6T G;  1OXZ A;  1FDO A;  2FXP A;  1KYO D;  1KB9 E;  2QA4 P;  1ZLL A;  2WSS H;  2YXQ B;  1SQX K;  5KLI B;  2BS3 C;  5CCG D;  3ABV D;  4ZKP A;  2HLO A;  3VMZ A;  1VQL P;  5GTH E;  3IN6 A;  3MGN A;  4R4M A;  1J1D C;  1YQ3 C;  3WU2 H;  2AXC A;  2Q5U A;  1MV8 A;  2O3J A;  1BGY E;  2HR3 A;  3L75 E;  3TK1 A;  1Y47 A;  1IC2 A;  2KS1 A;  1RE3 A;  5TIS H;  2NPS A;  1MUU A;  5KLV E;  3WUT A;  1L0N K;  3P4P C;  1EC5 A;  4H13 D;  3D6Z A;  1A02 F;  3BRV B;  1N8R Q;  1SFC B;  4PD4 H;  3KXD A;  1USD A;  3R2P A;  2JJL A;  1YQ4 D;  3IR9 A;  3RGU A;  1OMI A;  3TGU G;  5KLV K;  3VYI A;  1PPJ G;  3AE9 D;  3AE1 D;  2AXT E;  3U1A A;  1LNQ A;  3KYQ A;  4I6M C;  1Y9B A;  2B9B A;  2OYI C;  1DEE G;  3W68 A;  3USS A;  1BE3 D;  2KK7 A;  1BCC E;  1KB9 H;  2C9L Y;  1Q86 Q;  3MUD C;  2J5U A;  3A2A A;  4YTN C;  1KIL A;  3RK3 E;  1L0L D;  3AE8 C;  1BGY J;  2L5G B;  2M8R A;  5AW9 B;  3L74 G;  1DD3 A;  3C9I A;  2H8P D;  5GTH H;  2IBZ I;  1RF1 A;  5CHX A;  1RF0 C;  5AW8 B;  2H89 D;  1CZQ A;  1AJY A;  2OTL P;  1EDJ A;  1FZC B;  3M9H A;  1VQN P;  2ZVN B;  2I1J A;  1TFF A;  2YO3 A;  1Q90 D;  5APY A;  1VQK P;  3CIR D;  2A45 H;  3OAK A;  5KKZ B;  2XNX A;  2H88 D;  4K35 A;  2W90 A;  3Q5S A;  2HG5 D;  3TDK A;  2AEM A;  1L4A D;  3GF7 A;  1W2B O;  2E74 D;  4RKU J;  4Y28 J;  2OYH B;  3WUV A;  1BDD A;  2AXT H;  4ASW A;  3H1I E;  1GL2 A;  2YIU B;  1ZRT D;  3G3Z A;  1SFC C;  3B8E B;  2BEQ D;  5APS A;  1SQV D;  3QWO C;  1PFI A;  4D6T D;  1DH3 A;  5AVQ B;  4N3Y B;  3P4S D;  5H2F E;  1IK7 A;  1KQL A;  1RHZ B;  1IFJ A;  3SFE C;  4C7R A;  2LXC B;  1SQB E;  3CX5 E;  2QM7 A;  1FU1 A;  4JYB A;  1KOR A;  1JMM A;  4JQ0 D;  2FYN B;  2WQY D;  1NJI Q;  1PZQ A;  3O8Z A;  3TNU B;  2IDB A;  1T2K D;  3RK2 B;  1DEB A;  4YXD D;  1NTZ D;  1HF9 A;  3AE3 D;  2JR8 A;  4U7J A;  1FZC C;  1LT9 A;  3P7K A;  3CXH I;  2A45 G;  3H1I J;  2E75 D;  1NTM D;  2C0X A;  1NKN A;  4MN4 C;  3F89 A;  2NPS D;  3VRA D;  5KTB A;  5CBO A;  1A02 J;  1SLQ A;  4BRY B;  1EDI