3ABVC

Crystal structure of porcine heart mitochondrial complex ii bound with n-biphenyl-3-yl-2-trifluoromethyl-benzamide
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
total genus 49
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2009-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3abvC01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3abvC02
3AEGD 2FBWC 3AE8C 1YQ4C 2BS4C 1ZP0C 3AE5D 1L0VD 3AEEC 1KTMA 3AEAC 5C2TC 1NEKC 4YTPD 3AE4C 3AE9C 1OW8A 3ABVC 1KF6C 3AE1C 3AECC 1NEKD 4YSZC 3P4PC 3S9OA 4YSXC 3AE9D 2H88C 2WS3D 3AEFC 2WU2D 3VR9C 2BS2C 4YTND 2WDRD 3AE1D 4YTMC 4YXDD 1K05A 2H89D 3SFDC 1KFYC 4YSXD 3P4RD 3AEBC 1K04A 2H88D 3AEFD 2WDQC 3CIRD 2WQYC 3SFEC 2FBWD 4YT0C 3AE8D 1YQ4D 1QLBC 1ZP0D 3AEDC 3VRBC 3AEED 2WDVC 3P4QC 1YQ3C 2WU5C 3AEAD 1PV3A 1E7PC 4YSYC 5C2TD 2G3AA 3AE4D 2WP9C 3ABVD 1KF6D 2WU5D 3VRAC 5C3JC 3AECD 4YSZD 3P4PD 2B76C 3AE6C 4KX6C 3AE2C 3VRAD 3VR9D 4YTMD 2B76D 1ZOYC 3AE7C 1KFYD 3SFDD 2BS3C 1NENC 3AEBD 2WDQD 3AE3C 2WQYD 3AE7D 3SFED 1NEND 3AE5C 1L0VC 4YT0D 3B71A 3AEDD 3VRBD 3P4QD 2WDVD 1YQ3D 3VR8C 4YSYD 4YTPC 2WP9D 3VR8D 5C3JD 2ACZC 2WS3C 3AE6D 2WU2C 4YTNC 1OW6A 4KX6D 2WDRC 3AE2D 1OW7A 4YXDC 2H89C 3P4SC 2ACZD 3P4RC 3AEGC 1ZOYD 3CIRC 3P4SD 3AE3D
chains in the Genus database with same CATH superfamily
4PV1D 1HBWA 1P84I 3A0BH 1NKZB 1L4AA 5CJ0A 2D2CD 3CXHD 4JBZA 3CWBE 4U3FD 1URQC 3BATA 1SS1A 1JOCA 4YSXC 1PL5A 2E75C 1QL2A 2WS3D 2WU2D 1Q86Q 1SQPK 1USEA 1KQSO 1T8ZA 4YSXD 1RE4C 5AW7B 3CX5D 3CC4P 5KKZC 1RQUA 1LTTC 1LTIC 1VQMP 2POHA 1PFIA 2Q3EA 2IFNA 2WPVB 3L35A 5C3JC 1LTSC 1AQ5A 1VF5B 1EZVD 3AE2C 2ZFCA 4JYBA 4NPEA 2C9LY 3D71A 4DHIB 1NENC 3NMDA 3BASA 1CZQA 2NPSA 2WQYD 3H1LD 5CCHD 1CI6B 1KB9I 1NEND 1IC2A 3AEDD 2OYIC 2K9JB 3P4QD 2WDVD 2BCCJ 3A0HH 3L70J 3VR8C 2P2UA 5AVQB 2AXCA 2QG4A 3JSVC 2K1AA 4GDOA 3A3YB 3VR8D 3WUUA 1BDCA 2IZ1A 4YXDC 1JO5A 3CPWO 3AEGC 1VPCA 3HD7B 1R5LA 3TF5A 1OXZA 3L72J 3PHLA 3AEGD 4UB6H 2RMZA 2IZ0A 2N9YB 2OTJP 3M9QA 2XDJA 5APSA 1S9KE 3R4YA 3JCUH 5KAFH 2ZFYA 3K5BA 1GZLA 3HE4A 1VQ4P 2E76C 3CIRD 2AEFA 1BE3E 3H1JE 2XNDH 3F89A 3V5BA 2E76D 2LXCB 3WU2E 5KAIE 1SQPE 1SFCC 3AE4D 1NTKG 1SQBK 3PP5A 3H1IG 3MZWB 1M90Q 3IAOA 3C8VA 1NOHA 2CPBA 5KLIC 1LT1A 1L0NE 3N4XA 4RKUJ 1EDIA 3A2AA 2WSEH 1BCCJ 1KFYD 2WSCH 2P10A 4U3FJ 2QM7A 1OMIA 5AW1B 3VTPC 3VRBD 4LLHA 1JCCA 2YIUB 2HODB 2ACZC 4B86A 4RESB 1S5LH 2WDRC 2ACZD 5KJ7C 4OH8B 1M1JC 1YJ9P 3CCRP 1KILC 3H1HE 1NTZE 1KILD 3V4QA 1RY3A 2OARA 1OW8A 4HKZH 2A06G 4BXLA 4JQ0D 1PGQA 3A5TA 1MFZA 1VQKP 3S9OA 1VQ7P 3EFFK 2Q6QA 1S1CX 3H1LJ 2FYUD 2QE7H 2Q1KA 3E1RA 2V7QJ 2WSFJ 3AE8D 3CC7P 2W90A 1SQQD 3G6EP 5C2TD 2N1TB 4BWNA 2W27A 1MUUA 5AVXB 2P67A 1KB9H 5APXA 3P8CD 1T2KD 1KYOH 3Q2YA 3AECD 3RK3D 3L71E 3VR9D 1URQB 1H89A 3ZDMA 1FZCC 2Q7CA 1N86A 3A0HE 2E75B 1SQBE 2HPCB 1LWUA 3GF7A 4YT0D 4H13C 1KQGB 3QWOC 4XA4A 5CCHA 1K73Q 3TK1A 1H0TB 4GKGA 3NTNA 2M3BA 