3AEGC

Crystal structure of porcine heart mitochondrial complex ii bound with n-biphenyl-3-yl-2-iodo-benzamide
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with N-Biphenyl-3-yl-2-iodo-benzamide
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 48
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3aegC01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3aegC02
3VRBC 1YQ4C 3VR9D 3B71A 1ZOYD 3P4PC 3VR9C 3AE4C 3AEFC 1OW7A 4YTPC 3VRAD 1KTMA 1K05A 3S9OA 1KF6D 2ACZD 4YXDD 1KF6C 2ACZC 3VR8D 3AE2C 4YXDC 3VR8C 3AE7D 1E7PC 3AE7C 5C2TC 2WQYD 2WU2D 1KFYD 3AEDD 2WQYC 1K04A 2WDRD 2WU2C 2BS4C 3VRBD 3AEDC 4YSYD 2WDRC 3ABVC 3P4PD 2H89C 4YTMC 3AE4D 3AEFD 4YSYC 5C3JC 4YTPD 3AE5D 1NENC 1NEKC 2WS3D 3AE5C 3CIRC 4YT0C 2WS3C 3AE2D 2FBWC 3AE9C 2B76C 1ZP0D 2H88C 2WP9D 5C2TD 3SFDC 3AE1D 3AEGC 4YSXC 1ZP0C 2WP9C 3AE1C 2G3AA 3ABVD 2H89D 4YTMD 2BS2C 5C3JD 1NEND 1PV3A 1NEKD 3P4SC 3CIRD 4YT0D 2WU5D 3AEAD 2WDVD 2WU5C 2FBWD 3AE9D 3AEAC 2WDVC 3AEED 3AEEC 2B76D 2H88D 1YQ3D 3SFDD 3AEGD 4YSXD 4YSZC 4YTND 1YQ3C 3AEBD 4YTNC 3AEBC 3AE8D 1L0VD 3AE8C 1L0VC 1ZOYC 3P4SD 3AE6D 3VRAC 1QLBC 3AE3D 3AE6C 4KX6D 3AE3C 3P4QD 4KX6C 1OW6A 3P4QC 4YSZD 2WDQD 1OW8A 2WDQC 2BS3C 3AECD 3SFED 3P4RD 1YQ4D 1KFYC 3AECC 3SFEC 3P4RC
chains in the Genus database with same CATH superfamily
4GODA 1L0LD 4EYYQ 3EFFK 1HBWA 4WB4A 1SQQE 3H1LD 3CWBJ 4YXDC 1SFCA 2Y9ZA 2E5TA 3A3YB 2KLVA 2QA4P 1FBMA 2KNCB 2ZT9D 5DJTB 3M0AA 4L74A 3TF5A 3L4FA 1S9KD 1KYOH 4UB6E 4DHZA 1Z56A 2P58A 5B66H 1USEA 1K73Q 5AVYB 5KAFE 2C0WA 2O1JA 5KKZC 3PRJA 3CMAP 1SQVE 2J5UA 2YIUC 1Q7YQ 3G9RA 2R5BA 2QM8A 3M9QA 1EZVE 4MN4C 1M90Q 5BU5A 1MUUA 1YTZI 1IFMA 3GHGC 2JP3A 4IL6E 3SFDD 1VF5D 2KS1B 3UIAA 4Z1MH 2FYUD 4WY4D 1HF9A 1ZMEC 2C9NY 1AFOA 1FDOA 3GF3A 3Q3DA 2HPCA 1VQPP 2IFNA 1PZQA 3KXDA 1VQ6P 1Q2NA 1SQXJ 4H44C 2KOGA 2Q1KA 1SQPK 2D2CB 2HYNA 3HUSA 3VR9D 1Q86Q 1AQ5A 2V4HA 3FXEA 1OW7A 2I8DA 2WSCJ 4EDFA 1KF6C 3GHGA 1T2KD 3RK2C 1GU4A 2JKVA 2ZVNB 3CCJP 1JEKA 2WU2D 4DDGA 1X22A 1NU1E 2WDRD 3RK3D 1HUCA 1RF1A 3E1IA 1KFMA 2WTYA 1QX8A 2PP6A 2QRXA 3T97B 1G1JA 2B87B 1RE3C 1BE3E 2W6AA 2LR2A 4U3FE 4C7NB 2R3SA 4HYTB 1N73A 1RY3A 5AVQB 3VOPA 3H1HE 1M8OB 2FBWD 1AV1A 1RF0C 1ZXGA 2A06E 1JOCA 3CCQP 1DIPA 3AEGD 2A45G 2FYNB 4JPZB 3L73J 1BDCA 4OGQC 2B89A 1PPJE 1KILB 3HRNA 3L75G 2I1JA 2E42A 2OYHA 2BEZF 3C9IA 2E74D 1P84E 1N86A 2IPPA 4LC1A 1RE3A 2E76C 1YQ4D 3AECC 1NTKK 3B8EB 3VONA 4XFJA 2M3EA 2AEFA 2WSEH 1FZFA 1T8ZA 1FS0E 1SQPJ 4K35A 2HODB 1RF0A 3JC22 5KLIC 1NTKG 3P32A 2NPSB 3AE7D 1IZNB 1BCCD 3TGUD 1H88A 1EDLA 4KHXA 3RL0g 1JY3N 4KJMA 2JJLA 3B5NB 1PIXA 3L74G 3L72E 4D6TD 3AE5D 3EQ2A 4I2LC 2IYPA 1IFDA 3AE9C 3IFMA 3MUDC 3H1LJ 1NJIQ 1PGPA 2P7JA 3L70E 4PD4E 3AE1D 4XE5B 1SFCB 2WPRA 1JCCA 1KZUB 2IZ1A 2Q7CA 3RBZA 1G1IA 1N2DC 2H89D 1YJWP 5APQA 1KILE 5CHXA 3P4SC 3V2QA 2WU5D 1CW5A 4H0LB 1NAYA 2H88D 4YSXD 4UB8H 5H2FH 5K5GB 4YTNC 1DD3A 2YXRB 2QJPB 4N78D 4WVZA 3KZIE 3G71P 3L75J 2N1TD 4GIFA 1IFIA 3P7KA 2N9YB 1G2CA 3H1JD 1R5LA 3MUDA 3S1KA 1KFYC 2ZXXA 1K8AQ 1AVOA 3CX5H 1LTAC 3RBXA 3IAOA 3O6QB 2QIWA 1EDIA 4ZMDA 2BCCG 2HPCB 1H89A 1QVGO 2K88A 5CCGA 3RL0D 5C39A 2GM4A 1USDA 5APUA 1URQC 1L0NE 5KKZB 4EOTA 2YIUB 1KC8Q 2H7HA 2KLUA 3L74J 1AA0A 4ASWA 1KQLA 4NPDA 1NO4A 3AE4D 3L71G 2JEEA 3N4XA 3HUSB 2P67A 3BCCD 5AW2B 1SQBD 2WSFH 2JR8A 3GHGB 5C2TD 1FDIA 2ZFYA 2R5DA 4CPGA 1SQQD 1MFTA 5KJ7C 2H8PD 1FOSF 1NEKD 1KYOE 3HD7D 1RF1B 1HGZA 2CPBA 5B66E 3M9BA 1FZEA 3AEAC 3CCUP 3VMAA 2KUBA 1LT9A 3V2RA 4DJGA 1URQA 4GT1A 2POHA 1J1DC 3IN6A 3GG2A 1PGJA 2CK3H 1YYCA 1L0VC 4O9BA 4OVNF 1SQVD 5CJ0A 1PFIA 1N73B 2K9JA 1N8RQ 2QVAA 1S5LH 2YKPA 2O01N 1NTZE 3P4QC 4YSZD 1SS1A 5BVZA 2E75B 1EZVD 1GK6A 2DW3A 1FZCA 4WWIA 3V4WA 1YHQP 1E5WA 1UIIA 1JY2O 3CCLP 