A;  4N78 E;  1S9K D;  5KKZ C;  2FFD A;  4KT0 J;  3TGU D;  1VF5 D;  5M1B A;  4WY4 B;  1PPJ D;  1ZR2 A;  2K9J B;  2WTY A;  3P4R D;  2XZR A;  2KB7 P;  1NU1 E;  5EFW B;  1SQB J;  1QLB C;  2B87 A;  4OWF A;  3SWY A;  3L70 G;  1MFT A;  4DCK A;  4ZKU A;  1L0L K;  2RKL A;  3L74 D;  3CX5 H;  2WDQ C;  2A06 E;  1M1J A;  1SQP E;  1EDK A;  2B76 C;  3TSI A;  3AEA C;  1KIL D;  3CLQ A;  1K9M Q;  3H32 B;  3AE5 D;  2M5A A;  4GOD A;  4I6L A;  2N1T B;  3Q1M A;  1K05 A;  2YKO A;  3VTP C;  1SP4 A;  3CME P;  3RL0 B;  1FS0 E;  1L2P A;  3A0B E;  3AE6 D;  3Q2Y A;  1YYC A;  1Q2N A;  3B5N A;  2FYN C;  2HPC B;  3MZW B;  3RK2 C;  1NTK E;  1HGV A;  3HD7 B;  5KJ7 A;  3AEG C;  2FYU K;  2Y0E A;  1NU1 J;  2QE7 H;  3GHG A;  5GTI E;  4HB1 A;  5KAF E;  4YSX D;  2E76 D;  3HTK B;  1KV4 A;  1USE A;  1GK4 A;  1R5L A;  2QJK B;  3AE7 C;  2BCC E;  3L4F A;  2IBZ E;  3H1I G;  2R5D A;  5BU8 B;  1KQF B;  1HJB A;  1JCD A;  1H8A A;  3M9Q A;  2ZFY A;  3S4R A;  2NRG A;  1SQP J;  1T6A A;  1H0T A;  3SFD D;  4IFM A;  2ITA A;  3LIE A;  1WMK A;  2WSC H;  3HE4 A;  1HVV A;  2YMK A;  4WY4 C;  1GL2 D;  2GUS A;  2FYZ A;  3GW6 A;  1KB9 D;  2L91 A;  1KFY C;  1JB0 J;  2HFE D;  2IZ0 A;  3H1L E;  3H1H E;  2Q7C A;  2WVR A;  2GUV A;  1GDT A;  3AED C;  4W7Z A;  3S9O A;  1SQB G;  4AYC A;  3AEC C;  3RBZ A;  2QEX P;  3CPW O;  2W8Z A;  3R4Y A;  2N9Y B;  1RH5 B;  5AVW B;  1NTK J;  1NEK C;  1LWU B;  1X9V A;  3A0B H;  1BGY D;  1JO5 A;  3BAS A;  3FWL A;  3N4X A;  3L71 E;  1SS1 A;  1URQ A;  1PGQ A;  3AE4 D;  3NMD A;  3VP9 A;  3T97 B;  1DX7 A;  1X8Y A;  1Y8A A;  2N1T C;  3OW2 O;  1MFZ A;  2CPS A;  2O01 J;  2BCC J;  2KLU A;  3RL0 C;  5GTI H;  3CCV P;  3ABV C;  4FJV A;  2WU2 D;  3AEB C;  2RMZ A;  3O6Q B;  5KAF H;  1IZN B;  4L76 A;  1X0T A;  1VQ7 P;  2O01 H;  4PJ0 E;  3WMM 0;  1SQQ E;  1NO4 A;  3CWB J;  3JSV C;  2SPZ A;  1HH0 A;  1M56 D;  2Q1K A;  5AVV B;  3L73 E;  3FWN A;  4L74 A;  2XND H;  4DDG A;  4U3F E;  2JDI H;  1NU1 G;  3H1H J;  4EIJ A;  1BDC A;  4HYT