3QH9A 1OVUA 4JYCA 1ZR4A 5CBNA 4TT3H 1NJIQ 5KLVG 3FXDA 3GMAA 1NU1K 1L0LG 4I6MC 3SWFA 4I6LA 4PD4I 1TU3F 1DEEG 3TNUB 2BCCE 1HGVA 2OYHC 2BS2C 1NU1G 1NVOA 1K04A 1JY3P 3NFQA 1DEBA 1Z56A 1VQ6P 3L72E 2FFDB 1SQVD 2LKMA 5B66E 3AEAD 1VQ9P 2JWAA 3E7KA 1VF5D 2KK7A 3PH0A 2QJPC 3VOPA 1XTGB 1IK9A 1AVYA 4DCKA 1Q7YQ 2ZVNB 1E79H 2RH0A 1HUCA 1LGHB 4W7YA 4NPDA 5BU8B 3I5CA 1GL2A 1LTAC 2Z5IA 3HTKB 3MTUE 2W8ZA 3AE3C 1LJ2A 3Q5RA 4XE5B 3SFED 1SQXD 3MUDA 1HJ0A 2BEZF 2QEXP 1JTHB 1MKMA 1FZAA 3GHGC 1QEXA 2SPZA 3U59A 2FYUJ 4WY4B 2YO3A 3HD7D 3CCEP 4GOFA 1EXIA 1G1IA 4IL6E 2KOGA 3SSUA 1QL1A 2IBZE 3MP7B 5AW8B 1KQLA 3VONA 1K8AQ 1SFCB 1NO4A 1SQQJ 1OFCX 1FZBA 4BRYB 1EC5A 3CXHE 3MHVA 1ZP0C 3GW6A 1L0VD 3BRTB 4U3FE 3B4SA 4N78D 3H1KD 1ZLLA 2G8YA 1KF6C 3CCJP 2R5BA 2GUVA 3VMXA 1EDJA 3CX5E 3P4RD 3TDKA 4D6TG 3L73D 1AVOA 3FXEA 3S4RA 1GK6A 2WU5C 3CWBG 1S4XA 1M1JB 3B5NB 1X0TA 2G3AA 3L70D 3JC22 3KQGA 2KZJA 2WP9C 2WU5D 1EZVE 2LR2A 2YKPA 4KJMA 2YKOA 3CCQP 2Z4EA 2YIUC 2PGDA 1FS0E 4LDTA 2O01J 4DHJA 1HGZA 4Y28J 3L74D 2BASA 1JMMA 3H1LE 3HE5B 1VQPP 2I1KA 2ZJSE 2E74C 5KAIH 1VQOP 1VL2A 3BCCD 3PTZA 2OGUA 1S2EA 5L8RJ 4PJ0E 1SQVJ 4OGQC 1SVFA 1A02J 4EYYQ 1ZV8A 1FC2C 2FYUK 1R5SA 2B89A 1FZCB 1NEKC 4OWFA 2LXBA 3V2NA 4C7NB 1FAVA 4GODA 3TSIA 2Y9ZA 1NEKD 4H13B 4L73A 1BGYD 1DIPA 1P84D 4YTMC 1SQXJ 1USDA 3SFDC 3FWLA 1LT9A 2WDQC 1BCCD 1YBKA 2N1TD 3RL0C 2PFXA 1PP9D 3LIDA 2V4HA 1M57D 3L75D 2QA4P 3G71P 5AW4B 5AVSB 4HJGH 2KSJA 5AVWB 1URQD 3R2PA 1YTZT 2ZVOB 5AVTB 1NTKJ 2AEMA 1GDTA 2E75D 3CCSP 4EOTA 3U1CA 1H88A 1BE3G 2OYHB 1L0NK 2QVAA 1RF1C 2B87A 3H1KJ 4IFDK 3H1JG 2A45H 5AVYB 4CPGA 1SQPG 4YTPC 1L2PA 1L4AB 5C3JD 1FZGA 3L73J 3N7NA 1L0NG 2P1JA 4YTNC 1G2CB 3AE2D 3W67A 4ASWA 3CL3D 2H89C 2QJPB 3RL0g 2ZYDA 3U1AA 1ZMEC 1YHQP 1RF0C 1KYOI 2IFMA 4EDFA 1EXJA 1KILE 3GG2A 2O1JA 1LTJA 1BSHA 1NTZK 3EWKA 1U7JA 3V6IA 3L74J 2FFDC 2FYUE 4YXDD 1MV8A 1X79B 3L4FA 3M91A 3GHGB 1PPJD 5GTIE 3AEBC 1YYCA 3Q3DA 1SQQE 2CK3H 2YMKA 3H1HG 1NTZG 1OWAA 3HRNA 3I55P 1VQNP 3BCCJ 1EQ7A 1SQXK 1YTZI 3P8CE 1FOSE 3RK3E 2IYPA 2KLUA 2WPQA 4GT1A 4GIFA 3AE6C 1E5WA 2CPSA 2J58A 3O8ZA 3USSA 1IO4A 2XV5A 2A45G 1WRGA 1QGKB 2QJKC 4WY4C 2M5AA 1X9VA 1NKNA 4WY4D 1BGYJ 5B66H 2KP8A 1SFCD 2WTYA 4GOEA 3V2RA 2YO2A 3L71G 1KD1Q 2WPRA 1NTMD 3CLQA 5AW3B 5CCGA 2KI7B 2OQQA 2YNYA 2KSEA 2R5DA 1PP9J 1GL2C 3L75J 4C46A 5AVRB 1SQBG 1LTGC 3G4SP 1AJYA 5KLVJ 1YQ4C 3MUDC 3AEEC 3PJSK 1M1KQ 2P7JA 1RE3A 2W83C 2J59M 5AVZB 4HH2A 1M7LA 2E74B 3HUSC 3B5NC 2WDRD 1GU5A 4IL6H 1QX8A 1K05A 2KLVA 2M0BA 5KJ7D 1N7SC 3B5ND 4Z1MH 3CCUP 2AEJA 1SQVE 4M3LA 4H0LC 1KC8Q 3CXHH 2N1TA 3WMM0 4OGQB 4YSYC 2BCCG 1S3JA 2FYZA 5AW2B 2K3RA 1XTCC 4I2LC 1OZHA 2I8DA 3T97B 3KYQA 2KIKA 2PP6A 3NXSA 3H25A 1ZOYC 4I7ZB 3B8EB 3CX5H 1SQXE 5K5GB 3TGUD 3PLNA 5AW6B 2R32A 3L72G 3IFMA 3FWNA 1RE4A 5TISE 1LP1B 1H0TA 5CBOA 3EQ2A 1T3UA 3RL0B 3MD0A 5DJTB 3CCLP 3CI9A 1KV4A 2KS1A 4DHZA 1JM0A 1GD2E 2KNCA 2WWWA 