3AEGC

Crystal structure of porcine heart mitochondrial complex ii bound with n-biphenyl-3-yl-2-iodo-benzamide
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of porcine heart mitochondrial complex II bound with N-Biphenyl-3-yl-2-iodo-benzamide
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
total genus 48
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3aegC01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3aegC02
3AEBD 3SFDD 3AE1C 3S9OA 1NEND 2WDQC 3AEAD 2WP9C 2H88D 3AEED 4KX6D 3VRBC 3AEGD 1L0VD 5C3JC 3AE6C 1KF6D 5C2TC 1L0VC 3SFED 2H89D 3AE2C 1YQ3D 2WQYC 3P4PC 3AEBC 3AE1D 2FBWD 4YSYC 3VR9D 1OW7A 1K04A 3VR8D 1ZOYC 3VRAD 3VR9C 2WQYD 1YQ3C 4YXDD 4YSZC 2WS3D 2WDRC 1K05A 4YSZD 4KX6C 3VRBD 1ZP0C 1NENC 1PV3A 2WP9D 2ACZC 3AEAC 4YTMD 3AE8C 1OW6A 1KFYC 3ABVD 3AE4D 1KTMA 1NEKD 4YTMC 2WU5C 4YTPD 3P4PD 3P4RD 2FBWC 1YQ4D 2B76D 4YSYD 2BS4C 2WDRD 3AE8D 4YXDC 2G3AA 3P4QC 3CIRC 3AEEC 3VRAC 4YSXD 3AECD 4YTPC 3AEFC 2WU5D 4YT0D 5C2TD 3P4SC 3AE4C 2BS3C 3AE9D 2WDQD 2H88C 2ACZD 2WDVC 3AE3C 1QLBC 2WU2D 3AE2D 3SFEC 3ABVC 1KFYD 3AE3D 3AEDD 4YTND 1OW8A 3AECC 4YT0C 5C3JD 3AE5D 3AE9C 1ZP0D 2H89C 3AE5C 2WS3C 3AEFD 1KF6C 3SFDC 3AE6D 1YQ4C 2B76C 3P4SD 1E7PC 2BS2C 2WDVD 4YSXC 3AEGC 1ZOYD 3VR8C 3P4QD 3CIRD 3AEDC 4YTNC 3B71A 3AE7D 3P4RC 1NEKC 2WU2C 3AE7C
chains in the Genus database with same CATH superfamily
1L0NE 3S9OA 1AVYA 1S1CX 3CWBE 4KX6D 1G2CB 3Q5SA 1QVGO 1PFIA 3CCLP 4PV1C 2FKWB 4ZMDA 4OH8B 2OGUA 5GTHE 2JEEA 4WB4A 5AVSB 1CZQA 1BDDA 4W7YA 4LGDE 3L71D 3L71G 2R32A 1Q86Q 1GL2D 1YQ3C 3L73D 2KS1A 3MP7B 3H1HD 3HD7D 2IZ1A 3CI9A 1FZCA 3PH0A 3L70D 1LTJC 4L76A 2FYUK 3CL3D 2IBZE 1EZVE 1T2KC 4QMAA 4H13C 1JCCA 2FXPA 2N9BA 2BS4C 2RH0A 1JY2N 1PGQA 1GL2B 1ZN5A 3A0HE 3K5BA 4HKZH 2IFNA 1SQXJ 1RE3A 1DX7A 3AEFC 2FYUD 1JTHA 1PGOA 1VF5B 1N73B 3CCUP 1NTKK 2P7JA 1ZLLA 3A0BH 3CCMP 1OX3A 3V5BA 1EXIA 3BRVB 3CWBJ 2JP3A 2LR2A 4UB6H 4IL6E 2P2UA 1W2BO 3HE4A 2FYNC 3TF5A 1EXJA 1KFMA 3AEGD 4JBZA 3Q5PA 3H6PA 2A06E 5K5GB 3L74J 1FZFA 1HGVA 1G2CA 1KYOI 2M8RA 3RK2D 1NKZB 1KB9E 2E74D 2C0XA 4RJTA 1DH3A 1OVVA 1FU1A 2ZT9C 3GF7A 4GIFA 4YSZC 3OJAB 2FXMA 4H0LC 2QJKC 5TISE 2CPSA 2YKQA 3RL0C 2IDBA 3B5NB 2JWDA 3RBXA 4DZOA 2BCCE 2NRGA 4GKGA 1M90Q 3MUDA 4DOJA 5AVZB 3Q5RA 5CJ0A 1NTMJ 3BVHA 3HE5A 2FFDA 4OVNF 1NHLA 2WSCJ 3VRAC 1KV4A 4Y99B 1OMIA 4IOIH 2W83C 1DIPA 1N8RQ 3PHLA 2WU2D 1S3JA 1VQOP 1G1IA 1SQPG 3HD7C 3M9BA 3O6QA 1JTHB 1CSBA 4B86A 2W27A 1L0LE 1AJYA 2M5AA 1LTTC 3CMEP 3CCQP 1SFCB 1LTAC 2KK7A 1NEND 2AEJA 2WPVB 1VQ9P 1L0VD 5KLVG 1NTKJ 3A0HH 4PJ0E 1L4AB 4H13D 3W68A 1LGHB 5AW3B 3PP5A 1PGPA 5AW5B 1IC2A 3VR9C 3O6QB 1XTCC 2QM8A 2BCCG 3H1KG 1LT1A 2AEFA 2ZJSE 2AEMA 1KILD 2ACZC 3TGUD 1IFJA 2KZJA 1NEKD 4YTMC 3M91A 2QRXA 1IFDA 1T6AA 2B76D 3V4WA 2N1TA 3II6A 1BGYD 3GLMA 1JNMA 2IFMA 2WSEH 3B4SA 2WPRA 2WDQD 4RKUJ 3GHGB 1KILC 1A02F 3L35A 3SFEC 3M9HA 3D6YA 4YTND 1KQSO 1Y8AA 3L4FA 2KYVA 5APVA 1KF6C 3AE6D 1LT9B 5AVUB 2WSFJ 2WSEJ 1URQC 3P4QD 2R3SA 1DEEG 1ZW0A 3FXDA 2E42A 3AEBD 4AQRD 3H1HE 5TJHA 2HYNA 2YMYA 2O01H 3CMAP 1L0VC 3H1JD 3CCRP 1LT9C 1GW4A 3AE1D 2VRSA 1SQPK 4DHJA 4DDIA 1OW7A 3M9QA 3L71J 1NAYA 2O1JA 1LWUC 1NKNA 1FZGA 3L73G 5E79E 2UWJE 1YTZI 4IL6X 1HJ0A 1Q7YQ 5B66E 1KYOD 1FJKA 2ZXEB 2WSCH 1VQ8P 3S4RA 1L0NG 2QG4A 1NU1K 3VMXA 4D6TD 2PFXA 3H32A 2Z5HA 2XZRA 2FBWC 2C9LY 1YQ4D 5APWA 1FOSE 5KJ7A 3E1IA 2KSEA 1WMKA 3V2PA 2B89A 5C2TD 1P84I 1J1DB 3I56P 3P32A 1NJIQ 2HPCB 1KQLA 1M1JA 4BXLA 1BE3J 3FXEA 5AW8B 3L70E 1J1EC 4U3FG 3FWNA 1CI6A 1K8AQ 1MUUA 1M1KQ 1DD4A 4UB6E 2JKVA 3CWBG 2YXRB 1RQVA 4K3AA 1RY3A 4HYTB 1GK6A 1NH4A 4RO0A 2PRRA 5GTIE 3FWLA 1RQUA 2ZFCA 2IX7C 2HFED 5KAIE 2WSFH 2WQYC 2JJLA 3L74D 2PAJA 4I6MC 4ZKPA 5KLIB 3P8MC 2WSSH 1Q81Q 1SFCA 3PLNA 1SLQA 2QE7H 