B;  3D6Y A;  2E5T A;  2YO2 A;  4H13 C;  1PGP A;  1LTG C;  4PV1 B;  1FE6 A;  3Q5R A;  2A06 G;  1OX3 A;  3L71 J;  1YQ4 C;  1N73 B;  3CXH E;  3I5C A;  5AW5 B;  2D2C D;  2OYI B;  3AE9 C;  3VRB D;  3AE1 C;  2CK3 H;  4H0L B;  3Q3D A;  3CC4 P;  4YTM C;  5C3J D;  1FAV A;  2BS4 C;  3MIW A;  3SSU A;  1LTJ B;  1S4X A;  3M06 A;  1S1C X;  2FXM A;  2JP3 A;  1HJ0 A;  1SQQ J;  2AEF A;  4BXL A;  1FJP A;  1LWU C;  5K5G B;  1M1K Q;  1KZU B;  2WP9 D;  2RN0 A;  2ZXX A;  1NTK G;  3PH0 A;  3L73 J;  1GZL A;  3LW5 J;  3B5N D;  3VR8 D;  4QMA A;  4PJ0 H;  2Y9Y A;  5E79 E;  4YT0 D;  5AW6 B;  5KJ7 D;  3G71 P;  2PP6 A;  1EXI A;  4ZNC A;  3AE2 D;  4BWN A;  3LW5 H;  4IL6 X;  3A7O A;  2FKW B;  1L0N E;  1OZH A;  2BCC G;  2P2U A;  2WSF H;  2KS1 B;  3H1I D;  4LC1 A;  2E75 B;  4IL6 E;  1QL1 A;  2C0W A;  2IBZ G;  3AEF D;  2NPS B;  4RO0 A;  3H25 A;  3GLM A;  1JUN A;  2QVA A;  1U7J A;  4H44 D;  1RF0 A;  2H88 C;  2IYO A;  1GU5 A;  1NTZ G;  4I2L C;  1VF5 B;  3CWB G;  1L4A C;  2WPQ A;  1ZP0 C;  1L0V D;  2UWJ E;  3CXH H;  3G6E P;  2C9N Y;  1AV1 A;  5AW2 B;  1NTM G;  1IK9 A;  3H1H G;  3F5H A;  1SQX J;  1SQB D;  3CX5 D;  3L36 A;  2WDR D;  3VR9 D;  2GA1 A;  5AVT B;  3M91 A;  2P1J A;  2WPS A;  2Z5I A;  3V6I A;  4PV1 C;  2KLV A;  1N73 C;  4OGQ D;  2H43 A;  3L71 G;  3C8V A;  3P4S C;  2R32 A;  4DOJ A;  4H0L C;  1OFC X;  5TJH A;  1X79 B;  5CJ4 A;  1LTJ C;  1WRG A;  4XA4 A;  2E42 A;  1L0N J;  1J2J B;  1URQ D;  3AEE D;  3LID A;  2QIW A;  1NH4 A;  2G8Y A;  5E79 H;  2FBW C;  2QJY B;  1PP9 E;  4N78 D;  3L75 J;  2K1A A;  2R44 A;  3H1J E;  1VQ4 P;  1SQQ G;  2WQY C;  4IL6 H;  1T2K C;  2KZJ A;  5KLV J;  4HJG H;  4I1L A;  1NU1 D;  1PV3 A;  3H6P A;  3AE3 C;  1GTW A;  3JC2 2;  2E76 B;  2IZ1 A;  2E75 C;  3TF5 A;  4RES B;  2NPS C;  3VRA C;  1QVF O;  3BRT B;  2A06 D;  2WU5 D;  1JM0 A;  1SQP D;  2KYV A;  3P32 A;  1CW5 A;  3A3Y B;  3BCC E;  1YI2 P;  2WDV D;  1VF5 C;  2J58 A;  1FZC A;  3M0D C;  1BCC J;  2ZVO B;  3P4R C;  2KSJ A;  3H1K E;  4L75 