2ZAEB 1A02J 3VR8D 4GOEA 1J2JB 3VMYA 2P2UA 1GZLA 1RHZB 1PP9G 2PAJA 2XZRA 4LLHA 3L71J 2PFXA 4YSYC 3CL3D 1L2PA 1OVRA 1NVOA 3L37A 2OTJP 4IFDK 2LXCB 2K1AA 3CWBG 2A45H 3SFDC 2QE7H 1BCCJ 3TGUJ 5AW1B 2E5YA 3HTKA 4BRYA 1SQBK 2YNYA 1GU5A 4I6MC 1BGYJ 2R44A 3H1IE 1U7MA 5E79H 1LNQA 1HGVA 3SWYA 1NU1D 1NTME 3MHVA 3IR9A 3Q5RA 3O8ZA 1KFNA 2E76B 2FY8A 4PJ0H 3H1KJ 5GTIH 2I1KA 5BU8B 1QLBC 1N7SD 3AE3D 1BE3D 3WUTA 2WPQA 4U3FD 1S1CX 5KLIB 5APWA 3NXSA 4WY4A 4OH8B 3H1HD 1LTBC 4U7JA 2A06D 1K05A 4IL6X 1RH5B 2ACZD 1S4XA 1ZN5A 1VQ7P 1PPJD 2D2CD 4I1LA 1PP9J 4NPEA 2KSJA 2L5GB 2C9LY 1G2CB 3H1JJ 2WQYD 3C8VA 3AEDD 2R32A 3CXHH 3TNUA 4YTPD 1P84D 1FZBA 4N6JA 3AE2D 2FBWC 4A7PA 3I56P 1HWTC 4HKZH 3AEGC 1IJDB 1JNMA 4AUWA 5TJHA 5TISH 2W83C 2ZYDA 2G8YA 3VYIA 2NRGA 1VQNP 3GLMA 1KQFB 3VN0A 1LGHB 2AEJA 3IF4A 3BCCJ 2Y0EA 1TU3F 4BXLA 1SQBJ 2E74C 2OTKE 3L35A 1YQ3C 3L72D 3QWOC 5KLVE 3ZDMA 1SLQA 1L4AD 1ZLLA 1OWAA 1Y9BA 3AE8C 5AVTB 2O1KA 3HUSC 1SQQJ 5AW8B 3L70D 4PD4D 3PTZA 3A2AA 1JMBA 3Q5PA 3AE6C 1H0TA 2Z4EA 1KILD 4UB8E 3FXDA 1SQXE 3HE5B 3L73G 1URQB 2QJYC 5H2FE 3P4RC 1LWUC 3MP7B 1RF1C 1KB9H 3A7OA 3ITKA 5AW3B 2B9BA 1ZW0A 4I7ZB 4HB1A 3CCRP 2K9JB 4PV1D 2ITAA 4TT3H 2KP8A 2H89C 1FZCB 3AEFD 3CX5E 3I55P 1N73C 1KV4A 1S5LX 2WS3D 2NPSD 1SVFA 2IBZI 1M7LA 4JQ0D 4JYCA 1IFJA 1SQPG 4ZKPA 2OARA 2E75C 1ZP0D 2H88C 4HH2A 4YSXC 1OFCX 1L0LK 5KAIH 1JCDA 2HFED 1LWUA 1J1DB 3BVHA 4TLFA 5CCHD 1M1JA 2N9BA 1FOSE 1QEXA 1L0ND 1L0LG 2OYHC 1IC2A 2WDVC 1YJNP 4WBAA 3G6EP 3H1LG 3CI9A 3GW6A 4RO0A 1T3UA 4GKGA 1LTSC 3HTKB 4BRYB 2RMZA 3SSUA 3RL0C 5AW9B 3WMM0 2WDQD 2HR3A 1KYOD 4W7ZA 3Q5SA 3H32A 2IYOA 3TK1A 1ZOYD 3VP8A 2N1TA 3A0BH 3AE4C 3VRAD 4YXDD 2OYIA 1SQPE 3CC4P 1DD4A 2FYUK 1S5LE 1JB0J 1BE3J 4IFFA 5C2TC 4U3FJ 1VQ5P 1MFZA 3P4PD 4XA4A 2FYUG 3H1HJ 1NTZD 1NEKC 3HD7C 2FXOA 2M8RA 4LGDE 3NMDA 4ZKUA 2FXMA 1NYHA 2WP9C 1OXZA 3L36A 4W80A 4JF7A 1M57D 1QVFO 2P10A 1W2BO 4YT0D 1L0LJ 3JCUH 2FFDC 1JM0A 2Q5UA 2QM7A 4YSZC 2C0XA 1VPCA 2FYZA 1S3JA 1JO5A 1SP4A 3L75E 1K9MQ 3HD7A 3RK3B 2LXBA 1CI6A 2YO2A 3MGNA 5E79E 1H8AA 2R3CA 5CCGC 4H44D 3D6ZA 3MIWA 1J1EC 3H1ID 3L72J 2IZ0A 1NTMD 2M0BA 4PJ0E 2WPSA 4M3LA 3CMEP 2FFDA 5GTIE 1KF6D 1DX7A 2XKMA 2WVRA 2WSCH 3BATA 1JMMA 3RK2D 5AVSB 4RKUJ 1NTKE 4K3AA 1OVUA 2MKVA 1LP1A 1JY3O 1PGQA 1W2EA 1W5CE 2FYUJ 4H13C 3L74E 3KPEA 1KORA 1S72P 1KYOI 2YO3A 5AW6B 3P8MC 4BWNA 1MV8A 3V2PA 1EXIA 2B88A 1BSHA 5CJ4A 1LT9C 3FGAD 2E74B 2KK7A 2QG4A 1RE4C 1XTGB 1KD1Q 1KN7A 3CWBD 3E1RA 3CXHE 4I7ZC 5APVA 4EI2A 2E43A 2BASA 3AEEC 1U7JA 4OGQD 2VRSA 3AEBC 2SPZA 1ZRTE 3N7NA 1FZCC 5TISE 1BCCG 3PHLA 3TGUG 1YIJP 2QJYB 2Q6QA 1LWUB 2W6BA 4KT0J 1VQKP 1BGYG 2Q3IA 3CCEP 4D6TG 4KX6C 1L0NJ 2YMKA 5CBOA 1VQ8P 2ZXEB 2FKWB 4DHJA 3TDKA 3AECD 3WU2H 1RE4A 3MZWB 4L76A 3SFEC 3KYQA 2W90A 1M1KQ 1FAVA 2QJKC 4YPCA 2W27A 1PGOA 5AVVB 1WT6A 4YTPC 3H1KG 1X9VA 2ZVOB 3VTPC 1N7SA 3VP9A 2BCCE 5KLVD 3AE2C 3H6PA 1GL2D 2WITA 1NGMB 4N3YB 1JY3P 2ZYGA 2KI7B 1FJPA 3P8CE 3OW2O 3VRBD 2BS4C 2ZT9C 4RJTA 3II6A 4B86A 3H32B 2OTLP 1Y47A 3L71E 1BDDA 1KB9E 3E7KA 4R4MA 4DZOA 5CBNA 3CLQA 2V7QJ 3WUUA 1SQXD 2OYHB 2OYIB 3Q2YA 3S4RA 3PH0A 3H1JG 1DEEG 4L73A 1L4AC 2AEMA 3ABVD 1DH3A 2KYVA 4JYBA 1EDKA 3VMXA 1NTZJ 1BGYE 5B5EE 2B76D 2ZFCA 1GDTA 3EFGA 1OZHA 1X8YA 4YTND 3CX5D 2JWAA 3RL0B 1VF5C 2M3BA 4WY4C 5KAIE 1GD2E 1Q81Q 3D70A 5APXA 3H1KE 2LKMA 1Q90D 2O01J 4C46A 2B87A 4D6TJ 2H43A 1OW6A 3BCCG 1SQQK 2BS3C 1SQBG 1L4AA 3LIEA 3R4YA 3VR9C 3AEFC 1GTWA 1MKMA 1SQQG 2WPVB 2P1JA 3HD7B 1T2KC 1CI6B 2YMYA 3CC7P 1R8EA 3KDPB 1EXJA 4IOIH 1KILA 1PP9E 3NFQA 2WU2C 1JY2P 2WDRC 1SQVK 1UIXA 1NWQA 1BSNA 1VDFA 3RK3C 5KLVK 1JTHA 2JO1A 3OAKA 3A0BE 1NTMJ 5APYA 1IK7A 3WUVA 2FFDB 1SQVG 3CWBE 1LTJC 1ZV8A 5KJ7D 1LP1B 3A0HH 1EZVG 1SQPD 1NEND 1EZVI 1HJBA 3CIRD 2NPSA 