4ZNCA 1HH0A 2E5TA 1X8YA 5APQA 4N78E 1MZ9A 1GTWA 1JMBA 3H1KE 4H13D 3TNUA 2V7QH 1PIXA 2WSFH 1RF1B 3PRJA 3AE9C 2RKLA 4RO0A 2OYIA 1OVRA 2K88A 3P4PC 2IBZG 3AE9D 3L73E 3ITKA 1AV1A 4PD4D 3KPEA 4PJ0H 3VMZA 1FZEA 4U3FG 1HTLC 3L70E 1PV3A 1NTMJ 1N73C 1LWUB 5AW5B 3O6QB 1ZRTD 3P8MC 1FOSF 3GF3A 4H44C 5TJHA 3L74E 1SLQA 3HTKA 1IFIA 1L4AC 5APYA 1BDDA 3W68A 3RGUA 1L4AD 3LW5J 1HF9A 1IFNA 1JTHA 1VQ8P 4EI2A 4DOJA 1EZVG 3V2QA 2VRSA 3BCCE 2OTLP 3M0DA 5E79E 2XU6A 1OW7A 1QVFO 4TLFA 3H1LG 4BRYA 2Z5HA 2AXTE 3AE3D 4L76A 1IK7A 1KFMA 1FDOA 2YXRB 5C39A 2QJKB 1U57A 2H7HA 5GTHE 4HYTB 1GK4A 2O01N 2A45I 1BGYE 4IFMA 1P84E 1SP4A 3TGUJ 3OAKA 1NTKD 3H1ID 1BCCE 2NPSC 4Y99C 2ZAEB 1PP9E 3L75E 5KJ7A 1NWQA 1ZP0D 1T3JA 1LTJC 1GL2B 1R8EA 3H32A 1KILA 2GUSA 1A02F 3VMYA 1NAFA 1AA0A 1FE6A 2PAJA 1KF6D 4O9BA 2ZYGA 2NRGA 4W7ZA 4KX6C 1KFNA 1FDMA 3HE5A 5GTIH 1OVVA 3HUSB 3VN0A 1YITP 3AE5C 3B71A 1JCDA 1N7SB 3F5HA 2IDBA 1GW4A 1SQPJ 2WP9D 4H0LB 4IFFA 1U7MA 1KMIZ 1UIXA 2A06D 1EDLA 1GU4A 3D6YA 4R4LA 3Q5SA 1GW3A 1FZCA 2FBWC 2BS4C 2XKMA 3CCVP 2J5UA 2WT7B 2Q3IA 2E74D 4C7NA 3ABVC 1HWTC 1DD4A 3AE1C 4UB8E 4YSZC 5AVVB 1PPJE 1WT6A 3AE1D 1HVVA 1IFPA 3IR9A 2ZT9C 2WVRA 2O3JA 3KHUA 4OGQD 2QM8A 2O01H 2FY8A 2E43A 2PRRA 1YQ3C 1SQQK 3H1HJ 4AUWA 4I7ZC 2HLOA 3OW2O 2BEQD 3RK2C 2FXPA 3KZIE 3VRAC 2XNXA 1FU1A 2FYUG 1VQ5P 4DDGA 3M06A 3VRAD 4YTMD 3G3ZA 3SFDD 2FKWB 2WDQD 1SQQG 1DD3A 1FJKA 4A7PA 3RL0D 2Y0EA 3CCMP 5BU5A 5KLVD 2IBZI 3CC2P 3VYIA 1L0LD 1W2BO 3H1IJ 3Q1MA 2QRXA 5APVA 1K9MQ 1NTME 2W6JH 2Y9YA 1NH4A 1G2CA 2WS3C 3P7KA 3CXHI 2WU2C 3L71J 1YIJP 2QJYB 2E5YA 1N73B 1JY2N 1CI6A 1NHLA 3CMAP 2FYNC 3VP9A 2K9JA 1HJBA 4H44B 1NU1D 1M8OB 3IF4A 4W80A 1SQBJ 4U7JA 2DW3A 1LT9B 2JWDA 2Y0CA 3SWYA 4ASVA 1J1EC 4ZKPA 5TISH 4YTPD 3CX5I 1IJDB 1PZQA 4DJGA 1KB9D 2UWJE 5H2FE 1KYOD 3HD7A 2JEEA 3GHGA 2O1KA 4YTND 3L37A 2H89D 3RBZA 1LWUC 4HB1A 1PGJA 2WQYC 1EZVI 5CCHC 1QLBC 3AEDC 1ZW0A 3P4QC 1SQVK 2WDVC 4KT0J 5B5EE 2B87B 4I1LA 2WZ7A 4MN4C 1JY2P 3TGUE 1VQLP 2BS3C 3AEBD 1SQVG 2H8PD 1M56D 2MKVA 2KZIA 2NPSB 1IZNB 1IFMA 2YMYA 4Y99B 4YPCA 3SWKA 4N6JA 1Q81Q 3V4WA 2WSEJ 1PGPA 1LTJB 4AQRD 3AE6D 2WSCJ 2WPSA 5CMZA 1JY2O 1KN7A 2MJZA 3P4SC 2C0XA 1SQXG 1N2DC 1OIPA 1NTKK 3CIRC 2GA1A 2ZXEB 1J2JB 1NGMB 3P4SD 2M3EA 2HODA 4ZKUA 2XZRA 4D6TD 2Y0DA 1KTMA 3CMEP 1YJNP 2OYOA 2W6BA 3AE4C 1H8AA 4NPFX 3CWBD 3UIAA 3WUVA 1T6AA 3M0DC 2OTKE 3AEFC 2L91A 4LC1A 4PD4E 2L5GB 5E79H 3OA7A 2ZYAA 2HG5D 1KFYC 1OX3A 1GL2D 3AEFD 3HE4B 3Q5PA 1L0LJ 3H1KG 1RQVA 3FX0A 2AXTH 1ZR2A 1YQ4D 3VRBC 3AEED 1Y8AA 1ZRTE 2YXQB 3MGNA 2M5AB 1KORA 5GTHH 3OJAB 4OVNF 2FXOA 3T97A 1TFFA 1P84H 3L73G 1NU1J 2K9YA 3AE7C 1N7SD 2C0WA 1N8RQ 5CHXA 4WB4A 3A0BE 3AE7D 1J1DC 2P58A 1LP1A 3L70G 4H0LD 3VP8A 2R3SA 2ZT9B 5APUA 1VDFA 4YSYD 1URQA 1D7MA 3A7OA 3L74G 2HPCA 3RK2B 1WMKA 1ZOYD 2K37A 2JDIH 4N3YB 2NZ2A 3M9HA 4R4MA 2WMMA 3AE8C 1YJWP 1RF1A 5C2TC 3BCCG 3MIWA 3BRVB 4PV1B 1T2KC 2M8RA 