A;  2Z4E A;  5AW7 B;  1VDF A;  2Q3E A;  5AVS B;  3P4P D;  1GK6 A;  1PP9 J;  1OW6 A;  1SQX G;  1IFN A;  1T3U A;  3H1J J;  1S2E A;  5C2T D;  1S5L X;  1IO4 A;  1KQS O;  4GDO A;  1S5L E;  3HE5 A;  2WT7 B;  2OYH A;  1NTK D;  4I7Z B;  2MKV A;  2Y9Z A;  3E7K A;  3AE5 C;  5KAI E;  3N7N A;  4DHJ A;  1IJD B;  1Z56 A;  1AQ5 A;  1RF1 C;  2BCC D;  1L0N G;  1OIP A;  3D70 A;  2IBZ D;  2QJY C;  2QSI A;  1JMB A;  1AVO A;  2I1K A;  3AE6 C;  1BGY G;  4YTN D;  2Y0D A;  3L75 G;  1NVO A;  3AE8 D;  2DW3 A;  4UB8 E;  3CWB D;  2WWW A;  1YBK A;  1UII A;  5KLV G;  1AFO A;  2ACZ C;  1Q81 Q;  1N7S B;  3CCE P;  3H1L D;  1EZV I;  3H1H D;  4GKG A;  4OH8 B;  4YSX C;  2E76 C;  2BS2 C;  1XTG B;  3TNU A;  3S1K A;  4OVN F;  5CCH C;  4ZMD A;  1FBM A;  1L0L E;  2B87 B;  3SFD C;  4YTP D;  3L71 D;  4C7N B;  2D2C B;  2FY8 A;  1S5L H;  1RE4 C;  1LTA C;  5H2F H;  1BCC G;  3FXE A;  1HTL C;  3CMA P;  1VQM P;  3EFG A;  4DHI B;  5KAI H;  1FZF A;  2HOD A;  2M5A B;  4NPF X;  3NFQ A;  4EYY Q;  4WY4 A;  3JCU E;  1ZOY C;  3H1J G;  1SQQ D;  3NXS A;  2K9J A;  5AW0 B;  1GU4 A;  4EI2 A;  2W6J H;  4I7Z C;  1LT1 A;  1IFM A;  3L73 D;  1AVY A;  3VN0 A;  4UB8 H;  1EQ7 A;  2FYU E;  1N2D C;  3P4Q C;  1Q82 Q;  4HKZ H;  1YTZ I;  2IYP A;  3V2N A;  3GHG B;  2WU2 C;  3KHU A;  2WZ7 A;  3L37 A;  1LT9 C;  1N86 A;  2WS3 D;  1YTZ T;  4H44 B;  1JTH A;  2A45 I;  1PGO A;  1QL2 A;  3CXH D;  1G2C B;  2N1T A;  2XKM A;  2B88 A;  4IOI H;  4XFJ A;  4YXW H;  4PD4 D;  3GMA A;  3PP5 A;  1N7S C;  2WSC J;  1K04 A;  1NEN D;  3HE4 B;  4H13 B;  1DD4 A;  2AEJ A;  1PL5 A;  2HPC A;  1MZ9 A;  3PLN A;  1SQX D;  1KFN A;  2PAJ A;  1OVR A;  3HD7 A;  2ZT9 D;  1SQV K;  4TT3 H;  3IFM A;  2WPR A;  3CD6 P;  3CCR P;  3OJA B;  1HWT C;  3EWK A;  4XE5 B;  2D2C C;  3HTK A;  2FYU J;  3CC2 P;  1JY2 O;  3MHV A;  1P84 I;  3VRB C;  5C3J C;  1KF6 C;  2PRR A;  1QLE D;  1L0N D;  3V2R A;  3L75 D;  1AA0 A;  3PJS K;  1NTZ K;  1S9K E;  3A0H E;  1JY2 P;  2KNC B;  1LTT C;  3TGU E;  5KLV D;  3AEA