1M56D 3V5BA 3AEAD 1FZAA 3GF7A 2JWDA 1RQVA 2Q9IA 1L0VD 5GTHH 4FJVA 1J1EB 2J59M 5CCHA 1ZOYC 3FWLA 2OGUA 1KQGB 3VRAC 1HH0A 3JCUE 3P4QD 1IFPA 5AVXB 1LTJA 1FDMA 1MZ9A 3A5TA 1OIPA 3LW5J 1YQ4C 3P4PC 3CX5I 1AVYA 2WSEJ 2M5AA 4ASVA 3S9OA 4H13B 1NU1K 2V7QH 1AQTA 2YKOA 4JBZA 2KXPB 1E7PC 3AE7C 1VQ4P 2K37A 3L75D 1FC2C 3NTNA 1NU1G 1EQ7A 1LT9B 2WT7A 2XV5A 4YSYD 1X0TA 1D7MA 2IDBA 1KMIZ 1M1JC 2W8ZA 3AE5C 3MD0A 4YT0C 3PJSK 3HE4A 1A02F 1SQVJ 1NKNA 1N7SB 5KLVJ 2O3JA 1DEBA 2OQQA 1WRGA 3USSA 1BE3G 3O6QA 3AE1C 4U3FG 1NKZB 1YBKA 3EWKA 4YTMD 5C3JD 1NTKD 3H1HG 2O01H 2IBZG 2Y0CA 2PRRA 2WU5C 5B5EH 1X79B 2A06G 2XU6A 4RESB 3K5BA 1LTTC 3L74D 3B5ND 4AQRD 1PPJG 3M0DC 1QGKB 1E79H 2N1TC 2QJKB 1HJ0A 3G3ZA 2OYIC 1TFFA 1SFCD 2NZ2A 1P84I 1VL2A 1JUNA 1NH4A 3CXHD 1GW4A 3L73E 5KTBA 3B71A 4H0LD 3U1AA 4Y99C 2Z5HA 2ZT9B 3CCSP 1QLED 4I6LA 1ZRTD 5L8RJ 2KZIA 3BRTB 1NU1J 4GOFA 3MTUE 1K04A 1LT1A 2MJZA 3VMZA 3WU2E 3M0DA 3L72G 2L91A 1L4AB 3CCMP 4OWFA 2IBZE 3V4QA 3CCVP 2AXTH 2WSFJ 3L70G 1OX3A 2A45I 4PD4I 2BCCD 1VF5B 2QEXP 4WY4B 1PV3A 3C1LA 1L0LE 1JTHB 1GW3A 3P8CD 2K3RA 2UWJE 1YQ3D 3D6YA 3TYYA 3H1LE 3L71D 1KB9D 3AE8D 3CC2P 1T6AA 3RGUA 3LW5H 4PV1B 1FU1A 3AE6D 1LJ2A 1EDJA 3TNUB 1OVVA 2YKQA 1S9KE 5DJUB 1GL2C 1OMIA 5AVZB 5AVUB 3P4RD 4UB6H 3VRBC 1BGYD 1ZR4A 1LTGC 3BASA 1L0NK 4YXWH 4Y28J 1T3JA 1HVVA 1NOHA 2HLOA 5KAFH 1Q82Q 3VR8C 1IO4A 1L0NG 5EFWB 3CD6P 3H1KD 2ZYAA 1LTJB 5AW5B 3ABVC 1CZQA 2KIKA 2FYUE 3CXHI 1WMKA 3SWKA 4HJGH 3OA7A 2M5AB 4IL6H 2E75D 1GL2A 3L70J 2B76C 2RH0A 1NAFA 1H0TB 1S2EA 5CMZA 2K9YA 3OJAB 2XNXA 1GMJA 2BS2C 1FZGA 2WT7B 3FX0A 3M06A 2WDVD 3KQGA 3I5CA 1PP9D 3HE4B 1FJKA 1R5SA 3B4SA 1YTZT 3PP5A 3M9HA 1U57A 1NTZK 3F89A 3G4SP 1EC5A 3U59A 5APSA 3A0HE 1QL1A 2OYOA 3V2NA 1N7SC 1NTKJ 3RK3E 2Q3EA 5AVWB 3AE3C 1NTZG 1LTIC 2JDIH 2KNCA 4AYCA 4W7YA 1FE6A 1VQMP 2XNDH 5GTHE 1JY2N 1KTMA 1KB9I 5M1BA 3PLNA 1N7LA 1HTLC 2ACZC 5AW4B 1M1JB 2CPSA 2E76D 2D2CC 2GA1A 4DOJA 2QSIA 2WQYC 3AEDC 2ZJSE 1NENC 2GUSA 3CIRC 1XTCC 4IFMA 2Z5IA 2KS1A 3HE5A 3KHUA 2WP9D 4EIJA 2GUVA 1GK4A 4LDTA 1NTMK 3GMAA 4H44B 5AW0B 4QMAA 3H1IG 2KB7P 2N1TB 3AE9D 4NPFX 1P84H 1VQLP 1NTMG 3RK2B 2RKLA 5KJ7A 4ZNCA 3U1CA 1BCCE 3TGUE 3P4SD 2BCCJ 3M91A 4Y99B 4DDIA 5APTA 2FYNC 5CCGD 1VQ9P 1IFNA 1QL2A 4D6TE 2FXPA 3LIDA 1OW8A 2WWWA 1RQUA 3QH9A 1Y8AA 1KILC 3SWFA 2W6JH 1ZR2A 3T97A 4PD4H 2WZ7A 1VQOP 2HG5D 1YI2P 3D71A 4PV1C 4C7NA 3FWNA 1KFYD 2Y0DA 3W67A 4OGQB 4H13D 2IX7C 3TSIA 4YTMC 1YITP 5C3JC 2IFMA 2PGDA 2RN0A 4DHIB 2WS3C 2NPSC 2J58A 4N78E 1YJ9P 3Q1MA 3L73D 4DCKA 4GDOA 1URQD 1ZP0C 3B5NC 2KSEA 4DT0A 2G3AA 3W68A 3H25A 3H1JE 3KZIH 1CSBA 2YXQB 4C7RA 2BEQD 5CCHC 3CPWO 3H1IJ 2Y9YA 1KQSO 1IK9A 2AXCA 4R4LA 1AJYA 3AEED 1SFCC 2AXTE 4L75A 1GL2B 2XDJA 3AEBD 3V6IA 5KLVG 2IBZD 5AVRB 5AW7B 4H0LC 2WSSH 2HODA 3BRVB 1SQXK 2WMMA 3JSVC 4KX6D 1PL5A 3R2PA 1NHLA 3BCCE 3B5NA 2WDQC 3F5HA 2KZJA 2QJPC 3SFED 1SQBE 1SQXG
chains in the Genus database with same CATH topology
3LW5J 2D2CB 3R4YA 3VRBC 1YQ4C 2QJKC 3VR9D 3B71A 3IAOA 4U7JA 1ZOYD 4H0LD 3P4PC 2QIWA 3VR9C 4XFJA 3AE4C 3AEFC 2WSEJ 1OW7A 4YTPC 4Y28J 2ZT9B 1MKMA 1KTMA 5M1BA 3VRAD 1K05A 3S9OA 1KF6D 4H13B 4IL6X 2ACZD 2WSCJ 4YXDD 2WPVB 1KF6C 2ACZC 4I7ZB 3VR8D 3AE2C 4YXDC 5KLIC 1NGMB 5L8RJ 1DD4A 4RKUJ 3VR8C 3AE7D 1E7PC 1JB0J 1R8EA 2D2CD 4PV1D 3AE7C 1EXJA 2MKVA 2E76D 2D2CC 5C2TC 3D71A 4PV1C 2WQYD 2QSIA 3C8VA 3RL0g 2WU2D 1KFYD 3AEDD 2WQYC 1K04A 4TT3H 2ZT9D 2BS4C 2WDRD 2WU2C 3VRBD 4OGQB 3AEDC 4H13D 1PIXA 4YSYD 2ZT9C 2WDRC 3ABVC 3P4PD 2H89C 1UIXA 4H13C 4YTMC 3AE4D 2IDBA 3AEFD 1KORA 4YSYC 5C3JC 4YTPD 3AE5D 1NENC 1WMKA 2JO1A 1NEKC 1S5LX 1KMIZ 3AE5C 2WS3D 3CIRC 4YT0C 2WS3C 4R4MA 3AE2D 2V7QJ 2FBWC 1IK7A 1EXIA 2E75D 3AE9C 3Q1MA 2WSFJ 5KKZC 2E75C 4GDOA 2J5UA 1ZP0D 2B76C 2YIUC 2H88C 