1NTKE 3AECC 3H1IE 2D2CB 3RK3C 2W6AA 1S9KD 3VR9C 3V2PA 3GLMA 5AW0B 2IX7C 1RH5B 3TYYA 5AW9B 3C1LA 2FXMA 2I1JA 1JUNA 1JY3N 1BE3D 4YT0C 1RF0A 2FYNB 3KXDA 3H1JD 5DJUB 3O6QA 3II6A 1BGYG 5KLVK 3D6ZA 1SQPD 4YXWH 1L0LK 3P4PD 3S1KA 4UB8H 3IN6A 5KKZB 1J1EB 1BCCG 2IYOA 1AQTA 4D6TJ 2FFDA 1PP9G 1L0ND 2KS1B 1S5LX 3L75G 4UB6E 2KNCB 4FJVA 3KDPB 2QJYC 3M0AA 3CWBJ 1W2EA 4IL6X 3FGAD 3JCUE 1G1JA 5KAFE 5CJ4A 2A06E 2B9BA 2WSSH 3KZIH 1DH3A 4H44D 3M9BA 1LT9C 4XFJA 1OW6A 1IFJA 5KTBA 1CW5A 5EFWB 5APTA 2OYIB 2HR3A 1PGOA 3H6PA 1KZUB 2JP3A 1RHZB 2JO1A 4WY4A 5M1BA 3AEAC 1VF5C 2R3CA 3H1HD 1NTZD 1SFCA 1Y9BA 2JR8A 4JF7A 4QMAA 1X22A 2WITA 1QVGO 2ZXXA 3LIEA 4KHXA 1JB0J 4DZOA 4WBAA 1JY3O 3D70A 3WUTA 3SFEC 1LNQA 1Y47A 2RN0A 3C9IA 1FJPA 3VMAA 3LW5H 1IFDA 2E76B 2QIWA 1DX7A 2HYNA 1S5LE 1PPJG 3HD7C 4K3AA 1MFTA 5H2FH 2B88A 1Q82Q 3L71D 2Q5UA 2NPSD 3G9RA 3EFGA 3RBXA 3HUSA 4C7RA 1M1JA 3B5NA 1AFOA 5KLVE 1YI2P 1L0VC 4DDIA 1N7SA 1L0LE 5KLIB 1SQBD 1GMJA 2IPPA 4WVZA 2GM4A 3P32A 5APWA 2E42A 5B5EH 1CSBA 2HFED 2R44A 2JKVA 4JPZB 1ZXGA 1NTMK 4KX6D 1BE3J 3P4RC 1NU1E 3H1JJ 1W5CE 2WT7A 1S72P 4WWIA 1BSNA 4IOIH 3AE5D 1FDIA 1JEKA 1Q90D 2N9BA 4L74A 1KB9E 1NTMG 1KYOE 2KB7P 1J1DB 2BCCD 4ZMDA 2KXPB 1L0NJ 3H32B 1KILB 2H88C 4RJTA 4K35A 2H43A 2H88D 4DT0A 3E1IA 1UIIA 4LGDE 2JJLA 3I56P 1KQFB 2FBWD 3BVHA 2ITAA 2QSIA 1E7PC 3L72D 1FZFA 5CCGC 3ABVD 1QLED 5AVUB 1N7LA 2KYVA 3WU2H 4YSZD 2B76C 5CCGD 1ZN5A 1NYHA 4PD4H 2B76D 2ZT9D 4L75A 1JNMA 3RK3B 2Q9IA 1NTZJ 1RE3C 3CD6P 1YQ3D 1EDKA 2C9NY 1Q2NA 3RK2D 2OYHA 1N73A 1LTBC 2YKQA 3TGUG 3L36A 2KUBA 4AYCA 2IBZD 4PV1C 1FBMA 1NAYA 2N1TC 4EIJA 2D2CC 4D6TE 5BVZA
chains in the Genus database with same CATH topology
3AEGD 1KILE 2JP3A 2FBWC 4PV1D 3AE8C 1YQ4C 2JO1A 4U7JA 1ZP0C 2BS4C 3AE5D 1L0VD 1IK7A 3AEEC 5M1BA 1FDIA 1FDOA 2J5UA 3AEAC 4H13D 1Q90D 2D2CD 1KTMA 1VF5C 5C2TC 1NEKC 1U57A 1PIXA 2E74D 1TU3F 4YTPD 3AE4C 3AE9C 2G8YA 1OW8A 3EWKA 3ABVC 1KF6C 4PV1B 1DD4A 3AE1C 3AECC 3R4YA 1NEKD 4H13B 4YSZC 3P4PC 2D2CB 3S9OA 4YSXC 1Y9BA 1PL5A 2E75C 2H88C 2WS3D 3AE9D 3AEFC 2E74B 2WU2D 3VR9C 1DIPA 2BS2C 4YTND 2WDRD 3AE1D 4YTMC 1S1CX 4YXDD 1K05A 2H89D 3GLMA 3SFDC 2ZT9C 1KFYC 4YSXD 3P4RD 3AEBC 1K04A 2H88D 3AEFD 1JB0J 2E76C 2WDQC 3CIRD 4OGQD 4Z1MH 3Q5PA 2V7QJ 3D70A 2WQYC 3Q3DA 2WSFJ 5KKZC 2YMKA 1RQVA 3SFEC 1RQUA 4H0LC 1KQFB 2FBWD 2E76D 1YQ4D 1QLBC 1ZP0D 3AE8D 3AEDC 4YT0C 3VRBC 3AEED 2WDVC 3P4QC 1YQ3C 2WU5C 3AEAD 1R8EA 1PV3A 2QSIA 4KT0J 4I7ZC 1VF5D 4OGQB 1ZRTE 1E7PC 2G3AA 4YSYC 5C2TD 3O6QA 2QJPC 1KORA 2BEQD 3AE4D 3RK3E 2WP9C 2FXPA 3ABVD 1KF6D 2WU5D 3VRAC 2WPVB 2E76B 2QIWA 3D6ZA 3Q2YA 5C3JC 3AECD 3IAOA 3C8VA 4YSZD 3P4PD 2B76C 3AE6C 3GF3A 4H44C 5KLIC 2E75D 1VF5B 3IN6A 4KX6C 3AE2C 3VRAD 2K9YA 2YIUC 3T97B 3VR9D 2O01J 4RKUJ 4YTMD 1NYHA 3H25A 3G9RA 2B76D 4Y28J 1ZOYC 2ZT9D 3AE7C 3D71A 4I7ZB 1KFYD 1NENC 2BS3C 2QJKC 3AEBD 2P10A 2WDQD 1S5LX 2E75B 3AE3C 3Q5RA 1DD3A 2MKVA 