2W6JH 1FC2C 1HGZA 5CCGA 1XTGB 2YO2A 3TNUA 1AA0A 2Q7CA 2KUBA 1UIIA 3H1IG 3VYIA 3P8CE 1RF0A 1BDCA 2WVRA 4PV1D 4OGQB 4W80A 1SQVE 4Y28J 1GMJA 2PP6A 5H2FE 2W6BA 4BRYB 2N1TD 3CCSP 2RKLA 2BS3C 1KQFB 1OFCX 1PP9D 2XNDH 3H1KE 4D6TE 1G1JA 2OYHC 2KOGA 5KAIH 2HR3A 5KLVK 5C39A 3MGNA 3NTNA 4W7ZA 1KILE 3AE5D 3KZIH 1ZP0D 1S4XA 3CCJP 3CC4P 1CW5A 2ZXXA 3JCUE 3B5NA 4H44C 1IFIA 1Q2NA 3R2PA 1L4AD 2IYPA 3TSIA 4AUWA 1T3JA 3FGAD 1R5LA 4R4MA 1MFZA 4WY4A 2E5YA 5AW4B 2KZIA 3CXHI 2E76C 4GOFA 3H1KJ 3CPWO 2Y0DA 4WVZA 2WTYA 1LTJA 2Y9YA 3CCEP 2YIUB 1HH0A 3I55P 2D2CD 1JEKA 1MZ9A 1SQXE 1BE3D 3WMM0 3AEAC 3L72D 1NTKD 1YI2P 1J2JB 2G8YA 3ZDMA 1GK4A 2C9NY 4YTPD 4KHXA 2NPSC 3P4PD 2CK3H 3TGUJ 5KJ7D 2Q3EA 2KSJA 1GU4A 3GG2A 3H25A 5E79H 3P7KA 1H8AA 1N73A 3A2AA 3P4SC 4EYYQ 2JO1A 4HH2A 1BGYG 2ACZD 1Z56A 4TLFA 1NO4A 3N7NA 4LC1A 2M0BA 3GW6A 2NPSB 2GUVA 1SQPJ 2A45G 3CC7P 5AW9B 3AEFD 1X0TA 3Q2YA 1LWUB 4H0LB 1SQBG 2IBZI 5AVTB 1JO5A 1WT6A 1SVFA 4ZNCA 4I2LC 1VQ5P 3C1LA 3W67A 4I6LA 3SFDD 4PV1B 4C46A 1QLED 2H88D 2MKVA 3AEED 1S5LH 1KF6D 2QVAA 3AE6C 3EFGA 3OAKA 1KB9H 1BCCD 1USEA 1P84H 3LIEA 3H1JJ 1JY3N 1H0TA 3RK3C 1ZXGA 3QH9A 1VQ7P 3G71P 1M57D 3USSA 1IJDB 1ZOYC 1SQQJ 3V2RA 4YXDD 1VDFA 1M8OB 1S9KE 4YSZD 3VN0A 1NTKG 1W2EA 1FDOA 1OW6A 1ZMEC 1S5LE 3MIWA 4PD4D 3PRJA 4EDFA 4N6JA 2ZYAA 4C7NA 3WUUA 4YSYD 4EIJA 2IPPA 3P4QC 1HF9A 3HD7A 5APUA 1X79B 4YSXD 1CI6B 2E74B 4I7ZC 1EC5A 1SQPE 1IFNA 1HTLC 2L5GB 4PJ0H 1QLBC 1BSNA 2Y0EA 5C3JD 2WT7A 1PPJD 3TYYA 5KTBA 2BS2C 3NMDA 2M3BA 3AEDC 5KLVE 1SS1A 3E7KA 3P4RC 1NEKC 2A06D 1EZVD 2QJYB 3AEAD 1FS0E 1ZR2A 3O8ZA 1L4AA 3VOPA 5CBOA 2HPCA 4GODA 1YTZT 3VR9D 5APSA 4DT0A 4JYCA 5CBNA 2WQYD 1L2PA 3U1AA 2WS3D 3M06A 2N1TC 4OGQD 3EQ2A 5KLVJ 2E75D 1PP9E 3L75J 1KFYC 2IYOA 1JB0J 1NAFA 1GZLA 4BRYA 2Q1KA 1RE3C 2O01N 3MZWB 2C0WA 3MD0A 3BCCE 5KKZC 4YXDC 3IF4A 2BEQD 1YIJP 1KB9I 1RF1B 1H89A 1NYHA 2K9YA 2SPZA 1LT9A 3H1LD 3JCUH 1X9VA 2WMMA 1JCDA 3HE5B 2H88C 1RF1C 2WDVC 1NTZD 1BE3E 2K9JB 1JY3O 2O1KA 4KJMA 3N4XA 2O01J 1GW3A 3P8CD 1NTMK 2XV5A 3LW5H 4JPZB 3GHGC 2I1JA 2YKOA 3CX5E 5B66H 4U3FD 1N7SC 3OA7A 3EWKA 4XA4A 1L0ND 4I7ZB 5B5EE 1YBKA 5C3JC 2GA1A 2ZT9D 4YXWH 3B5NC 1S72P 3L73J 5B5EH 1LP1B 2V4HA 2FYZA 3VP8A 1FZAA 3HE4B 3D6ZA 3D70A 3WUVA 2BASA 3RGUA 2R5BA 3FX0A 1EZVI 5APQA 3L36A 1M1JB 1J1EB 3Q3DA 4HJGH 2WZ7A 5GTIH 2W6AA 3WUTA 2H7HA 3UIAA 1PZQA 1VPCA 2R5DA 4Z1MH 2CPBA 3H1LE 2G3AA 2ZYGA 3HTKA 2LXBA 1SQBK 3H32B 3A7OA 2WU5D 3HRNA 2KXPB 2QSIA 3CXHD 2J59M 1SQXG 4EOTA 1LTSC 5CCGC 2LKMA 3AE3D 3AEDD 1URQB 4DJGA 1M7LA 3L72E 1S5LX 3PTZA 1T3UA 3SFDC 2FFDB 1LJ2A 3AEGC 1JY2P 2KLVA 2N9YB 3CIRD 3H1ID 3HUSB 3KHUA 2E75B 4UB8H 1KN7A 2A06G 3AE7C 2KB7P 4L74A 1WRGA 1NU1G 4N3YB 1GD2E 1JMBA 2Q6QA 3OW2O 3SSUA 2PGDA 1JOCA 1OVUA 4LLHA 4MN4C 2E43A 5KAFE 3LIDA 4YSYC 2FFDC 2E76B 2XU6A 1KB9D 2AXTH 3G9RA 1PL5A 1SQBE 1E5WA 1NGMB 1YJNP 2B87B 1VQMP 1NENC 3HUSC 3ABVD 1IZNB 1QEXA 3H1LJ 1L4AC 2BCCD 2K88A 1VQKP 2HODB 1KC8Q 1OVRA 5AVXB 4D6TG 3H1IJ 3MHVA 4NPDA 2Y0CA 5BU5A 1S9KD 1SQBJ 1BGYJ 4UB8E 3R4YA 1N2DC 3A3YB 1NTKE 3ABVC 1U57A 1PP9G 2P10A 1OW8A 2QA4P 2YIUC 1T8ZA 5GTHH 1VQNP 3NFQA 3KYQA 1KFNA 2Z5IA 3KXDA 5CCGD 3HTKB 1EDJA 1LTJB 2OYHB 2GM4A 2QJKB 1HVVA 5KKZB 3RL0g 1TU3F 2WP9C 2V7QJ 2Y9ZA 5CMZA 4DDGA 2I8DA 1AQTA 1FZBA 5AVYB 1PP9J 2KS1B 2E74C 3SWFA 1VF5D 2OTLP 3VR8D 5BVZA 2ZFYA 1NTZK 1KILA 1K9MQ 2QJPC 3VMZA 1MV8A 3AE4D 1YJWP 3S1KA 2OTKE 2OYIA 1RHZB 1UIXA 1FAVA 1NTZG 3H1KD 3AE8D 3RL0D 1BGYE 4YT0D 1NWQA 1W5CE 3V6IA 3RK2C 3AE9D 2YXQB 3CX5I 2NPSD 3TNUB 1ZR4A 1IK9A 3L74G 1N7SD 2B87A 1R5SA 1NTZJ 4H44B 2K1AA 2O3JA 5AVRB 1TFFA 4OGQC 3WU2H 1FZEA 1SQXD 1YQ4C 4Y99C 3A5TA 1SQVJ 1QGKB 2IBZD 3KPEA 3VR8C 2D2CC 4TT3H 4HB1A 1VF5C 1PPJG 1FDIA 1FDMA 3BRTB 3TGUG 4EI2A 4IFDK 1OIPA 1RH5B 1BE3G 