3Q2YA 2OQQA 3T97B 2WP9D 3SFDC 3AE1D 3AEGC 3FGAD 1ZP0C 1FDIA 4YSXC 5C2TD 1NYHA 3O6QA 2WP9C 3AE1C 2G3AA 2E74B 3G9RA 3H25A 2K9YA 4H44B 3GMAA 3EWKA 3ABVD 1VF5B 2H89D 4YTMD 1GMJA 2BS2C 5C3JD 2P10A 2BEQD 2G8YA 1NEND 1PV3A 1KILE 1NEKD 3P4SC 3GLMA 3CIRD 4YT0D 4I7ZC 2WU5D 1KQFB 4H0LB 3AEAD 2WDVD 2WU5C 4R4LA 2FBWD 3AE9D 1AJYA 3AEAC 2JP3A 2WDVC 3AEED 3GF7A 3AEEC 1TU3F 2B76D 1RQVA 3Q5RA 3P4RC 2H88D 1YQ3D 2E74C 3SFDD 1DIPA 3AEGD 4YSXD 1VF5D 4YSZC 4YTND 4OGQD 1YQ3C 4Z1MH 3AEBD 3IN6A 3D6YA 1VF5C 4YTNC 4OGQC 3AEBC 3AE8D 1HF9A 1ZRTE 4PV1B 1ZMEC 1U57A 1DD3A 1L0VD 3D70A 1Y9BA 2E76B 3AE8C 1FDOA 1L0VC 3GF3A 1ZOYC 3Q3DA 4H0LC 3P4SD 1KQGB 3AE6D 3VRAC 4KT0J 1QLBC 1Q90D 2O01J 3Q5PA 1HJ0A 3AE3D 3AE6C 2BEZF 3RK3E 4KX6D 3AE3C 3P4QD 2FYNC 4KX6C 1OW6A 2YMKA 1S1CX 3P4QC 2NZ2A 1PL5A 2E74D 4YSZD 2FXPA 2WDQD 1OW8A 1OMIA 1RQUA 4H44D 2E75B 1VL2A 2WDQC 2BS3C 2E76C 3D6ZA 2QJPC 4H44C 3AECD 3P4RD 3SFED 3Q5SA 1YQ4D 1KFYC 3AECC 3SFEC 2QJYC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VRB C;  1YQ4 C;  3VR9 D;  3B71 A;  1ZOY D;  3P4P C;  3VR9 C;  3AE4 C;  3AEF C;  1OW7 A;  4YTP C;  3VRA D;  1KTM A;  1K05 A;  3S9O A;  1KF6 D;  2ACZ D;  4YXD D;  1KF6 C;  2ACZ C;  3VR8 D;  3AE2 C;  4YXD C;  3VR8 C;  3AE7 D;  1E7P C;  3AE7 C;  5C2T C;  2WQY D;  2WU2 D;  1KFY D;  3AED D;  2WQY C;  1K04 A;  2WDR D;  2WU2 C;  2BS4 C;  3VRB D;  3AED C;  4YSY D;  2WDR C;  3ABV C;  3P4P D;  2H89 C;  4YTM C;  3AE4 D;  3AEF D;  4YSY C;  5C3J C;  4YTP D;  3AE5 D;  1NEN C;  1NEK C;  2WS3 D;  3AE5 C;  3CIR C;  4YT0 C;  2WS3 C;  3AE2 D;  2FBW C;  3AE9 C;  2B76 C;  1ZP0 D;  2H88 C;  2WP9 D;  5C2T D;  3SFD C;  3AE1 D;  3AEG C;  4YSX C;  1ZP0 C;  2WP9 C;  3AE1 C;  2G3A A;  3ABV D;  2H89 D;  4YTM D;  2BS2 C;  5C3J D;  1NEN D;  1PV3 A;  1NEK D;  3P4S C;  3CIR D;  4YT0 D;  2WU5 D;  3AEA D;  2WDV D;  2WU5 C;  2FBW D;  3AE9 D;  3AEA C;  2WDV C;  3AEE D;  3AEE C;  2B76 D;  2H88 D;  1YQ3 D;  3SFD D;  3AEG D;  4YSX D;  4YSZ C;  4YTN D;  1YQ3 C;  3AEB D;  4YTN C;  3AEB C;  3AE8 D;  1L0V D;  3AE8 C;  1L0V C;  1ZOY C;  3P4S D;  3AE6 D;  3VRA C;  1QLB C;  3AE3 D;  3AE6 C;  4KX6 D;  3AE3 C;  3P4Q D;  4KX6 C;  1OW6 A;  3P4Q C;  4YSZ D;  2WDQ D;  1OW8 A;  2WDQ C;  2BS3 C;  3AEC D;  3SFE D;  3P4R D;  1YQ4 D;  1KFY C;  3AEC C;  3SFE C;  3P4R C; 
#chains in the Genus database with same CATH topology
 4GOD A;  1L0L D;  4EYY Q;  3EFF K;  1HBW A;  4WB4 A;  1SQQ E;  3H1L D;  3CWB J;  4YXD C;  1SFC A;  2Y9Z A;  2E5T A;  3A3Y B;  2KLV A;  2QA4 P;  1FBM A;  2KNC B;  2ZT9 D;  5DJT B;  3M0A A;  4L74 A;  3TF5 A;  3L4F A;  1S9K D;  1KYO H;  4UB6 E;  4DHZ A;  1Z56 A;  2P58 A;  5B66 H;  1USE A;  1K73 Q;  5AVY B;  5KAF E;  2C0W A;  2O1J A;  5KKZ C;  3PRJ A;  3CMA P;  1SQV E;  2J5U A;  2YIU C;  1Q7Y Q;  3G9R A;  2R5B A;  2QM8 A;  3M9Q A;  1EZV E;  4MN4 C;  1M90 Q;  5BU5 A;  1MUU A;  1YTZ I;  1IFM A;  3GHG C;  2JP3 A;  4IL6 E;  3SFD D;  1VF5 D;  2KS1 B;  3UIA A;  4Z1M H;  2FYU D;  4WY4 D;  1HF9 A;  1ZME C;  2C9N Y;  1AFO A;  1FDO A;  3GF3 A;  3Q3D A;  2HPC A;  1VQP P;  2IFN A;  1PZQ A;  3KXD A;  1VQ6 P;  1Q2N A;  1SQX J;  4H44 C;  2KOG A;  2Q1K A;  1SQP K;  2D2C B;  2HYN A;  3HUS A;  3VR9 D;  1Q86 Q;  1AQ5 A;  2V4H A;  3FXE A;  1OW7 A;  2I8D A;  2WSC J;  4EDF A;  1KF6 C;  3GHG A;  1T2K D;  3RK2 C;  1GU4 A;  2JKV A;  2ZVN B;  3CCJ P;  1JEK A;  2WU2 D;  4DDG A;  1X22 A;  1NU1 E;  2WDR D;  3RK3 D;  1HUC A;  1RF1 A;  3E1I A;  1KFM A;  2WTY A;  1QX8 A;  2PP6 A;  2QRX A;  3T97 B;  1G1J A;  2B87 B;  1RE3 C;  1BE3 E;  2W6A A;  2LR2 A;  4U3F E;  4C7N B;  2R3S A;  4HYT B;  1N73 A;  1RY3 A;  5AVQ B;  3VOP A;  3H1H E;  1M8O B;  2FBW D;  1AV1 A;  1RF0 C;  1ZXG A;  2A06 E;  1JOC A;  