2WQYD 3AE7D 3SFED 1NEND 3AE5C 2QJYC 1L0VC 1OMIA 3GF7A 4H0LD 4H13C 3B71A 3LW5J 1HF9A 4YT0D 3AEDD 1GMJA 1HJ0A 2ZT9B 2WDVD 3P4QD 3VRBD 2BEZF 1KQGB 1YQ3D 4IL6X 3FGAD 2E74C 2IDBA 3VR8C 4YSYD 4YTPC 3Q1MA 1MKMA 4GDOA 3SFDD 2WP9D 4H0LB 3VR8D 2WSEJ 5C3JD 2ACZC 1VL2A 1KMIZ 1EXIA 2WS3C 3AE6D 4H44D 2WSCJ 1UIXA 2WU2C 2OQQA 4XFJA 1OW6A 4KX6D 4YTNC 2WDRC 3AE2D 1OW7A 4YXDC 2H89C 5L8RJ 3RL0g 3P4SC 2ACZD 1WMKA 2FYNC 3P4RC 3AEGC 4PV1C 1ZMEC 1ZOYD 3CIRC 4OGQC 4TT3H 3D6YA 1NGMB 1AJYA 4R4LA 2D2CC 3GMAA 4H44B 3Q5SA 3P4SD 2NZ2A 3AE3D 4R4MA 1EXJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AEG D;  2FBW C;  3AE8 C;  1YQ4 C;  2BS4 C;  1ZP0 C;  3AE5 D;  1L0V D;  3AEE C;  1KTM A;  3AEA C;  5C2T C;  1NEK C;  4YTP D;  3AE4 C;  3AE9 C;  1OW8 A;  3ABV C;  1KF6 C;  3AE1 C;  3AEC C;  1NEK D;  4YSZ C;  3P4P C;  3S9O A;  4YSX C;  3AE9 D;  2H88 C;  2WS3 D;  3AEF C;  2WU2 D;  3VR9 C;  2BS2 C;  4YTN D;  2WDR D;  3AE1 D;  4YTM C;  4YXD D;  1K05 A;  2H89 D;  3SFD C;  1KFY C;  4YSX D;  3P4R D;  3AEB C;  1K04 A;  2H88 D;  3AEF D;  2WDQ C;  3CIR D;  2WQY C;  3SFE C;  2FBW D;  4YT0 C;  3AE8 D;  1YQ4 D;  1QLB C;  1ZP0 D;  3AED C;  3VRB C;  3AEE D;  2WDV C;  3P4Q C;  1YQ3 C;  2WU5 C;  3AEA D;  1PV3 A;  1E7P C;  4YSY C;  5C2T D;  2G3A A;  3AE4 D;  2WP9 C;  3ABV D;  1KF6 D;  2WU5 D;  3VRA C;  5C3J C;  3AEC D;  4YSZ D;  3P4P D;  2B76 C;  3AE6 C;  4KX6 C;  3AE2 C;  3VRA D;  3VR9 D;  4YTM D;  2B76 D;  1ZOY C;  3AE7 C;  1KFY D;  3SFD D;  2BS3 C;  1NEN C;  3AEB D;  2WDQ D;  3AE3 C;  2WQY D;  3AE7 D;  3SFE D;  1NEN D;  3AE5 C;  1L0V C;  4YT0 D;  3B71 A;  3AED D;  3VRB D;  3P4Q D;  2WDV D;  1YQ3 D;  3VR8 C;  4YSY D;  4YTP C;  2WP9 D;  3VR8 D;  5C3J D;  2ACZ C;  2WS3 C;  3AE6 D;  2WU2 C;  4YTN C;  1OW6 A;  4KX6 D;  2WDR C;  3AE2 D;  1OW7 A;  4YXD C;  2H89 C;  3P4S C;  2ACZ D;  3P4R C;  3AEG C;  1ZOY D;  3CIR C;  3P4S D;  3AE3 D; 
#chains in the Genus database with same CATH topology
 4PV1 D;  1HBW A;  1P84 I;  3A0B H;  1NKZ B;  1L4A A;  5CJ0 A;  2D2C D;  3CXH D;  4JBZ A;  3CWB E;  4U3F D;  1URQ C;  3BAT A;  1SS1 A;  1JOC A;  4YSX C;  1PL5 A;  2E75 C;  1QL2 A;  2WS3 D;  2WU2 D;  1Q86 Q;  1SQP K;  1USE A;  1KQS O;  1T8Z A;  4YSX D;  1RE4 C;  5AW7 B;  3CX5 D;  3CC4 P;  5KKZ C;  1RQU A;  1LTT C;  1LTI C;  1VQM P;  2POH A;  1PFI A;  2Q3E A;  2IFN A;  2WPV B;  3L35 A;  5C3J C;  1LTS C;  1AQ5 A;  1VF5 B;  1EZV D;  3AE2 C;  2ZFC A;  4JYB A;  4NPE A;  2C9L Y;  3D71 A;  4DHI B;  1NEN C;  3NMD A;  3BAS A;  1CZQ A;  2NPS A;  2WQY D;  3H1L D;  5CCH D;  1CI6 B;  1KB9 I;  1NEN D;  1IC2 A;  3AED D;  2OYI C;  2K9J B;  3P4Q D;  2WDV D;  2BCC J;  3A0H H;  3L70 J;  3VR8 C;  2P2U A;  5AVQ B;  2AXC A;  2QG4 A;  3JSV C;  2K1A A;  4GDO A;  3A3Y B;  3VR8 D;  3WUU A;  1BDC A;  2IZ1 A;  4YXD C;  1JO5 A;  3CPW O;  3AEG C;  1VPC A;  3HD7 B;  1R5L A;  3TF5 A;  1OXZ A;  3L72 