5AW7B 5CHXA 1NTZE 1FJPA 2A45H 3JSVC 4L75A 2D2CB 2POHA 1USDA 3IAOA 1M56D 1L0NJ 3VMYA 5KLVD 1URQA 4JYBA 2YO3A 4KX6C 1HBWA 1HWTC 2V7QH 1VQ4P 1SQVK 1ZP0C 1KMIZ 1RF0C 3M0DA 1AQ5A 2OYIB 4YTMD 2Q9IA 3BCCG 2QIWA 3KZIE 1VQ6P 2W90A 1KORA 5CCHA 3BATA 2R3CA 2YNYA 3RBZA 1SQVD 5BU8B 2B9BA 4ASWA 4ASVA 3CC2P 1N86A 4PD4H 1NU1J 1FZCC 3CIRC 3AECD 4A7PA 1E79H 2Q3IA 2GUSA 3A0BE 2H43A 2ZVNB 4H13B 3IFMA 2KI7B 3AE3C 1KFYD 2ZYDA 1X8YA 3KQGA 3AE9C 2H89C 3WU2E 2B76C 3TGUE 2AXTE 1KZUB 1LP1A 1NOHA 1ZOYD 2MJZA 2ZT9B 3RK3E 4U3FJ 2WITA 2ZAEB 1MFTA 4XE5B 1KILB 1AFOA 4DHIB 5KAFH 1YJ9P 2P67A 3EFFK 3TDKA 1D7MA 3B8EB 1YHQP 3CLQA 3VRBC 1NTMD 3SFED 2E5TA 3U59A 3L70J 3L75E 1DEBA 1VQLP 5AW6B 3L72G 1R8EA 2KP8A 2FBWD 3ITKA 2FYNB 2OARA 2P1JA 3T97A 3GF3A 1NVOA 5AW1B 1JM0A 1P84D 1GU5A 2FYUE 3E1RA 1SFCD 2Q5UA 3VTPC 1H0TB 2OYHA 3BASA 3H1IE 5EFWB 4D6TJ 4C7NB 2R44A 3JC22 3GHGA 1SQVG 1KTMA 3VMAA 1NU1E 2WU5C 1RF1A 2W8ZA 1N73C 2FY8A 2WDRD 2K37A 1N7SB 4M3LA 1EZVG 3AEEC 1QX8A 1HJBA 2WPSA 3SWYA 1SFCC 5KJ7C 2A45I 1L0NK 5L8RJ 3F89A 4I1LA 4IFMA 4WBAA 3CD6P 1Y47A 4BWNA 3D71A 2QJPB 3SWKA 3L71E 2YMKA 3L73E 3RL0B 1GTWA 3B5ND 4YTNC 1OWAA 3B71A 4N78D 3AE1C 1JUNA 2WDQC 1EDKA 1DD3A 1L0LG 3G6EP 2OTJP 3L75D 2IBZG 5DJTB 1HUCA 2NPSA 2LXCB 5C2TC 2H89D 2NZ2A 3L74E 1H88A 2M5AB 3CX5H 3G3ZA 1K04A 3G4SP 2P58A 3VRAD 4ZKUA 4C7RA 1ZRTD 1AVOA 1GL2A 3L72J 2J58A 1IFPA 1PPJE 1LTGC 2XDJA 2YKPA 4CPGA 4JF7A 2KNCA 1SQQD 2FXOA 2ITAA 2BCCJ 3H1LG 4WY4B 1VL2A 3HD7B 1AV1A 3RK3B 2Z4EA 3U1CA 1Y9BA 2KIKA 3CXHE 1QL2A 2JDIH 5AVWB 2ZVOB 3CCVP 4RESB 1LNQA 1RE4C 3AE4C 3TK1A 2AXCA 2XNXA 5APXA 2E75C 1GDTA 4KT0J 3V2QA 4DCKA 3M0AA 1U7MA 3AE2D 1M1JC 3QWOC 1QVFO 2JWAA 3AECC 1KYOE 3AE5C 4WWIA 5AVQB 2WS3C 3GMAA 4JQ0D 4YSXC 4NPEA 3BCCJ 1N7SA 1T2KD 1FBMA 3AE7D 4U7JA 2M3EA 2J5UA 4IFFA 1VQPP 4PD4I 2BEZF 1BCCE 1SQQK 2K9JA 4NPFX 2B88A 3AE2C 2E76D 1GL2C 5APTA 1YQ3D 4FJVA 1KD1Q 5AW0B 3H1HG 3HUSA 1NTMG 1A02J 4K35A 4XFJA 3MUDC 1IO4A 2QM7A 2DW3A 4N78E 4YPCA 3NXSA 3F5HA 3RK3D 2I1KA 1SP4A 3IN6A 2H8PD 1LTIC 1OXZA 1X22A 5AVVB 1QL1A 4PD4E 5CCHD 1RE4A 4L73A 3L37A 3L75G 1L0LD 3PJSK 3H1HJ 4GOEA 3IR9A 3BCCD 1EDLA 1SQQE 3V2NA 1SQPD 3LW5J 3T97B 1KYOH 3KDPB 2QEXP 1IK7A 2N1TB 1OZHA 2KNCB 2IZ0A 2K3RA 1JY3P 1L0LK 2JR8A 3I5CA 3MTUE 1Q82Q 4GT1A 4YT0C 1BSHA 1NTME 5M1BA 2L91A 2KLUA 3C9IA 3P4SD 1NU1D 4DHZA 2OYIC 5TISH 3CXHH 1MKMA 4H0LD 1BCCG 1BCCJ 2WU2C 1P84E 2RN0A 1N7LA 2FYUJ 5APYA 4WY4C 1J1DC 2RMZA 3RK2B 4AYCA 1FZCB 3P4PC 3CWBD 1K73Q 3H1JG 1SQBD 3AEBC 2WWWA 1L0LJ 2XKMA 1JMMA 1S2EA 1URQD 4IL6H 3VP9A 4O9BA 2WDRC 1K05A 3VRBD 3C8VA 1PV3A 1FOSF 1LTBC 2WP9D 3AE8C 5DJUB 4R4LA 2OQQA 2WT7B 1IFMA 4LDTA 1SQQG 4GDOA 3P4RD 5KLIC 1SQXK 1KQGB 1ZV8A 3V4QA 4YTPC 4OWFA 2FYUG 2QJYC 5CJ4A 5H2FH 1U7JA 2OYOA 2HODA 4H44D 2WPQA 3H1JE 3VONA 1YITP 1Q90D 1PIXA 4WY4D 1JY2O 3M0DC 5AW2B 1FE6A 1EQ7A 2HG5D 1E7PC 1PGJA 1EDIA 2WDVD 3L70G 5CCHC 4U3FE 2HLOA 3CX5D 1LWUA 1YYCA 1ZRTE 3Q1MA
chains in the Genus database with same CATH topology
3AEBD 3SFDD 3AE1C 4I7ZB 4PV1B 3RL0g 3S9OA 1TU3F 1EXJA 1NEND 2WDQC 3AEAD 2WP9C 2J5UA 1S1CX 2H88D 1DD3A 2WPVB 2MKVA 3AEED 4KX6D 3VRBC 3AEGD 1L0VD 1RQUA 5C3JC 2E76C 2BEZF 3AE6C 3Q5SA 1KF6D 2V7QJ 5C2TC 1L0VC 3SFED 2H89D 3AE2C 3Q5PA 2E76D 2NZ2A 1YQ3D 2WQYC 2ZT9D 4PV1C 3P4PC 4H13D 3AEBC 3AE1D 2E74C 1R8EA 2FBWD 4YSYC 2E76B 4XFJA 2E74D 1VF5D 3GF3A 3VR9D 2D2CB 1OW7A 1K04A 3VR8D 1ZOYC 3VRAD 3VR9C 2D2CD 3G9RA 2WQYD 1PL5A 1YQ3C 3IAOA 2ZT9C 4YXDD 3GF7A 3D6ZA 4YSZC 3D70A 4H0LC 4IL6X 2QJKC 2WS3D 1HJ0A 2WDRC 1K05A 4YSZD 4KX6C 3VRBD 1NGMB 3C8VA 4OGQD 1ZP0C 1NENC 1PV3A 2QJPC 1KMIZ 2E75D 2IDBA 2ACZC 2WP9D 3AEAC 3IN6A 1FDOA 4YTMD 3AE8C 3Q3DA 1OW6A 1KFYC 2QIWA 3ABVD 1ZMEC 4R4LA 3AE4D 1KTMA 1NEKD 2OQQA 4YTMC 2G8YA 1JB0J 2WU5C 4YTPD 