3CCQ P;  1DIP A;  3AEG D;  2A45 G;  2FYN B;  4JPZ B;  3L73 J;  1BDC A;  4OGQ C;  2B89 A;  1PPJ E;  1KIL B;  3HRN A;  3L75 G;  2I1J A;  2E42 A;  2OYH A;  2BEZ F;  3C9I A;  2E74 D;  1P84 E;  1N86 A;  2IPP A;  4LC1 A;  1RE3 A;  2E76 C;  1YQ4 D;  3AEC C;  1NTK K;  3B8E B;  3VON A;  4XFJ A;  2M3E A;  2AEF A;  2WSE H;  1FZF A;  1T8Z A;  1FS0 E;  1SQP J;  4K35 A;  2HOD B;  1RF0 A;  3JC2 2;  5KLI C;  1NTK G;  3P32 A;  2NPS B;  3AE7 D;  1IZN B;  1BCC D;  3TGU D;  1H88 A;  1EDL A;  4KHX A;  3RL0 g;  1JY3 N;  4KJM A;  2JJL A;  3B5N B;  1PIX A;  3L74 G;  3L72 E;  4D6T D;  3AE5 D;  3EQ2 A;  4I2L C;  2IYP A;  1IFD A;  3AE9 C;  3IFM A;  3MUD C;  3H1L J;  1NJI Q;  1PGP A;  2P7J A;  3L70 E;  4PD4 E;  3AE1 D;  4XE5 B;  1SFC B;  2WPR A;  1JCC A;  1KZU B;  2IZ1 A;  2Q7C A;  3RBZ A;  1G1I A;  1N2D C;  2H89 D;  1YJW P;  5APQ A;  1KIL E;  5CHX A;  3P4S C;  3V2Q A;  2WU5 D;  1CW5 A;  4H0L B;  1NAY A;  2H88 D;  4YSX D;  4UB8 H;  5H2F H;  5K5G B;  4YTN C;  1DD3 A;  2YXR B;  2QJP B;  4N78 D;  4WVZ A;  3KZI E;  3G71 P;  3L75 J;  2N1T D;  4GIF A;  1IFI A;  3P7K A;  2N9Y B;  1G2C A;  3H1J D;  1R5L A;  3MUD A;  3S1K A;  1KFY C;  2ZXX A;  1K8A Q;  1AVO A;  3CX5 H;  1LTA C;  3RBX A;  3IAO A;  3O6Q B;  2QIW A;  1EDI A;  4ZMD A;  2BCC G;  2HPC B;  1H89 A;  1QVG O;  2K88 A;  5CCG A;  3RL0 D;  5C39 A;  2GM4 A;  1USD A;  5APU A;  1URQ C;  1L0N E;  5KKZ B;  4EOT A;  2YIU B;  1KC8 Q;  2H7H A;  2KLU A;  3L74 J;  1AA0 A;  4ASW A;  1KQL A;  4NPD A;  1NO4 A;  3AE4 D;  3L71 G;  2JEE A;  3N4X A;  3HUS B;  2P67 A;  3BCC D;  5AW2 B;  1SQB D;  2WSF H;  2JR8 A;  3GHG B;  5C2T D;  1FDI A;  2ZFY A;  2R5D A;  4CPG A;  1SQQ D;  1MFT A;  5KJ7 C;  2H8P D;  1FOS F;  1NEK D;  1KYO E;  3HD7 D;  1RF1 B;  1HGZ A;  2CPB A;  5B66 E;  3M9B A;  1FZE A;  3AEA C;  3CCU P;  3VMA A;  2KUB A;  1LT9 A;  3V2R A;  4DJG A;  1URQ A;  4GT1 A;  2POH A;  1J1D C;  3IN6 A;  3GG2 A;  1PGJ A;  2CK3 H;  1YYC A;  1L0V C;  4O9B A;  4OVN F;  1SQV D;  5CJ0 A;  1PFI A;  1N73 B;  2K9J A;  1N8R Q;  2QVA A;  1S5L H;  2YKP A;  2O01 N;  1NTZ E;  3P4Q C;  4YSZ D;  1SS1 A;  5BVZ A;  2E75 B;  1EZV D;  1GK6 A;  2DW3 A;  1FZC A;  4WWI A;  3V4W A;  1YHQ P;  1E5W A;  1UII A;  1JY2 O;  3CCL P;  2ZAE B;  1A02 J;  3VR8 D;  4GOE A;  1J2J B;  3VMY A;  2P2U A;  1GZL A;  1RHZ B;  1PP9 G;  2PAJ A;  2XZR A;  4LLH A;  3L71 J;  2PFX A;  4YSY C;  3CL3 D;  1L2P A;  1OVR A;  1NVO A;  3L37 A;  2OTJ P;  4IFD K;  2LXC B;  2K1A A;  3CWB G;  2A45 H;  3SFD C;  2QE7 H;  1BCC J;  3TGU J;  5AW1 B;  2E5Y A;  3HTK A;  4BRY A;  1SQB K;  2YNY A;  1GU5 A;  4I6M C;  1BGY J;  2R44 A;  3H1I E;  1U7M A;  5E79 H;  1LNQ A;  1HGV A;  3SWY A;  1NU1 D;  1NTM E;  3MHV A;  3IR9 A;  3Q5R A;  3O8Z A;  1KFN A;  2E76 B;  2FY8 A;  4PJ0 H;  3H1K J;  5GTI H;  2I1K A;  5BU8 B;  1QLB C;  1N7S D;  3AE3 D;  1BE3 D;  3WUT A;  2WPQ A;  4U3F D;  1S1C X;  5KLI B;  5APW A;  3NXS A;  4WY4 A;  4OH8 B;  3H1H D;  1LTB C;  4U7J A;  2A06 D;  1K05 A;  4IL6 X;  1RH5 B;  2ACZ D;  1S4X A;  1ZN5 A;  1VQ7 P;  1PPJ D;  2D2C D;  4I1L A;  1PP9 J;  4NPE A;  2KSJ A;  2L5G B;  2C9L Y;  1G2C B;  3H1J J;  2WQY D;  3C8V A;  3AED D;  2R32 A;  3CXH H;  3TNU A;  4YTP D;  1P84 D;  1FZB A;  4N6J A;  3AE2 D;  2FBW C;  4A7P A;  3I56 P;  1HWT C;  4HKZ H;  3AEG C;  1IJD B;  1JNM A;  4AUW A;  5TJH A;  5TIS H;  2W83 C;  2ZYD A;  2G8Y A;  3VYI A;  2NRG A;  1VQN P;  3GLM A;  1KQF B;  3VN0 A;  1LGH B;  2AEJ A;  3IF4 A;  3BCC J;  2Y0E A;  1TU3 F;  4BXL A;  1SQB J;  2E74 C;  2OTK E;  3L35 A;  1YQ3 C;  3L72 D;  3QWO C;  5KLV E;  3ZDM A;  1SLQ A;  1L4A D;  1ZLL A;  1OWA A;  1Y9B A;  3AE8 C;  5AVT B;  2O1K A;  3HUS C;  1SQQ J;  5AW8 B;  3L70 D;  4PD4 D;  3PTZ A;  