D;  3CL3 D;  1CI6 B;  3VR8 C;  3SWK A;  1VQ6 P;  1DIP A;  1ZW0 A;  1PPJ E;  3KDP B;  5APU A;  1NTM K;  2JO1 A;  5CCG C;  4YT0 C;  4N6J A;  5KJ7 C;  3HRN A;  2JEE A;  1KYO I;  1KD1 Q;  3GHG C;  1RY3 A;  1LP1 A;  1TU3 F;  2M0B A;  3AEF C;  4LLH A;  4DT0 A;  1ZN5 A;  2K9Y A;  3CC7 P;  3T97 A;  1L4A B;  3MTU E;  4H44 C;  1KFM A;  5AVZ B;  2E74 B;  1M90 Q;  1KN7 A;  3EFF K;  3H1L J;  4YSZ D;  1ZXG A;  2P7J A;  3U1C A;  1L0V C;  2W27 A;  2P10 A;  1BCC D;  2J59 M;  4WVZ A;  2P58 A;  3O6Q A;  1R5S A;  5AVR B;  1S3J A;  3RK3 D;  1GW4 A;  1VQ9 P;  2VRS A;  3CCL P;  1W2E A;  2WDR C;  4O9B A;  2POH A;  5APX A;  1PP9 D;  2M3E A;  3AE7 D;  1YIT P;  2OGU A;  3VMY A;  3G4S P;  1SQP G;  3H1J D;  1IFP A;  1LGH B;  4JBZ A;  2R3C A;  3M9B A;  4NPD A;  3HUS B;  1EZV E;  4KJM A;  2PGD A;  1VQ5 P;  3CX5 I;  1KMI Z;  4WY4 D;  2KXP B;  3FXD A;  2NZ2 A;  1QGK B;  2FYU G;  3A0H H;  2GM4 A;  4W80 A;  1Q7Y Q;  1KFY D;  3WUU A;  3G9R A;  1OW8 A;  3PHL A;  2G3A A;  3AEC D;  2O01 N;  2YMY A;  1M57 D;  2OYI A;  1HGZ A;  2WIT A;  4U3F J;  3C1L A;  5AW4 B;  1H88 A;  2WSF J;  4TLF A;  5B66 E;  3RBX A;  1NEK D;  2N9B A;  1GW3 A;  5AVU B;  1NWQ A;  4M3L A;  2H89 C;  4Z1M H;  3MUD A;  1JEK A;  4RJT A;  4W7Y A;  3H1K D;  4Y99 B;  3KQG A;  4JPZ B;  1E5W A;  1ZME C;  2N1T D;  3PRJ A;  1FC2 C;  4KX6 D;  3CIR C;  2BAS A;  3RL0 D;  3AEB D;  3A5T A;  4R4L A;  2Y0C A;  2WU5 C;  2E74 C;  2WDV C;  1EXJ A;  3HD7 D;  1ZV8 A;  2O1J A;  3H1L G;  3VOP A;  2V7Q J;  1HBW A;  2QRX A;  4WWI A;  4JF7 A;  1NAF A;  2P67 A;  1KTM A;  2LXB A;  1T3J A;  1KQG B;  1OW7 A;  3VON A;  4YSY D;  2V7Q H;  2LR2 A;  2OYO A;  2JWD A;  3IAO A;  5C2T C;  3B71 A;  3M0D A;  3HUS C;  1UIX A;  1VQP P;  1KIL B;  1VL2 A;  4CPG A;  2ZJS E;  2YNY A;  1MKM A;  2CPB A;  3P8C E;  3L72 E;  1GD2 E;  4JYC A;  2W83 C;  5B66 H;  1SFC A;  2ZFC A;  1RF1 B;  1JY2 N;  4YTM D;  2JKV A;  1YJW P;  2Q9I A;  1X22 A;  2JWA A;  2B89 A;  5CJ0 A;  3GG2 A;  3MP7 B;  3L70 E;  2V4H