1KORA 4GDOA 4PV1D 3P4PD 1VL2A 1UIXA 4H13C 4OGQB 3P4RD 2FXPA 2FBWC 1YQ4D 2B76D 4YSYD 5KLIC 5KKZC 2BS4C 4Z1MH 2WDRD 1Y9BA 3Q5RA 4Y28J 1KQGB 1GMJA 3H25A 4YXDC 2G3AA 3AE8D 3P4QC 1HF9A 3GLMA 3CIRC 2BEQD 3AEEC 1WMKA 2WSCJ 3VRAC 1NYHA 2K9YA 4YSXD 3AECD 4YTPC 3AEFC 2WU5D 4YT0D 1VF5B 5C2TD 2E74B 4I7ZC 3P4SC 2QJYC 3AE4C 2JO1A 3LW5J 1KQFB 1OMIA 3T97B 2BS3C 3AE9D 2WDQD 2QSIA 2H88C 1IK7A 4RKUJ 1DIPA 4H13B 2ACZD 2E75C 3R4YA 5L8RJ 2WDVC 4H44D 3AE3C 4KT0J 1QLBC 2WU2D 3AE2D 4H44B 3SFEC 3ABVC 3D6YA 1KFYD 3AE3D 1U57A 2P10A 3AEDD 4YTND 1OW8A 1KILE 1Q90D 3AECC 4YT0C 5C3JD 1S5LX 3AE5D 1PIXA 4OGQC 3AE9C 5M1BA 3O6QA 1ZP0D 2H89C 3D71A 2O01J 2YIUC 3AE5C 2WS3C 3AEFD 1KF6C 3SFDC 4U7JA 1EXIA 1YQ4C 2WSFJ 3GMAA 2B76C 1E7PC 3AE6D 3P4SD 2BS2C 2YMKA 2WSEJ 4H44C 3Q2YA 2WDVD 4YSXC 3AEGC 4H0LB 1ZOYD 1DD4A 2ZT9B 3VR8C 3P4QD 2D2CC 3RK3E 4TT3H 1AJYA 3CIRD 2E75B 1RQVA 2JP3A 3AEDC 1VF5C 1MKMA 4YTNC 3B71A 4H0LD 3AE7D 3FGAD 3P4RC 3EWKA 1NEKC 2WU2C 1FDIA 1ZRTE 4R4MA 2FYNC 3Q1MA 3AE7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AEB D;  3SFD D;  3AE1 C;  3S9O A;  1NEN D;  2WDQ C;  3AEA D;  2WP9 C;  2H88 D;  3AEE D;  4KX6 D;  3VRB C;  3AEG D;  1L0V D;  5C3J C;  3AE6 C;  1KF6 D;  5C2T C;  1L0V C;  3SFE D;  2H89 D;  3AE2 C;  1YQ3 D;  2WQY C;  3P4P C;  3AEB C;  3AE1 D;  2FBW D;  4YSY C;  3VR9 D;  1OW7 A;  1K04 A;  3VR8 D;  1ZOY C;  3VRA D;  3VR9 C;  2WQY D;  1YQ3 C;  4YXD D;  4YSZ C;  2WS3 D;  2WDR C;  1K05 A;  4YSZ D;  4KX6 C;  3VRB D;  1ZP0 C;  1NEN C;  1PV3 A;  2WP9 D;  2ACZ C;  3AEA C;  4YTM D;  3AE8 C;  1OW6 A;  1KFY C;  3ABV D;  3AE4 D;  1KTM A;  1NEK D;  4YTM C;  2WU5 C;  4YTP D;  3P4P D;  3P4R D;  2FBW C;  1YQ4 D;  2B76 D;  4YSY D;  2BS4 C;  2WDR D;  3AE8 D;  4YXD C;  2G3A A;  3P4Q C;  3CIR C;  3AEE C;  3VRA C;  4YSX D;  3AEC D;  4YTP C;  3AEF C;  2WU5 D;  4YT0 D;  5C2T D;  3P4S C;  3AE4 C;  2BS3 C;  3AE9 D;  2WDQ D;  2H88 C;  2ACZ D;  2WDV C;  3AE3 C;  1QLB C;  2WU2 D;  3AE2 D;  3SFE C;  3ABV C;  1KFY D;  3AE3 D;  3AED D;  4YTN D;  1OW8 A;  3AEC C;  4YT0 C;  5C3J D;  3AE5 D;  3AE9 C;  1ZP0 D;  2H89 C;  3AE5 C;  2WS3 C;  3AEF D;  1KF6 C;  3SFD C;  3AE6 D;  1YQ4 C;  2B76 C;  3P4S D;  1E7P C;  2BS2 C;  2WDV D;  4YSX C;  3AEG C;  1ZOY D;  3VR8 C;  3P4Q D;  3CIR D;  3AED C;  4YTN C;  3B71 A;  3AE7 D;  3P4R C;  1NEK C;  2WU2 C;  3AE7 C; 
#chains in the Genus database with same CATH topology
 1L0N E;  3S9O A;  1AVY A;  1S1C X;  3CWB E;  4KX6 D;  1G2C B;  3Q5S A;  1QVG O;  1PFI A;  3CCL P;  4PV1 C;  2FKW B;  4ZMD A;  4OH8 B;  2OGU A;  5GTH E;  2JEE A;  4WB4 A;  5AVS B;  1CZQ A;  1BDD A;  4W7Y A;  4LGD E;  3L71 D;  3L71 G;  2R32 A;  1Q86 Q;  1GL2 D;  1YQ3 C;  3L73 D;  2KS1 A;  3MP7 B;  3H1H D;  3HD7 D;  2IZ1 A;  3CI9 A;  1FZC A;  3PH0 A;  3L70 D;  1LTJ C;  4L76 A;  2FYU K;  3CL3 D;  2IBZ E;  1EZV E;  1T2K C;  4QMA A;  4H13 C;  1JCC A;  2FXP A;  2N9B A;  2BS4 C;  2RH0 A;  1JY2 N;  1PGQ A;  1GL2 B;  1ZN5 A;  3A0H E;  3K5B A;  4HKZ H;  2IFN A;  1SQX J;  1RE3 A;  1DX7 A;  3AEF C;  2FYU D;  1JTH A;  1PGO A;  1VF5 B;  1N73 B;  3CCU P;  1NTK K;  2P7J A;  1ZLL A;  3A0B H;  3CCM P;  1OX3 A;  3V5B A;  1EXI A;  3BRV B;  3CWB J;  2JP3 A;  2LR2 A;  4UB6 H;  4IL6 E;  2P2U A;  1W2B O;  3HE4 A;  2FYN C;  3TF5 A;  1EXJ A;  1KFM A;  3AEG D;  4JBZ A;  3Q5P A;  3H6P A;  2A06 E;  5K5G B;  3L74 J;  1FZF A;  1HGV A;  1G2C A;  1KYO I;  2M8R A;  3RK2 D;  1NKZ B;  1KB9 E;  2E74 D;  2C0X A;  4RJT A;  1DH3 A;  1OVV A;  1FU1 A;  2ZT9 C;  3GF7 A;  4GIF A;  4YSZ C;  3OJA B;  2FXM A;  4H0L C;  2QJK C;  5TIS E;  2CPS A;  2YKQ A;  3RL0 C;  2IDB A;  3B5N B;  2JWD A;  3RBX A;  4DZO A;  2BCC E;  2NRG A;  4GKG A;  1M90 Q;  3MUD A;  4DOJ A;  5AVZ B;  3Q5R A;  