3A2A A;  1JMB A;  3Q5P A;  3AE6 C;  1H0T A;  2Z4E A;  1KIL D;  4UB8 E;  3FXD A;  1SQX E;  3HE5 B;  3L73 G;  1URQ B;  2QJY C;  5H2F E;  3P4R C;  1LWU C;  3MP7 B;  1RF1 C;  1KB9 H;  3A7O A;  3ITK A;  5AW3 B;  2B9B A;  1ZW0 A;  4I7Z B;  4HB1 A;  3CCR P;  2K9J B;  4PV1 D;  2ITA A;  4TT3 H;  2KP8 A;  2H89 C;  1FZC B;  3AEF D;  3CX5 E;  3I55 P;  1N73 C;  1KV4 A;  1S5L X;  2WS3 D;  2NPS D;  1SVF A;  2IBZ I;  1M7L A;  4JQ0 D;  4JYC A;  1IFJ A;  1SQP G;  4ZKP A;  2OAR A;  2E75 C;  1ZP0 D;  2H88 C;  4HH2 A;  4YSX C;  1OFC X;  1L0L K;  5KAI H;  1JCD A;  2HFE D;  1LWU A;  1J1D B;  3BVH A;  4TLF A;  5CCH D;  1M1J A;  2N9B A;  1FOS E;  1QEX A;  1L0N D;  1L0L G;  2OYH C;  1IC2 A;  2WDV C;  1YJN P;  4WBA A;  3G6E P;  3H1L G;  3CI9 A;  3GW6 A;  4RO0 A;  1T3U A;  4GKG A;  1LTS C;  3HTK B;  4BRY B;  2RMZ A;  3SSU A;  3RL0 C;  5AW9 B;  3WMM 0;  2WDQ D;  2HR3 A;  1KYO D;  4W7Z A;  3Q5S A;  3H32 A;  2IYO A;  3TK1 A;  1ZOY D;  3VP8 A;  2N1T A;  3A0B H;  3AE4 C;  3VRA D;  4YXD D;  2OYI A;  1SQP E;  3CC4 P;  1DD4 A;  2FYU K;  1S5L E;  1JB0 J;  1BE3 J;  4IFF A;  5C2T C;  4U3F J;  1VQ5 P;  1MFZ A;  3P4P D;  4XA4 A;  2FYU G;  3H1H J;  1NTZ D;  1NEK C;  3HD7 C;  2FXO A;  2M8R A;  4LGD E;  3NMD A;  4ZKU A;  2FXM A;  1NYH A;  2WP9 C;  1OXZ A;  3L36 A;  4W80 A;  4JF7 A;  1M57 D;  1QVF O;  2P10 A;  1W2B O;  4YT0 D;  1L0L J;  3JCU H;  2FFD C;  1JM0 A;  2Q5U A;  2QM7 A;  4YSZ C;  2C0X A;  1VPC A;  2FYZ A;  1S3J A;  1JO5 A;  1SP4 A;  3L75 E;  1K9M Q;  3HD7 A;  3RK3 B;  2LXB A;  1CI6 A;  2YO2 A;  3MGN A;  5E79 E;  1H8A A;  2R3C A;  5CCG C;  4H44 D;  3D6Z A;  3MIW A;  1J1E C;  3H1I D;  3L72 J;  2IZ0 A;  1NTM D;  2M0B A;  4PJ0 E;  2WPS A;  4M3L A;  3CME P;  2FFD A;  5GTI E;  1KF6 D;  1DX7 A;  2XKM A;  2WVR A;  2WSC H;  3BAT A;  1JMM A;  3RK2 D;  5AVS B;  4RKU J;  1NTK E;  4K3A A;  1OVU A;  2MKV A;  1LP1 A;  1JY3 O;  1PGQ A;  1W2E A;  1W5C E;  2FYU J;  4H13 C;  3L74 E;  3KPE A;  1KOR A;  1S72 P;  1KYO I;  2YO3 A;  5AW6 B;  3P8M C;  4BWN A;  1MV8 A;  3V2P A;  1EXI A;  2B88 A;  1BSH A;  5CJ4 A;  1LT9 C;  3FGA D;  2E74 B;  2KK7 A;  2QG4 A;  1RE4 C;  1XTG B;  1KD1 Q;  1KN7 A;  3CWB D;  3E1R A;  3CXH E;  4I7Z C;  5APV A;  4EI2 A;  2E43 A;  2BAS A;  3AEE C;  1U7J A;  4OGQ D;  2VRS A;  3AEB C;  2SPZ A;  1ZRT E;  3N7N A;  1FZC C;  5TIS E;  1BCC G;  3PHL A;  3TGU G;  1YIJ P;  2QJY B;  2Q6Q A;  1LWU B;  2W6B A;  4KT0 J;  1VQK P;  1BGY G;  2Q3I A;  3CCE P;  4D6T G;  4KX6 C;  1L0N J;  2YMK A;  5CBO A;  1VQ8 P;  2ZXE B;  2FKW B;  4DHJ A;  3TDK A;  3AEC D;  3WU2 H;  1RE4 A;  3MZW B;  4L76 A;  3SFE C;  3KYQ A;  2W90 A;  1M1K Q;  1FAV A;  2QJK C;  4YPC A;  2W27 A;  1PGO A;  5AVV B;  1WT6 A;  4YTP C;  3H1K G;  1X9V A;  2ZVO B;  3VTP C;  1N7S A;  3VP9 A;  2BCC E;  5KLV D;  3AE2 C;  3H6P A;  1GL2 D;  2WIT A;  1NGM B;  4N3Y B;  1JY3 P;  2ZYG A;  2KI7 B;  1FJP A;  3P8C E;  3OW2 O;  3VRB D;  2BS4 C;  2ZT9 C;  4RJT A;  3II6 A;  4B86 A;  3H32 B;  2OTL P;  1Y47 A;  3L71 E;  1BDD A;  1KB9 E;  3E7K A;  4R4M A;  4DZO A;  5CBN A;  3CLQ A;  2V7Q J;  3WUU A;  1SQX D;  2OYH B;  2OYI B;  3Q2Y A;  3S4R A;  3PH0 A;  3H1J G;  1DEE G;  4L73 A;  1L4A C;  2AEM A;  3ABV D;  1DH3 A;  2KYV A;  4JYB A;  1EDK A;  3VMX A;  1NTZ J;  1BGY E;  5B5E E;  2B76 D;  2ZFC A;  1GDT A;  3EFG A;  1OZH A;  1X8Y A;  4YTN D;  3CX5 D;  2JWA A;  3RL0 B;  1VF5 C;  2M3B A;  4WY4 C;  5KAI E;  1GD2 E;  1Q81 Q;  3D70 A;  5APX A;  3H1K E;  2LKM A;  1Q90 D;  2O01 J;  4C46 A;  2B87 A;  4D6T J;  2H43 A;  1OW6 A;  3BCC G;  1SQQ K;  2BS3 C;  1SQB G;  1L4A A;  3LIE A;  3R4Y A;  3VR9 C;  3AEF C;  1GTW A;  1MKM A;  1SQQ G;  2WPV B;  2P1J A;  3HD7 B;  1T2K C;  1CI6 B;  2YMY A;  3CC7 