A;  5BVZ A;  3FGA D;  1P84 E;  3VMA A;  4YXD C;  3B4S A;  5APW A;  5CMZ A;  3L73 G;  3MD0 A;  4U3F G;  1KC8 Q;  1K8A Q;  3ZDM A;  4Y99 C;  3P8M C;  5CBN A;  5APT A;  1RE3 C;  2KOG A;  3FX0 A;  1VQ8 P;  5KLI C;  2K3R A;  1PIX A;  4AQR D;  3QH9 A;  1G1I A;  4YPC A;  1OWA A;  1QEX A;  1YQ3 D;  4KHX A;  3E1R A;  5DJU B;  2ZT9 B;  1GL2 B;  3U59 A;  1YJ9 P;  1EZV G;  4YTP C;  3L72 J;  4IFF A;  1KYO E;  1ZP0 D;  2PFX A;  2FYU D;  1QVG O;  3HE5 B;  2RH0 A;  4DHZ A;  5CCH A;  1NHL A;  3V2Q A;  3L70 J;  1M7L A;  2H7H A;  4PV1 D;  2WSE J;  1KIL C;  2MJZ A;  1RE4 A;  4AUW A;  1P84 H;  1JY3 O;  1NYH A;  3CCJ P;  1FZA A;  3OA7 A;  2WSE H;  4H0L D;  2KIK A;  1JNM A;  4WB4 A;  1BSN A;  2WT7 A;  1LT9 B;  2KP8 A;  3BCC J;  2FBW D;  1YIJ P;  2XV5 A;  2QJP B;  2WS3 C;  1FDM A;  1NAY A;  3H1K J;  1JY3 P;  4EDF A;  2FFD B;  1PGJ A;  3V5B A;  2KUB A;  2W6A A;  1SQB K;  4IFD K;  1NEN C;  1NOH A;  1BE3 E;  1KYO H;  2WMM A;  2Q6Q A;  3RK3 B;  2WPV B;  3TYY A;  4GT1 A;  1FOS F;  2ZT9 C;  4PD4 I;  5L8R J;  1VQO P;  1GL2 C;  4K3A A;  1OVU A;  3L35 A;  1N7S A;  2HOD B;  3CCQ P;  2IPP A;  1CSB A;  1M1J B;  4BRY A;  4L73 A;  3W67 A;  3V2P A;  3L72 G;  5DJT B;  2OYH C;  4HH2 A;  2IX7 C;  2O1K A;  3CCM P;  2OTJ P;  4NPE A;  3BAT A;  1PP9 G;  2ZYG A;  1KB9 I;  4GOE A;  1SFC D;  2ZYD A;  2ZAE B;  2IFM A;  2YIU C;  3RL0 g;  4C7N A;  3AE4 C;  3B5N B;  4U3F D;  2YXR B;  1FZB A;  1NU1 K;  5APQ A;  1U57 A;  2OTK E;  3GF3 A;  2YKQ A;  4GOF A;  5B5E E;  3Q5P A;  2Z5H A;  1BE3 J;  3SFE D;  1R8E A;  1JTH B;  4C46 A;  1L0L J;  3H32 A;  1JOC A;  1ZRT E;  3NTN A;  1SQP K;  3BCC G;  2QJP C;  2XDJ A;  1N7L A;  5AVY B;  3KZI E;  1SQV E;  1EZV D;  4D6T E;  2FFD C;  4UB6 E;  1NKZ B;  5CCG A;  2FXO A;  1H0T B;  3H1K G;  2BEZ F;  3UIA A;  4YSZ C;  3ITK A;  5AVX B;  3KPE A;  1LTS C;  4B86 A;  4LGD E;  2ACZ D;  3V4Q A;  2K37 A;  3RK3 C;  5BU5 A;  1BSH A;  1G1J A;  1G2C A;  2QM8 A;  1NTK K;  2IFN A;  3I56 P;  3BVH A;  5CCH D;  3JCU