5CJ0 A;  1NTM J;  3BVH A;  3HE5 A;  2FFD A;  4OVN F;  1NHL A;  2WSC J;  3VRA C;  1KV4 A;  4Y99 B;  1OMI A;  4IOI H;  2W83 C;  1DIP A;  1N8R Q;  3PHL A;  2WU2 D;  1S3J A;  1VQO P;  1G1I A;  1SQP G;  3HD7 C;  3M9B A;  3O6Q A;  1JTH B;  1CSB A;  4B86 A;  2W27 A;  1L0L E;  1AJY A;  2M5A A;  1LTT C;  3CME P;  3CCQ P;  1SFC B;  1LTA C;  2KK7 A;  1NEN D;  2AEJ A;  2WPV B;  1VQ9 P;  1L0V D;  5KLV G;  1NTK J;  3A0H H;  4PJ0 E;  1L4A B;  4H13 D;  3W68 A;  1LGH B;  5AW3 B;  3PP5 A;  1PGP A;  5AW5 B;  1IC2 A;  3VR9 C;  3O6Q B;  1XTC C;  2QM8 A;  2BCC G;  3H1K G;  1LT1 A;  2AEF A;  2ZJS E;  2AEM A;  1KIL D;  2ACZ C;  3TGU D;  1IFJ A;  2KZJ A;  1NEK D;  4YTM C;  3M91 A;  2QRX A;  1IFD A;  1T6A A;  2B76 D;  3V4W A;  2N1T A;  3II6 A;  1BGY D;  3GLM A;  1JNM A;  2IFM A;  2WSE H;  3B4S A;  2WPR A;  2WDQ D;  4RKU J;  3GHG B;  1KIL C;  1A02 F;  3L35 A;  3SFE C;  3M9H A;  3D6Y A;  4YTN D;  1KQS O;  1Y8A A;  3L4F A;  2KYV A;  5APV A;  1KF6 C;  3AE6 D;  1LT9 B;  5AVU B;  2WSF J;  2WSE J;  1URQ C;  3P4Q D;  2R3S A;  1DEE G;  1ZW0 A;  3FXD A;  2E42 A;  3AEB D;  4AQR D;  3H1H E;  5TJH A;  2HYN A;  2YMY A;  2O01 H;  3CMA P;  1L0V C;  3H1J D;  3CCR P;  1LT9 C;  1GW4 A;  3AE1 D;  2VRS A;  1SQP K;  4DHJ A;  4DDI A;  1OW7 A;  3M9Q A;  3L71 J;  1NAY A;  2O1J A;  1LWU C;  1NKN A;  1FZG A;  3L73 G;  5E79 E;  2UWJ E;  1YTZ I;  4IL6 X;  1HJ0 A;  1Q7Y Q;  5B66 E;  1KYO D;  1FJK A;  2ZXE B;  2WSC H;  1VQ8 P;  3S4R A;  1L0N G;  2QG4 A;  1NU1 K;  3VMX A;  4D6T D;  2PFX A;  3H32 A;  2Z5H A;  2XZR A;  2FBW C;  2C9L Y;  1YQ4 D;  5APW A;  1FOS E;  5KJ7 A;  3E1I A;  2KSE A;  1WMK A;  3V2P A;  2B89 A;  5C2T D;  1P84 I;  1J1D B;  3I56 P;  3P32 A;  1NJI Q;  2HPC B;  1KQL A;  1M1J A;  4BXL A;  1BE3 J;  3FXE A;  5AW8 B;  3L70 E;  1J1E C;  4U3F G;  3FWN A;  1CI6 A;  1K8A Q;  1MUU A;  1M1K Q;  1DD4 A;  4UB6 E;  2JKV A;  3CWB G;  2YXR B;  1RQV A;  4K3A A;  1RY3 A;  4HYT B;  1GK6 A;  1NH4 A;  4RO0 A;  2PRR A;  5GTI E;  3FWL A;  1RQU A;  2ZFC A;  2IX7 C;  2HFE D;  5KAI E;  2WSF H;  2WQY C;  2JJL A;  3L74 D;  2PAJ A;  4I6M C;  4ZKP A;  5KLI B;  3P8M C;  2WSS H;  1Q81 Q;  1SFC A;  3PLN A;  1SLQ A;  2QE7 H;  2W6J H;  1FC2 C;  1HGZ A;  5CCG A;  1XTG B;  2YO2 A;  3TNU A;  1AA0 A;  2Q7C A;  2KUB A;  1UII A;  3H1I G;  3VYI A;  3P8C E;  1RF0 A;  1BDC A;  2WVR A;  4PV1 D;  4OGQ B;  4W80 A;  1SQV E;  4Y28 J;  1GMJ A;  2PP6 A;  5H2F E;  2W6B A;  4BRY B;  2N1T D;  3CCS P;  2RKL A;  2BS3 C;  1KQF B;  1OFC X;  1PP9 D;  2XND H;  3H1K E;  4D6T E;  1G1J A;  2OYH C;  2KOG A;  5KAI H;  2HR3 A;  5KLV K;  5C39 A;  3MGN A;  3NTN A;  4W7Z A;  1KIL E;  3AE5 D;  3KZI H;  1ZP0 D;  1S4X A;  3CCJ P;  3CC4 P;  1CW5 A;  2ZXX A;  3JCU E;  3B5N A;  4H44 C;  1IFI A;  1Q2N A;  3R2P A;  1L4A D;  2IYP A;  3TSI A;  4AUW A;  1T3J A;  3FGA D;  1R5L A;  4R4M A;  1MFZ A;  4WY4 A;  2E5Y A;  5AW4 B;  2KZI A;  3CXH I;  2E76 C;  4GOF A;  3H1K J;  3CPW O;  2Y0D A;  4WVZ A;  2WTY A;  1LTJ A;  2Y9Y A;  3CCE P;  2YIU B;  1HH0 A;  3I55 P;  2D2C D;  1JEK A;  1MZ9 A;  1SQX E;  1BE3 D;  3WMM 0;  3AEA C;  3L72 D;  1NTK D;  1YI2 P;  1J2J B;  2G8Y A;  3ZDM A;  1GK4 A;  2C9N Y;  4YTP D;  4KHX A;  2NPS C;  3P4P D;  2CK3 H;  3TGU J;  5KJ7 D;  2Q3E A;  2KSJ A;  1GU4 A;  3GG2 A;  3H25 A;  5E79 H;  3P7K A;  1H8A A;  1N73 A;  3A2A A;  3P4S C;  4EYY Q;  2JO1 A;  4HH2 A;  1BGY G;  2ACZ D;  1Z56 A;  4TLF A;  1NO4 A;  3N7N A;  4LC1 A;  2M0B A;  3GW6 A;  2NPS B;  2GUV A;  1SQP J;  2A45 G;  3CC7 P;  5AW9 B;  3AEF D;  1X0T A;  3Q2Y A;  1LWU B;  4H0L B;  1SQB G;  2IBZ I;  5AVT B;  1JO5 A;  1WT6 A;  1SVF A;  4ZNC A;  4I2L C;  1VQ5 P;  3C1L A;  3W67 A;  4I6L A;  3SFD D;  4PV1 B;  4C46 A;  1QLE D;  2H88 