P;  1R8E A;  3KDP B;  1EXJ A;  4IOI H;  1KIL A;  1PP9 E;  3NFQ A;  2WU2 C;  1JY2 P;  2WDR C;  1SQV K;  1UIX A;  1NWQ A;  1BSN A;  1VDF A;  3RK3 C;  5KLV K;  1JTH A;  2JO1 A;  3OAK A;  3A0B E;  1NTM J;  5APY A;  1IK7 A;  3WUV A;  2FFD B;  1SQV G;  3CWB E;  1LTJ C;  1ZV8 A;  5KJ7 D;  1LP1 B;  3A0H H;  1EZV G;  1SQP D;  1NEN D;  1EZV I;  1HJB A;  3CIR D;  2NPS A;  1M56 D;  3V5B A;  3AEA D;  1FZA A;  3GF7 A;  2JWD A;  1RQV A;  2Q9I A;  1L0V D;  5GTH H;  4FJV A;  1J1E B;  2J59 M;  5CCH A;  1ZOY C;  3FWL A;  2OGU A;  1KQG B;  3VRA C;  1HH0 A;  3JCU E;  3P4Q D;  1IFP A;  5AVX B;  1LTJ A;  1FDM A;  1MZ9 A;  3A5T A;  1OIP A;  3LW5 J;  1YQ4 C;  3P4P C;  3CX5 I;  1AVY A;  2WSE J;  2M5A A;  4ASV A;  3S9O A;  4H13 B;  1NU1 K;  2V7Q H;  1AQT A;  2YKO A;  4JBZ A;  2KXP B;  1E7P C;  3AE7 C;  1VQ4 P;  2K37 A;  3L75 D;  1FC2 C;  3NTN A;  1NU1 G;  1EQ7 A;  1LT9 B;  2WT7 A;  2XV5 A;  4YSY D;  1X0T A;  1D7M A;  2IDB A;  1KMI Z;  1M1J C;  2W8Z A;  3AE5 C;  3MD0 A;  4YT0 C;  3PJS K;  3HE4 A;  1A02 F;  1SQV J;  1NKN A;  1N7S B;  5KLV J;  2O3J A;  1DEB A;  2OQQ A;  1WRG A;  3USS A;  1BE3 G;  3O6Q A;  3AE1 C;  4U3F G;  1NKZ B;  1YBK A;  3EWK A;  4YTM D;  5C3J D;  1NTK D;  3H1H G;  2O01 H;  2IBZ G;  2Y0C A;  2PRR A;  2WU5 C;  5B5E H;  1X79 B;  2A06 G;  2XU6 A;  4RES B;  3K5B A;  1LTT C;  3L74 D;  3B5N D;  4AQR D;  1PPJ G;  3M0D C;  1QGK B;  1E79 H;  2N1T C;  2QJK B;  1HJ0 A;  3G3Z A;  2OYI C;  1TFF A;  1SFC D;  2NZ2 A;  1P84 I;  1VL2 A;  1JUN A;  1NH4 A;  3CXH D;  1GW4 A;  3L73 E;  5KTB A;  3B71 A;  4H0L D;  3U1A A;  4Y99 C;  2Z5H A;  2ZT9 B;  3CCS P;  1QLE D;  4I6L A;  1ZRT D;  5L8R J;  2KZI A;  3BRT B;  1NU1 J;  4GOF A;  3MTU E;  1K04 A;  1LT1 A;  2MJZ A;  3VMZ A;  3WU2 E;  3M0D A;  3L72 G;  2L91 A;  1L4A B;  3CCM P;  4OWF A;  2IBZ E;  3V4Q A;  3CCV P;  2AXT H;  2WSF J;  3L70 G;  1OX3 A;  2A45 I;  4PD4 I;  2BCC D;  1VF5 B;  2QEX P;  4WY4 B;  1PV3 A;  3C1L A;  1L0L E;  1JTH B;  1GW3 A;  3P8C D;  2K3R A;  2UWJ E;  1YQ3 D;  3D6Y A;  3TYY A;  3H1L E;  3L71 D;  1KB9 D;  3AE8 D;  3CC2 P;  1T6A A;  3RGU A;  3LW5 H;  4PV1 B;  1FU1 A;  3AE6 D;  1LJ2 A;  1EDJ A;  3TNU B;  1OVV A;  2YKQ A;  1S9K E;  5DJU B;  1GL2 C;  1OMI A;  5AVZ B;  5AVU B;  3P4R D;  4UB6 H;  3VRB C;  1BGY D;  1ZR4 A;  1LTG C;  3BAS A;  1L0N K;  4YXW H;  4Y28 J;  1T3J A;  1HVV A;  1NOH A;  2HLO A;  5KAF H;  1Q82 Q;  3VR8 C;  1IO4 A;  1L0N G;  5EFW B;  3CD6 P;  3H1K D;  2ZYA A;  1LTJ B;  5AW5 B;  3ABV C;  1CZQ A;  2KIK A;  2FYU E;  3CXH I;  1WMK A;  3SWK A;  4HJG H;  3OA7 A;  2M5A B;  4IL6 H;  2E75 D;  1GL2 A;  3L70 J;  2B76 C;  2RH0 A;  1NAF A;  1H0T B;  1S2E A;  5CMZ A;  2K9Y A;  3OJA B;  2XNX A;  1GMJ A;  2BS2 C;  1FZG A;  2WT7 B;  3FX0 A;  3M06 A;  2WDV D;  3KQG A;  3I5C A;  1PP9 D;  3HE4 B;  1FJK A;  1R5S A;  3B4S A;  1YTZ T;  3PP5 A;  3M9H A;  1U57 A;  1NTZ K;  3F89 A;  3G4S P;  1EC5 A;  3U59 A;  5APS A;  3A0H E;  1QL1 A;  2OYO A;  3V2N A;  1N7S C;  1NTK J;  3RK3 E;  2Q3E A;  5AVW B;  3AE3 C;  1NTZ G;  1LTI C;  2JDI H;  2KNC A;  4AYC A;  4W7Y A;  1FE6 A;  1VQM P;  2XND H;  5GTH E;  1JY2 N;  1KTM A;  1KB9 I;  5M1B A;  3PLN A;  1N7L A;  1HTL C;  2ACZ C;  5AW4 B;  1M1J B;  2CPS A;  2E76 D;  2D2C C;  2GA1 A;  4DOJ A;  2QSI A;  2WQY C;  3AED C;  2ZJS E;  1NEN C;  2GUS A;  3CIR C;  1XTC C;  4IFM A;  2Z5I A;  2KS1 A;  3HE5 A;  3KHU A;  2WP9 D;  4EIJ A;  2GUV A;  1GK4 A;  4LDT A;  1NTM K;  3GMA A;  4H44 B;  5AW0 B;  4QMA A;  3H1I G;  2KB7 P;  2N1T B;  3AE9 D;  4NPF X;  1P84 H;  1VQL P;  1NTM G;  3RK2 B;  2RKL A;  5KJ7 A;  4ZNC A;  3U1C A;  1BCC E;  3TGU E;  3P4S D;  2BCC J;  3M91 A;  4Y99 B;  4DDI A;  5APT A;  2FYN C;  5CCG D;  1VQ9 P;  1IFN