J;  3PHL A;  3AEG D;  4UB6 H;  2RMZ A;  2IZ0 A;  2N9Y B;  2OTJ P;  3M9Q A;  2XDJ A;  5APS A;  1S9K E;  3R4Y A;  3JCU H;  5KAF H;  2ZFY A;  3K5B A;  1GZL A;  3HE4 A;  1VQ4 P;  2E76 C;  3CIR D;  2AEF A;  1BE3 E;  3H1J E;  2XND H;  3F89 A;  3V5B A;  2E76 D;  2LXC B;  3WU2 E;  5KAI E;  1SQP E;  1SFC C;  3AE4 D;  1NTK G;  1SQB K;  3PP5 A;  3H1I G;  3MZW B;  1M90 Q;  3IAO A;  3C8V A;  1NOH A;  2CPB A;  5KLI C;  1LT1 A;  1L0N E;  3N4X A;  4RKU J;  1EDI A;  3A2A A;  2WSE H;  1BCC J;  1KFY D;  2WSC H;  2P10 A;  4U3F J;  2QM7 A;  1OMI A;  5AW1 B;  3VTP C;  3VRB D;  4LLH A;  1JCC A;  2YIU B;  2HOD B;  2ACZ C;  4B86 A;  4RES B;  1S5L H;  2WDR C;  2ACZ D;  5KJ7 C;  4OH8 B;  1M1J C;  1YJ9 P;  3CCR P;  1KIL C;  3H1H E;  1NTZ E;  1KIL D;  3V4Q A;  1RY3 A;  2OAR A;  1OW8 A;  4HKZ H;  2A06 G;  4BXL A;  4JQ0 D;  1PGQ A;  3A5T A;  1MFZ A;  1VQK P;  3S9O A;  1VQ7 P;  3EFF K;  2Q6Q A;  1S1C X;  3H1L J;  2FYU D;  2QE7 H;  2Q1K A;  3E1R A;  2V7Q J;  2WSF J;  3AE8 D;  3CC7 P;  2W90 A;  1SQQ D;  3G6E P;  5C2T D;  2N1T B;  4BWN A;  2W27 A;  1MUU A;  5AVX B;  2P67 A;  1KB9 H;  5APX A;  3P8C D;  1T2K D;  1KYO H;  3Q2Y A;  3AEC D;  3RK3 D;  3L71 E;  3VR9 D;  1URQ B;  1H89 A;  3ZDM A;  1FZC C;  2Q7C A;  1N86 A;  3A0H E;  2E75 B;  1SQB E;  2HPC B;  1LWU A;  3GF7 A;  4YT0 D;  4H13 C;  1KQG B;  3QWO C;  4XA4 A;  5CCH A;  1K73 Q;  3TK1 A;  1H0T B;  4GKG A;  3NTN A;  2M3B A;  3QH9 A;  1OVU A;  4JYC A;  1ZR4 A;  5CBN A;  4TT3 H;  1NJI Q;  5KLV G;  3FXD A;  3GMA A;  1NU1 K;  1L0L G;  4I6M C;  3SWF A;  4I6L A;  4PD4 I;  1TU3 F;  1DEE G;  3TNU B;  2BCC E;  1HGV A;  2OYH C;  2BS2 C;  1NU1 G;  1NVO A;  1K04 A;  1JY3 P;  3NFQ A;  1DEB A;  1Z56 A;  1VQ6 P;  3L72 E;  2FFD B;  1SQV D;  2LKM A;  5B66 E;  3AEA D;  1VQ9 P;  2JWA A;  3E7K A;  1VF5 D;  2KK7 A;  3PH0 A;  2QJP C;  3VOP A;  1XTG B;  1IK9 A;  1AVY A;  4DCK A;  1Q7Y Q;  2ZVN B;  1E79 H;  2RH0 A;  1HUC A;  1LGH B;  4W7Y A;  4NPD A;  5BU8 B;  3I5C A;  1GL2 A;  1LTA C;  2Z5I A;  3HTK B;  3MTU E;  2W8Z A;  3AE3 C;  1LJ2 A;  3Q5R A;  4XE5 B;  3SFE D;  1SQX D;  3MUD A;  1HJ0 A;  2BEZ F;  2QEX P;  1JTH B;  1MKM A;  1FZA A;  3GHG C;  1QEX A;  2SPZ A;  3U59 A;  2FYU J;  4WY4 B;  2YO3 A;  3HD7 D;  3CCE P;  4GOF A;  1EXI A;  1G1I A;  4IL6 E;  2KOG A;  3SSU A;  1QL1 A;  2IBZ E;  3MP7 B;  5AW8 B;  1KQL A;  3VON A;  1K8A Q;  1SFC B;  1NO4 A;  1SQQ J;  1OFC X;  1FZB A;  4BRY B;  1EC5 A;  3CXH E;  3MHV A;  1ZP0 C;  3GW6 A;  1L0V D;  3BRT B;  4U3F E;  3B4S A;  4N78 D;  3H1K D;  1ZLL A;  2G8Y A;  1KF6 C;  3CCJ P;  2R5B A;  2GUV A;  3VMX A;  1EDJ A;  3CX5 E;  3P4R D;  3TDK A;  4D6T G;  3L73 D;  1AVO A;  3FXE A;  3S4R A;  1GK6 A;  2WU5 C;  3CWB G;  1S4X A;  1M1J B;  3B5N B;  1X0T A;  2G3A A;  3L70 D;  3JC2 2;  3KQG A;  2KZJ A;  2WP9 C;  2WU5 D;  1EZV E;  2LR2 A;  2YKP A;  4KJM A;  2YKO A;  3CCQ P;  2Z4E