D;  2MKV A;  3AEE D;  1S5L H;  1KF6 D;  2QVA A;  3AE6 C;  3EFG A;  3OAK A;  1KB9 H;  1BCC D;  1USE A;  1P84 H;  3LIE A;  3H1J J;  1JY3 N;  1H0T A;  3RK3 C;  1ZXG A;  3QH9 A;  1VQ7 P;  3G71 P;  1M57 D;  3USS A;  1IJD B;  1ZOY C;  1SQQ J;  3V2R A;  4YXD D;  1VDF A;  1M8O B;  1S9K E;  4YSZ D;  3VN0 A;  1NTK G;  1W2E A;  1FDO A;  1OW6 A;  1ZME C;  1S5L E;  3MIW A;  4PD4 D;  3PRJ A;  4EDF A;  4N6J A;  2ZYA A;  4C7N A;  3WUU A;  4YSY D;  4EIJ A;  2IPP A;  3P4Q C;  1HF9 A;  3HD7 A;  5APU A;  1X79 B;  4YSX D;  1CI6 B;  2E74 B;  4I7Z C;  1EC5 A;  1SQP E;  1IFN A;  1HTL C;  2L5G B;  4PJ0 H;  1QLB C;  1BSN A;  2Y0E A;  5C3J D;  2WT7 A;  1PPJ D;  3TYY A;  5KTB A;  2BS2 C;  3NMD A;  2M3B A;  3AED C;  5KLV E;  1SS1 A;  3E7K A;  3P4R C;  1NEK C;  2A06 D;  1EZV D;  2QJY B;  3AEA D;  1FS0 E;  1ZR2 A;  3O8Z A;  1L4A A;  3VOP A;  5CBO A;  2HPC A;  4GOD A;  1YTZ T;  3VR9 D;  5APS A;  4DT0 A;  4JYC A;  5CBN A;  2WQY D;  1L2P A;  3U1A A;  2WS3 D;  3M06 A;  2N1T C;  4OGQ D;  3EQ2 A;  5KLV J;  2E75 D;  1PP9 E;  3L75 J;  1KFY C;  2IYO A;  1JB0 J;  1NAF A;  1GZL A;  4BRY A;  2Q1K A;  1RE3 C;  2O01 N;  3MZW B;  2C0W A;  3MD0 A;  3BCC E;  5KKZ C;  4YXD C;  3IF4 A;  2BEQ D;  1YIJ P;  1KB9 I;  1RF1 B;  1H89 A;  1NYH A;  2K9Y A;  2SPZ A;  1LT9 A;  3H1L D;  3JCU H;  1X9V A;  2WMM A;  1JCD A;  3HE5 B;  2H88 C;  1RF1 C;  2WDV C;  1NTZ D;  1BE3 E;  2K9J B;  1JY3 O;  2O1K A;  4KJM A;  3N4X A;  2O01 J;  1GW3 A;  3P8C D;  1NTM K;  2XV5 A;  3LW5 H;  4JPZ B;  3GHG C;  2I1J A;  2YKO A;  3CX5 E;  5B66 H;  4U3F D;  1N7S C;  3OA7 A;  3EWK A;  4XA4 A;  1L0N D;  4I7Z B;  5B5E E;  1YBK A;  5C3J C;  2GA1 A;  2ZT9 D;  4YXW H;  3B5N C;  1S72 P;  3L73 J;  5B5E H;  1LP1 B;  2V4H A;  2FYZ A;  3VP8 A;  1FZA A;  3HE4 B;  3D6Z A;  3D70 A;  3WUV A;  2BAS A;  3RGU A;  2R5B A;  3FX0 A;  1EZV I;  5APQ A;  3L36 A;  1M1J B;  1J1E B;  3Q3D A;  4HJG H;  2WZ7 A;  5GTI H;  2W6A A;  3WUT A;  2H7H A;  3UIA A;  1PZQ A;  1VPC A;  2R5D A;  4Z1M H;  2CPB A;  3H1L E;  2G3A A;  2ZYG A;  3HTK A;  2LXB A;  1SQB K;  3H32 B;  3A7O A;  2WU5 D;  3HRN A;  2KXP B;  2QSI A;  3CXH D;  2J59 M;  1SQX G;  4EOT A;  1LTS C;  5CCG C;  2LKM A;  3AE3 D;  3AED D;  1URQ B;  4DJG A;  1M7L A;  3L72 E;  1S5L X;  3PTZ A;  1T3U A;  3SFD C;  2FFD B;  1LJ2 A;  3AEG C;  1JY2 P;  2KLV A;  2N9Y B;  3CIR D;  3H1I D;  3HUS B;  3KHU A;  2E75 B;  4UB8 H;  1KN7 A;  2A06 G;  3AE7 C;  2KB7 P;  4L74 A;  1WRG A;  1NU1 G;  4N3Y B;  1GD2 E;  1JMB A;  2Q6Q A;  3OW2 O;  3SSU A;  2PGD A;  1JOC A;  1OVU A;  4LLH A;  4MN4 C;  2E43 A;  5KAF E;  3LID A;  4YSY C;  2FFD C;  2E76 B;  2XU6 A;  1KB9 D;  2AXT H;  3G9R A;  1PL5 A;  1SQB E;  1E5W A;  1NGM B;  1YJN P;  2B87 B;  1VQM P;  1NEN C;  3HUS C;  3ABV D;  1IZN B;  1QEX A;  3H1L J;  1L4A C;  2BCC D;  2K88 A;  1VQK P;  2HOD B;  1KC8 Q;  1OVR A;  5AVX B;  4D6T G;  3H1I J;  3MHV A;  4NPD A;  2Y0C A;  5BU5 A;  1S9K D;  1SQB J;  1BGY J;  4UB8 E;  3R4Y A;  1N2D C;  3A3Y B;  1NTK E;  3ABV C;  1U57 A;  1PP9 G;  2P10 A;  1OW8 A;  2QA4 P;  2YIU C;  1T8Z A;  5GTH H;  1VQN P;  3NFQ A;  3KYQ A;  1KFN A;  2Z5I A;  3KXD A;  5CCG D;  3HTK B;  1EDJ A;  1LTJ B;  2OYH B;  2GM4 A;  2QJK B;  1HVV A;  5KKZ B;  3RL0 g;  1TU3 F;  2WP9 C;  2V7Q J;  2Y9Z A;  5CMZ A;  4DDG A;  2I8D A;  1AQT A;  1FZB A;  5AVY B;  1PP9 J;  2KS1 B;  2E74 C;  3SWF A;  1VF5 D;  2OTL P;  3VR8 D;  5BVZ A;  2ZFY A;  1NTZ K;  1KIL A;  1K9M Q;  2QJP C;  3VMZ A;  1MV8 A;  3AE4 D;  1YJW P;  3S1K A;  2OTK E;  2OYI A;  1RHZ B;  1UIX A;  1FAV A;  1NTZ G;  3H1K D;  3AE8 D;  3RL0 D;  1BGY E;  4YT0 D;  1NWQ A;  1W5C E;  3V6I A;  3RK2 C;  3AE9 D;  2YXQ B;  3CX5 I;  2NPS D;  3TNU B;  1ZR4 A;  1IK9 A;  3L74 G;  