H;  2M3B A;  4OGQ B;  1OVV A;  4WBA A;  1FOS E;  2XU6 A;  1NTZ E;  3PTZ A;  1M1J C;  3CWB E;  1IFI A;  5APV A;  4A7P A;  1T8Z A;  3D71 A;  4EOT A;  1URQ B;  1LTI C;  3I55 P;  1QX8 A;  1NTM E;  1FJK A;  2K88 A;  5B5E H;  1WT6 A;  4ASV A;  1GMJ A;  1D7M A;  2ZXE B;  3CCU P;  1NGM B;  1FZE A;  2WDQ D;  2WP9 C;  2I8D A;  1J1E B;  1SQV J;  2R5B A;  1FDI A;  2HYN A;  1ZR4 A;  4D6T J;  1ZOY D;  2B76 D;  1LJ2 A;  2OQQ A;  3SWF A;  3B5N C;  2Q3I A;  3K5B A;  5AW1 B;  4DJG A;  1LP1 B;  3KZI H;  3IF4 A;  1HUC A;  1SVF A;  3AE2 C;  1JY3 N;  4UB6 H;  1K73 Q;  1LWU A;  5C39 A;  3V4W A;  1BE3 G;  4GIF A;  3P4Q D;  4KX6 C;  1AQT A;  1H89 A;  4DZO A;  1L0L G;  1J1D B;  2KNC A;  1E7P C;  3L74 E;  1CI6 A;  3RK2 D;  2ZYA A;  2R3S A;  1NTZ J;  3EQ2 A;  3AEG D;  2E43 A;  2KZI A;  2KSE A;  2LKM A;  1KIL E;  1YHQ P;  3HD7 C;  3P8C D;  3L72 D;  1E79 H;  2W6B A;  3VR9 C;  1N7S D;  1NTM J;  2KI7 B;  2OAR A;  3WU2 E;  1S72 P;  1EDL A;  1L4A A;  3VP8 A;  2QJK C;  1RQU A;  1SQQ K;  3II6 A;  3M0A A;  1JCC A;  3L70 D;  4YSY C;  5AW3 B;  1U7M A;  3TGU J;  5TIS E;  1LTB C;  4OGQ C;  1P84 D;  2QG4 A;  1IFD A;  2E5Y A;  3VMX A;  1YJN P;  3CCS P;  1XTC C;  1URQ C;  1W5C E;  3AEE C;  1M8O B;  4LDT A;  3AED D;  2YKP A; 
#chains in the Genus database with same CATH homology
 1U57 A;  2E76 C;  2YMK A;  3AEF C;  3GF3 A;  1FDI A;  2BEQ D;  2BS2 C;  2WU5 D;  4YSX C;  1ZME C;  3Q5P A;  1ZOY D;  3AE9 D;  1QLB C;  2K9Y A;  4PV1 B;  2B76 D;  2FBW D;  3AE1 D;  2OQQ A;  1KF6 D;  4XFJ A;  2WDV D;  1VF5 C;  3SFE D;  1R8E A;  4KX6 D;  3GMA A;  4H44 C;  1Y9B A;  3CIR C;  2WSC J;  3Q5R A;  1K04 A;  1NEN D;  2WDR D;  2E74 B;  1RQV A;  3VR9 D;  4H13 B;  1DD4 A;  2WS3 C;  1KFY C;  1JB0 J;  1PL5 A;  3AEB D;  3P4S D;  4YSZ D;  1YQ4 C;  3P4R C;  4PV1 C;  3SFD C;  2D2C D;  1ZRT E;  3AE2 C;  2WDQ C;  1L0V C;  4YTP D;  3AED C;  2P10 A;  2J5U A;  3S9O A;  4R4L A;  4YTN C;  2WU5 C;  1IK7 A;  5KLI C;  3O6Q A;  3RK3 E;  3AEC C;  1FDO A;  2QJP