A;  2YIU C;  2PGD A;  1FS0 E;  4LDT A;  2O01 J;  4DHJ A;  1HGZ A;  4Y28 J;  3L74 D;  2BAS A;  1JMM A;  3H1L E;  3HE5 B;  1VQP P;  2I1K A;  2ZJS E;  2E74 C;  5KAI H;  1VQO P;  1VL2 A;  3BCC D;  3PTZ A;  2OGU A;  1S2E A;  5L8R J;  4PJ0 E;  1SQV J;  4OGQ C;  1SVF A;  1A02 J;  4EYY Q;  1ZV8 A;  1FC2 C;  2FYU K;  1R5S A;  2B89 A;  1FZC B;  1NEK C;  4OWF A;  2LXB A;  3V2N A;  4C7N B;  1FAV A;  4GOD A;  3TSI A;  2Y9Z A;  1NEK D;  4H13 B;  4L73 A;  1BGY D;  1DIP A;  1P84 D;  4YTM C;  1SQX J;  1USD A;  3SFD C;  3FWL A;  1LT9 A;  2WDQ C;  1BCC D;  1YBK A;  2N1T D;  3RL0 C;  2PFX A;  1PP9 D;  3LID A;  2V4H A;  1M57 D;  3L75 D;  2QA4 P;  3G71 P;  5AW4 B;  5AVS B;  4HJG H;  2KSJ A;  5AVW B;  1URQ D;  3R2P A;  1YTZ T;  2ZVO B;  5AVT B;  1NTK J;  2AEM A;  1GDT A;  2E75 D;  3CCS P;  4EOT A;  3U1C A;  1H88 A;  1BE3 G;  2OYH B;  1L0N K;  2QVA A;  1RF1 C;  2B87 A;  3H1K J;  4IFD K;  3H1J G;  2A45 H;  5AVY B;  4CPG A;  1SQP G;  4YTP C;  1L2P A;  1L4A B;  5C3J D;  1FZG A;  3L73 J;  3N7N A;  1L0N G;  2P1J A;  4YTN C;  1G2C B;  3AE2 D;  3W67 A;  4ASW A;  3CL3 D;  2H89 C;  2QJP B;  3RL0 g;  2ZYD A;  3U1A A;  1ZME C;  1YHQ P;  1RF0 C;  1KYO I;  2IFM A;  4EDF A;  1EXJ A;  1KIL E;  3GG2 A;  2O1J A;  1LTJ A;  1BSH A;  1NTZ K;  3EWK A;  1U7J A;  3V6I A;  3L74 J;  2FFD C;  2FYU E;  4YXD D;  1MV8 A;  1X79 B;  3L4F A;  3M91 A;  3GHG B;  1PPJ D;  5GTI E;  3AEB C;  1YYC A;  3Q3D A;  1SQQ E;  2CK3 H;  2YMK A;  3H1H G;  1NTZ G;  1OWA A;  3HRN A;  3I55 P;  1VQN P;  3BCC J;  1EQ7 A;  1SQX K;  1YTZ I;  3P8C E;  1FOS E;  3RK3 E;  2IYP A;  2KLU A;  2WPQ A;  4GT1 A;  4GIF A;  3AE6 C;  1E5W A;  2CPS A;  2J58 A;  3O8Z A;  3USS A;  1IO4 A;  2XV5 A;  2A45 G;  1WRG A;  1QGK B;  2QJK C;  4WY4 C;  2M5A A;  1X9V A;  1NKN A;  4WY4 D;  1BGY J;  5B66 H;  2KP8 A;  1SFC D;  2WTY A;  4GOE A;  3V2R A;  2YO2 A;  3L71 G;  1KD1 Q;  2WPR A;  1NTM D;  3CLQ A;  5AW3 B;  5CCG A;  2KI7 B;  2OQQ A;  2YNY A;  2KSE A;  2R5D A;  1PP9 J;  1GL2 C;  3L75 J;  4C46 A;  5AVR B;  1SQB G;  1LTG C;  3G4S P;  1AJY A;  5KLV J;  1YQ4 C;  3MUD C;  3AEE C;  3PJS K;  1M1K Q;  2P7J A;  1RE3 A;  2W83 C;  2J59 M;  5AVZ B;  4HH2 A;  1M7L A;  2E74 B;  3HUS C;  3B5N C;  2WDR D;  1GU5 A;  4IL6 H;  1QX8 A;  1K05 A;  2KLV A;  2M0B A;  5KJ7 D;  1N7S C;  3B5N D;  4Z1M H;  3CCU P;  2AEJ A;  1SQV E;  4M3L A;  4H0L C;  1KC8 Q;  3CXH H;  2N1T A;  3WMM 0;  4OGQ B;  4YSY C;  2BCC G;  1S3J A;  2FYZ A;  5AW2 B;  2K3R A;  1XTC C;  4I2L C;  1OZH A;  2I8D A;  3T97 B;  3KYQ A;  2KIK A;  2PP6 A;  3NXS A;  3H25 A;  1ZOY C;  4I7Z B;  3B8E B;  3CX5 H;  1SQX E;  5K5G B;  3TGU D;  3PLN A;  5AW6 B;  2R32 A;  3L72 G;  3IFM A;  3FWN A;  1RE4 A;  5TIS E;  1LP1 B;  1H0T A;  5CBO A;  3EQ2 A;  1T3U A;  3RL0 B;  3MD0 A;  5DJT B;  3CCL P;  3CI9 A;  1KV4 A;  2KS1 A;  4DHZ A;  1JM0 A;  1GD2 E;  2KNC A;  2WWW A;  4ZNC