1N7S D;  2B87 A;  1R5S A;  1NTZ J;  4H44 B;  2K1A A;  2O3J A;  5AVR B;  1TFF A;  4OGQ C;  3WU2 H;  1FZE A;  1SQX D;  1YQ4 C;  4Y99 C;  3A5T A;  1SQV J;  1QGK B;  2IBZ D;  3KPE A;  3VR8 C;  2D2C C;  4TT3 H;  4HB1 A;  1VF5 C;  1PPJ G;  1FDI A;  1FDM A;  3BRT B;  3TGU G;  4EI2 A;  4IFD K;  1OIP A;  1RH5 B;  1BE3 G;  5AW7 B;  5CHX A;  1NTZ E;  1FJP A;  2A45 H;  3JSV C;  4L75 A;  2D2C B;  2POH A;  1USD A;  3IAO A;  1M56 D;  1L0N J;  3VMY A;  5KLV D;  1URQ A;  4JYB A;  2YO3 A;  4KX6 C;  1HBW A;  1HWT C;  2V7Q H;  1VQ4 P;  1SQV K;  1ZP0 C;  1KMI Z;  1RF0 C;  3M0D A;  1AQ5 A;  2OYI B;  4YTM D;  2Q9I A;  3BCC G;  2QIW A;  3KZI E;  1VQ6 P;  2W90 A;  1KOR A;  5CCH A;  3BAT A;  2R3C A;  2YNY A;  3RBZ A;  1SQV D;  5BU8 B;  2B9B A;  4ASW A;  4ASV A;  3CC2 P;  1N86 A;  4PD4 H;  1NU1 J;  1FZC C;  3CIR C;  3AEC D;  4A7P A;  1E79 H;  2Q3I A;  2GUS A;  3A0B E;  2H43 A;  2ZVN B;  4H13 B;  3IFM A;  2KI7 B;  3AE3 C;  1KFY D;  2ZYD A;  1X8Y A;  3KQG A;  3AE9 C;  2H89 C;  3WU2 E;  2B76 C;  3TGU E;  2AXT E;  1KZU B;  1LP1 A;  1NOH A;  1ZOY D;  2MJZ A;  2ZT9 B;  3RK3 E;  4U3F J;  2WIT A;  2ZAE B;  1MFT A;  4XE5 B;  1KIL B;  1AFO A;  4DHI B;  5KAF H;  1YJ9 P;  2P67 A;  3EFF K;  3TDK A;  1D7M A;  3B8E B;  1YHQ P;  3CLQ A;  3VRB C;  1NTM D;  3SFE D;  2E5T A;  3U59 A;  3L70 J;  3L75 E;  1DEB A;  1VQL P;  5AW6 B;  3L72 G;  1R8E A;  2KP8 A;  2FBW D;  3ITK A;  2FYN B;  2OAR A;  2P1J A;  3T97 A;  3GF3 A;  1NVO A;  5AW1 B;  1JM0 A;  1P84 D;  1GU5 A;  2FYU E;  3E1R A;  1SFC D;  2Q5U A;  3VTP C;  1H0T B;  2OYH A;  3BAS A;  3H1I E;  5EFW B;  4D6T J;  4C7N B;  2R44 A;  3JC2 2;  3GHG A;  1SQV G;  1KTM A;  3VMA A;  1NU1 E;  2WU5 C;  1RF1 A;  2W8Z A;  1N73 C;  2FY8 A;  2WDR D;  2K37 A;  1N7S B;  4M3L A;  1EZV G;  3AEE C;  1QX8 A;  1HJB A;  2WPS A;  3SWY A;  1SFC C;  5KJ7 C;  2A45 I;  1L0N K;  5L8R J;  3F89 A;  4I1L A;  4IFM A;  4WBA A;  3CD6 P;  1Y47 A;  4BWN A;  3D71 A;  2QJP B;  3SWK A;  3L71 E;  2YMK A;  3L73 E;  3RL0 B;  1GTW A;  3B5N D;  4YTN C;  1OWA A;  3B71 A;  4N78 D;  3AE1 C;  1JUN A;  2WDQ C;  1EDK A;  1DD3 A;  1L0L G;  3G6E P;  2OTJ P;  3L75 D;  2IBZ G;  5DJT B;  1HUC A;  2NPS A;  2LXC B;  5C2T C;  2H89 D;  2NZ2 A;  3L74 E;  1H88 A;  2M5A B;  3CX5 H;  3G3Z A;  1K04 A;  3G4S P;  2P58 A;  3VRA D;  4ZKU A;  4C7R A;  1ZRT D;  1AVO A;  1GL2 A;  3L72 J;  2J58 A;  1IFP A;  1PPJ E;  1LTG C;  2XDJ A;  2YKP A;  4CPG A;  4JF7 A;  2KNC A;  1SQQ D;  2FXO A;  2ITA A;  2BCC J;  3H1L G;  4WY4 B;  1VL2 A;  3HD7 B;  1AV1 A;  3RK3 B;  2Z4E A;  3U1C A;  1Y9B A;  2KIK A;  3CXH E;  1QL2 A;  2JDI H;  5AVW B;  2ZVO B;  3CCV P;  4RES B;  1LNQ A;  1RE4 C;  3AE4 C;  3TK1 A;  2AXC A;  2XNX A;  5APX A;  2E75 C;  1GDT A;  4KT0 J;  3V2Q A;  4DCK A;  3M0A A;  1U7M A;  3AE2 D;  1M1J C;  3QWO C;  1QVF O;  2JWA A;  3AEC C;  1KYO E;  3AE5 C;  4WWI A;  5AVQ B;  2WS3 C;  3GMA A;  4JQ0 D;  4YSX C;  4NPE A;  3BCC J;  1N7S A;  1T2K D;  1FBM A;  3AE7 D;  4U7J A;  2M3E A;  2J5U A;  4IFF A;  1VQP P;  4PD4 I;  2BEZ F;  1BCC E;  1SQQ K;  2K9J A;  4NPF X;  2B88 A;  3AE2 C;  2E76 D;  1GL2 C;  5APT A;  1YQ3 D;  4FJV A;  1KD1 Q;  5AW0 B;  3H1H G;  3HUS A;  1NTM G;  1A02 J;  4K35 A;  4XFJ A;  3MUD C;  1IO4 A;  2QM7 A;  2DW3 A;  4N78 E;  4YPC A;  3NXS A;  3F5H A;  3RK3 D;  2I1K A;  1SP4 A;  3IN6 A;  2H8P D;  1LTI C;  1OXZ A;  1X22 A;  5AVV B;  1QL1 A;  4PD4 E;  5CCH D;  1RE4 A;  4L73 A;  3L37 A;  3L75 G;  1L0L D;  3PJS K;  3H1H J;  4GOE A;  3IR9 A;  3BCC D;  1EDL A;  1SQQ E;  3V2N A;  1SQP D;  3LW5 J;  3T97 B;  1KYO H;  3KDP B;  2QEX P;  1IK7 A;  2N1T B;  1OZH A;  2KNC B;  2IZ0 A;  2K3R A;  1JY3 P;  1L0L K;  2JR8 A;  3I5C A;  3MTU E;  1Q82 Q;  4GT1 A;  4YT0 