A;  1QL2 A;  4D6T E;  2FXP A;  3LID A;  1OW8 A;  2WWW A;  1RQU A;  3QH9 A;  1Y8A A;  1KIL C;  3SWF A;  2W6J H;  1ZR2 A;  3T97 A;  4PD4 H;  2WZ7 A;  1VQO P;  2HG5 D;  1YI2 P;  3D71 A;  4PV1 C;  4C7N A;  3FWN A;  1KFY D;  2Y0D A;  3W67 A;  4OGQ B;  4H13 D;  2IX7 C;  3TSI A;  4YTM C;  1YIT P;  5C3J C;  2IFM A;  2PGD A;  2RN0 A;  4DHI B;  2WS3 C;  2NPS C;  2J58 A;  4N78 E;  1YJ9 P;  3Q1M A;  3L73 D;  4DCK A;  4GDO A;  1URQ D;  1ZP0 C;  3B5N C;  2KSE A;  4DT0 A;  2G3A A;  3W68 A;  3H25 A;  3H1J E;  3KZI H;  1CSB A;  2YXQ B;  4C7R A;  2BEQ D;  5CCH C;  3CPW O;  3H1I J;  2Y9Y A;  1KQS O;  1IK9 A;  2AXC A;  4R4L A;  1AJY A;  3AEE D;  1SFC C;  2AXT E;  4L75 A;  1GL2 B;  2XDJ A;  3AEB D;  3V6I A;  5KLV G;  2IBZ D;  5AVR B;  5AW7 B;  4H0L C;  2WSS H;  2HOD A;  3BRV B;  1SQX K;  2WMM A;  3JSV C;  4KX6 D;  1PL5 A;  3R2P A;  1NHL A;  3BCC E;  3B5N A;  2WDQ C;  3F5H A;  2KZJ A;  2QJP C;  3SFE D;  1SQB E;  1SQX G; 
#chains in the Genus database with same CATH homology
 3LW5 J;  2D2C B;  3R4Y A;  3VRB C;  1YQ4 C;  2QJK C;  3VR9 D;  3B71 A;  3IAO A;  4U7J A;  1ZOY D;  4H0L D;  3P4P C;  2QIW A;  3VR9 C;  4XFJ A;  3AE4 C;  3AEF C;  2WSE J;  1OW7 A;  4YTP C;  4Y28 J;  2ZT9 B;  1MKM A;  1KTM A;  5M1B A;  3VRA D;  1K05 A;  3S9O A;  1KF6 D;  4H13 B;  4IL6 X;  2ACZ D;  2WSC J;  4YXD D;  2WPV B;  1KF6 C;  2ACZ C;  4I7Z B;  3VR8 D;  3AE2 C;  4YXD C;  5KLI C;  1NGM B;  5L8R J;  1DD4 A;  4RKU J;  3VR8 C;  3AE7 D;  1E7P C;  1JB0 J;  1R8E A;  2D2C D;  4PV1 D;  3AE7 C;  1EXJ A;  2MKV A;  2E76 D;  2D2C C;  5C2T C;  3D71 A;  4PV1 C;  2WQY D;  2QSI A;  3C8V A;  3RL0 g;  2WU2 D;  1KFY D;  3AED D;  2WQY C;  1K04 A;  4TT3 H;  2ZT9 D;  2BS4 C;  2WDR D;  2WU2 C;  3VRB D;  4OGQ B;  3AED C;  4H13 D;  1PIX A;  4YSY D;  2ZT9 C;  2WDR C;  3ABV C;  3P4P D;  2H89 C;  1UIX A;  4H13 C;  4YTM C;  3AE4 D;  2IDB A;  3AEF D;  1KOR A;  4YSY C;  5C3J C;  4YTP D;  3AE5 D;  1NEN C;  1WMK A;  2JO1 A;  1NEK C;  1S5L X;  1KMI Z;  3AE5 C;  2WS3 D;  3CIR C;  4YT0 C;  2WS3 C;  4R4M A;  3AE2 D;  2V7Q J;  2FBW C;  1IK7 A;  1EXI A;  2E75 D;  3AE9 C;  3Q1M A;  2WSF J;  5KKZ C;  2E75 C;  4GDO A;  2J5U A;  1ZP0 D;  2B76 C;  2YIU C;  2H88 C;  3Q2Y A;  2OQQ A;  3T97 B;  2WP9 D;  3SFD C;  3AE1 D;  3AEG C;  3FGA D;  1ZP0 C;  1FDI A;  4YSX C;  5C2T D;  1NYH A;  3O6Q A;  2WP9 C;  3AE1 C;  2G3A A;  2E74 B;  3G9R A;  3H25 A;  2K9Y A;  4H44 B;  3GMA A;  3EWK A;  3ABV D;  1VF5 B;  2H89 D;  4YTM D;  1GMJ A;  2BS2 C;  5C3J D;  2P10 A;  2BEQ D;  2G8Y A;  1NEN D;  1PV3 A;  1KIL E;  1NEK D;  3P4S C;  3GLM A;  3CIR D;  4YT0 D;  4I7Z C;  2WU5 D;  1KQF B;  4H0L B;  3AEA D;  2WDV D;  2WU5 C;  4R4L A;  2FBW D;  3AE9 D;  1AJY A;  3AEA C;  2JP3 A;  2WDV C;  3AEE D;  3GF7 A;  3AEE C;  1TU3 F;  2B76 D;  1RQV A;  3Q5R A;  3P4R C;  2H88 D;  1YQ3 D;  2E74 C;  3SFD D;  1DIP A;  3AEG D;  4YSX D;  1VF5 D;  4YSZ C;  4YTN D;  4OGQ D;  1YQ3 C;  4Z1M H;  3AEB D;  3IN6 A;  3D6Y A;  1VF5 C;  4YTN C;  4OGQ C;  3AEB C;  3AE8 D;  1HF9 A;  1ZRT E;  4PV1 B;  1ZME C;  1U57 A;  1DD3 A;  1L0V D;  3D70 A;  1Y9B A;  2E76 B;  3AE8 C;  1FDO A;  1L0V C;  3GF3 A;  1ZOY C;  3Q3D A;  4H0L C;  3P4S D;  1KQG B;  3AE6 D;  3VRA C;  4KT0 J;  1QLB C;  1Q90 D;  2O01 J;  3Q5P A;  1HJ0 A;  3AE3 D;  3AE6 C;  2BEZ F;  3RK3 E;  4KX6 D;  3AE3 C;  3P4Q D;  2FYN C;  4KX6 C;  1OW6 A;  2YMK A;  1S1C X;  3P4Q C;  2NZ2 A;  1PL5 A;  2E74 D;  4YSZ D;  2FXP A;  2WDQ D;  1OW8 A;  1OMI A;  1RQU A;  4H44 D;  2E75 B;  1VL2 A;  2WDQ C;  2BS3 C;  2E76 C;  3D6Z A;  2QJP C;  4H44 C;  3AEC D;  3P4R D;  3SFE D;  3Q5S A;  1YQ4 D;  1KFY C;  3AEC C;  3SFE C;  2QJY C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...