C;  1PIX A;  2E74 C;  3AE1 C;  3AE9 C;  2B76 C;  2FXP A;  2ZT9 D;  3AEA C;  3P4P D;  2D2C B;  3AE8 C;  4H0L B;  3Q3D A;  1EXJ A;  2WDV C;  3P4Q D;  4TT3 H;  3SFE C;  4KX6 C;  1OW6 A;  4YTM C;  5C3J D;  1YQ3 D;  4OGQ D;  2BS4 C;  1DD3 A;  3R4Y A;  3AE5 D;  1NEN C;  2WDR C;  4YXD C;  2ZT9 B;  1NEK C;  5C2T D;  1S5L X;  3AE7 D;  3C8V A;  1E7P C;  2BEZ F;  2V7Q J;  3P4S C;  4YSZ C;  1S1C X;  2WP9 C;  1KOR A;  3EWK A;  2BS3 C;  2D2C C;  4H0L C;  3Q1M A;  2WPV B;  4GDO A;  3ABV D;  1K05 A;  2JP3 A;  4YTP C;  1HJ0 A;  2WQY D;  2H89 D;  3AE4 D;  3IN6 A;  3AEG D;  1KTM A;  3T97 B;  1AJY A;  3VRB C;  2IDB A;  2ZT9 C;  1ZP0 D;  1KIL E;  5L8R J;  4R4M A;  2ACZ D;  4I7Z B;  3AEE D;  2MKV A;  3AE6 D;  2QIW A;  2WP9 D;  1ZOY C;  2G8Y A;  5C3J C;  1KQG B;  1YQ3 C;  1OW7 A;  2FBW C;  3Q2Y A;  4YXD D;  1KF6 C;  1KMI Z;  4YSY D;  3AE5 C;  2FYN C;  1HF9 A;  1Q90 D;  2O01 J;  3LW5 J;  3IAO A;  5C2T C;  3VR8 D;  2NZ2 A;  3AE3 D;  4U7J A;  3B71 A;  3CIR D;  3VR9 C;  4I7Z C;  3ABV C;  1UIX A;  2WU2 D;  3AEB C;  1VL2 A;  2WQY C;  4OGQ B;  1KFY D;  3D70 A;  2H88 D;  2QJY C;  3AEG C;  4YT0 D;  2QSI A;  2E75 D;  4PV1 D;  3G9R A;  2QJK C;  1RQU A;  1MKM A;  3Q5S A;  1EXI A;  3AE2 D;  3AE6 C;  3VRA D;  4IL6 X;  1OW8 A;  3P4P C;  4YSY C;  4YTN D;  3GF7 A;  2G3A A;  2WSE J;  3P4Q C;  3AEC D;  2E74 D;  2E75 B;  4RKU J;  4H13 D;  3D6Z A;  3AEA D;  4OGQ C;  4Y28 J;  3D71 A;  1PV3 A;  5KKZ C;  2E76 D;  3AE8 D;  3AEF D;  3VR8 C;  4YSX D;  4KT0 J;  3AE3 C;  4YTM D;  3H25 A;  1DIP A;  3GLM A;  2YIU C;  3AE7 C;  2WU2 C;  1VF5 D;  3RL0 g;  2WSF J;  4H44 D;  5M1B A;  2JO1 A;  1NEK D;  1NYH A;  2E76 B;  2H88 C;  4YT0 C;  1KQF B;  2E75 C;  3VRB D;  2WS3 D;  1GMJ A;  4H0L D;  2H89 C;  3AE4 C;  1VF5 B;  3VRA C;  4Z1M H;  1YQ4 D;  3P4R D;  1OMI A;  1ZP0 C;  3AEE C;  4H44 B;  3D6Y A;  2ACZ C;  3SFD D;  3FGA D;  1NGM B;  1TU3 F;  2WDQ D;  1L0V D;  1WMK A;  3AED D;  4H13 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...