C;  1BSH A;  1NTM E;  5M1B A;  2L91 A;  2KLU A;  3C9I A;  3P4S D;  1NU1 D;  4DHZ A;  2OYI C;  5TIS H;  3CXH H;  1MKM A;  4H0L D;  1BCC G;  1BCC J;  2WU2 C;  1P84 E;  2RN0 A;  1N7L A;  2FYU J;  5APY A;  4WY4 C;  1J1D C;  2RMZ A;  3RK2 B;  4AYC A;  1FZC B;  3P4P C;  3CWB D;  1K73 Q;  3H1J G;  1SQB D;  3AEB C;  2WWW A;  1L0L J;  2XKM A;  1JMM A;  1S2E A;  1URQ D;  4IL6 H;  3VP9 A;  4O9B A;  2WDR C;  1K05 A;  3VRB D;  3C8V A;  1PV3 A;  1FOS F;  1LTB C;  2WP9 D;  3AE8 C;  5DJU B;  4R4L A;  2OQQ A;  2WT7 B;  1IFM A;  4LDT A;  1SQQ G;  4GDO A;  3P4R D;  5KLI C;  1SQX K;  1KQG B;  1ZV8 A;  3V4Q A;  4YTP C;  4OWF A;  2FYU G;  2QJY C;  5CJ4 A;  5H2F H;  1U7J A;  2OYO A;  2HOD A;  4H44 D;  2WPQ A;  3H1J E;  3VON A;  1YIT P;  1Q90 D;  1PIX A;  4WY4 D;  1JY2 O;  3M0D C;  5AW2 B;  1FE6 A;  1EQ7 A;  2HG5 D;  1E7P C;  1PGJ A;  1EDI A;  2WDV D;  3L70 G;  5CCH C;  4U3F E;  2HLO A;  3CX5 D;  1LWU A;  1YYC A;  1ZRT E;  3Q1M A; 
#chains in the Genus database with same CATH homology
 3AEB D;  3SFD D;  3AE1 C;  4I7Z B;  4PV1 B;  3RL0 g;  3S9O A;  1TU3 F;  1EXJ A;  1NEN D;  2WDQ C;  3AEA D;  2WP9 C;  2J5U A;  1S1C X;  2H88 D;  1DD3 A;  2WPV B;  2MKV A;  3AEE D;  4KX6 D;  3VRB C;  3AEG D;  1L0V D;  1RQU A;  5C3J C;  2E76 C;  2BEZ F;  3AE6 C;  3Q5S A;  1KF6 D;  2V7Q J;  5C2T C;  1L0V C;  3SFE D;  2H89 D;  3AE2 C;  3Q5P A;  2E76 D;  2NZ2 A;  1YQ3 D;  2WQY C;  2ZT9 D;  4PV1 C;  3P4P C;  4H13 D;  3AEB C;  3AE1 D;  2E74 C;  1R8E A;  2FBW D;  4YSY C;  2E76 B;  4XFJ A;  2E74 D;  1VF5 D;  3GF3 A;  3VR9 D;  2D2C B;  1OW7 A;  1K04 A;  3VR8 D;  1ZOY C;  3VRA D;  3VR9 C;  2D2C D;  3G9R A;  2WQY D;  1PL5 A;  1YQ3 C;  3IAO A;  2ZT9 C;  4YXD D;  3GF7 A;  3D6Z A;  4YSZ C;  3D70 A;  4H0L C;  4IL6 X;  2QJK C;  2WS3 D;  1HJ0 A;  2WDR C;  1K05 A;  4YSZ D;  4KX6 C;  3VRB D;  1NGM B;  3C8V A;  4OGQ D;  1ZP0 C;  1NEN C;  1PV3 A;  2QJP C;  1KMI Z;  2E75 D;  2IDB A;  2ACZ C;  2WP9 D;  3AEA C;  3IN6 A;  1FDO A;  4YTM D;  3AE8 C;  3Q3D A;  1OW6 A;  1KFY C;  2QIW A;  3ABV D;  1ZME C;  4R4L A;  3AE4 D;  1KTM A;  1NEK D;  2OQQ A;  4YTM C;  2G8Y A;  1JB0 J;  2WU5 C;  4YTP D;  1KOR A;  4GDO A;  4PV1 D;  3P4P D;  1VL2 A;  1UIX A;  4H13 C;  4OGQ B;  3P4R D;  2FXP A;  2FBW C;  1YQ4 D;  2B76 D;  4YSY D;  5KLI C;  5KKZ C;  2BS4 C;  4Z1M H;  2WDR D;  1Y9B A;  3Q5R A;  4Y28 J;  1KQG B;  1GMJ A;  3H25 A;  4YXD C;  2G3A A;  3AE8 D;  3P4Q C;  1HF9 A;  3GLM A;  3CIR C;  2BEQ D;  3AEE C;  1WMK A;  2WSC J;  3VRA C;  1NYH A;  2K9Y A;  4YSX D;  3AEC D;  4YTP C;  3AEF C;  2WU5 D;  4YT0 D;  1VF5 B;  5C2T D;  2E74 B;  4I7Z C;  3P4S C;  2QJY C;  3AE4 C;  2JO1 A;  3LW5 J;  1KQF B;  1OMI A;  3T97 B;  2BS3 C;  3AE9 D;  2WDQ D;  2QSI A;  2H88 C;  1IK7 A;  4RKU J;  1DIP A;  4H13 B;  2ACZ D;  2E75 C;  3R4Y A;  5L8R J;  2WDV C;  4H44 D;  3AE3 C;  4KT0 J;  1QLB C;  2WU2 D;  3AE2 D;  4H44 B;  3SFE C;  3ABV C;  3D6Y A;  1KFY D;  3AE3 D;  1U57 A;  2P10 A;  3AED D;  4YTN D;  1OW8 A;  1KIL E;  1Q90 D;  3AEC C;  4YT0 C;  5C3J D;  1S5L X;  3AE5 D;  1PIX A;  4OGQ C;  3AE9 C;  5M1B A;  3O6Q A;  1ZP0 D;  2H89 C;  3D71 A;  2O01 J;  2YIU C;  3AE5 C;  2WS3 C;  3AEF D;  1KF6 C;  3SFD C;  4U7J A;  1EXI A;  1YQ4 C;  2WSF J;  3GMA A;  2B76 C;  1E7P C;  3AE6 D;  3P4S D;  2BS2 C;  2YMK A;  2WSE J;  4H44 C;  3Q2Y A;  2WDV D;  4YSX C;  3AEG C;  4H0L B;  1ZOY D;  1DD4 A;  2ZT9 B;  3VR8 C;  3P4Q D;  2D2C C;  3RK3 E;  4TT3 H;  1AJY A;  3CIR D;  2E75 B;  1RQV A;  2JP3 A;  3AED C;  1VF5 C;  1MKM A;  4YTN C;  3B71 A;  4H0L D;  3AE7 D;  3FGA D;  3P4R C;  3EWK A;  1NEK C;  2WU2 C;  1FDI A;  1ZRT E;  4R4M A;  2FYN C;  3Q1M A;  3AE7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...