A;  1HH0 A;  2E5T A;  1X8Y A;  5APQ A;  4N78 E;  1MZ9 A;  1GTW A;  1JMB A;  3H1K E;  4H13 D;  3TNU A;  2V7Q H;  1PIX A;  2WSF H;  1RF1 B;  3PRJ A;  3AE9 C;  2RKL A;  4RO0 A;  2OYI A;  1OVR A;  2K88 A;  3P4P C;  2IBZ G;  3AE9 D;  3L73 E;  3ITK A;  1AV1 A;  4PD4 D;  3KPE A;  4PJ0 H;  3VMZ A;  1FZE A;  4U3F G;  1HTL C;  3L70 E;  1PV3 A;  1NTM J;  1N73 C;  1LWU B;  5AW5 B;  3O6Q B;  1ZRT D;  3P8M C;  1FOS F;  3GF3 A;  4H44 C;  5TJH A;  3L74 E;  1SLQ A;  3HTK A;  1IFI A;  1L4A C;  5APY A;  1BDD A;  3W68 A;  3RGU A;  1L4A D;  3LW5 J;  1HF9 A;  1IFN A;  1JTH A;  1VQ8 P;  4EI2 A;  4DOJ A;  1EZV G;  3V2Q A;  2VRS A;  3BCC E;  2OTL P;  3M0D A;  5E79 E;  2XU6 A;  1OW7 A;  1QVF O;  4TLF A;  3H1L G;  4BRY A;  2Z5H A;  2AXT E;  3AE3 D;  4L76 A;  1IK7 A;  1KFM A;  1FDO A;  2YXR B;  5C39 A;  2QJK B;  1U57 A;  2H7H A;  5GTH E;  4HYT B;  1GK4 A;  2O01 N;  2A45 I;  1BGY E;  4IFM A;  1P84 E;  1SP4 A;  3TGU J;  3OAK A;  1NTK D;  3H1I D;  1BCC E;  2NPS C;  4Y99 C;  2ZAE B;  1PP9 E;  3L75 E;  5KJ7 A;  1NWQ A;  1ZP0 D;  1T3J A;  1LTJ C;  1GL2 B;  1R8E A;  3H32 A;  1KIL A;  2GUS A;  1A02 F;  3VMY A;  1NAF A;  1AA0 A;  1FE6 A;  2PAJ A;  1KF6 D;  4O9B A;  2ZYG A;  2NRG A;  4W7Z A;  4KX6 C;  1KFN A;  1FDM A;  3HE5 A;  5GTI H;  1OVV A;  3HUS B;  3VN0 A;  1YIT P;  3AE5 C;  3B71 A;  1JCD A;  1N7S B;  3F5H A;  2IDB A;  1GW4 A;  1SQP J;  2WP9 D;  4H0L B;  4IFF A;  1U7M A;  1KMI Z;  1UIX A;  2A06 D;  1EDL A;  1GU4 A;  3D6Y A;  4R4L A;  3Q5S A;  1GW3 A;  1FZC A;  2FBW C;  2BS4 C;  2XKM A;  3CCV P;  2J5U A;  2WT7 B;  2Q3I A;  2E74 D;  4C7N A;  3ABV C;  1HWT C;  1DD4 A;  3AE1 C;  4UB8 E;  4YSZ C;  5AVV B;  1PPJ E;  1WT6 A;  3AE1 D;  1HVV A;  1IFP A;  3IR9 A;  2ZT9 C;  2WVR A;  2O3J A;  3KHU A;  4OGQ D;  2QM8 A;  2O01 H;  2FY8 A;  2E43 A;  2PRR A;  1YQ3 C;  1SQQ K;  3H1H J;  4AUW A;  4I7Z C;  2HLO A;  3OW2 O;  2BEQ D;  3RK2 C;  2FXP A;  3KZI E;  3VRA C;  2XNX A;  1FU1 A;  2FYU G;  1VQ5 P;  4DDG A;  3M06 A;  3VRA D;  4YTM D;  3G3Z A;  3SFD D;  2FKW B;  2WDQ D;  1SQQ G;  1DD3 A;  1FJK A;  4A7P A;  3RL0 D;  2Y0E A;  3CCM P;  5BU5 A;  5KLV D;  2IBZ I;  3CC2 P;  3VYI A;  1L0L D;  1W2B O;  3H1I J;  3Q1M A;  2QRX A;  5APV A;  1K9M Q;  1NTM E;  2W6J H;  2Y9Y A;  1NH4 A;  1G2C A;  2WS3 C;  3P7K A;  3CXH I;  2WU2 C;  3L71 J;  1YIJ P;  2QJY B;  2E5Y A;  1N73 B;  1JY2 N;  1CI6 A;  1NHL A;  3CMA P;  2FYN C;  3VP9 A;  2K9J A;  1HJB A;  4H44 B;  1NU1 D;  1M8O B;  3IF4 A;  4W80 A;  1SQB J;  4U7J A;  2DW3 A;  1LT9 B;  2JWD A;  2Y0C A;  3SWY A;  4ASV A;  1J1E C;  4ZKP A;  5TIS H;  4YTP D;  3CX5 I;  1IJD B;  1PZQ A;  4DJG A;  1KB9 D;  2UWJ E;  5H2F E;  1KYO D;  3HD7 A;  2JEE A;  3GHG A;  2O1K A;  4YTN D;  3L37 A;  2H89 D;  3RBZ A;  1LWU C;  4HB1 A;  1PGJ A;  2WQY C;  1EZV I;  5CCH C;  1QLB C;  3AED C;  1ZW0 A;  3P4Q C;  1SQV K;  2WDV C;  4KT0 J;  5B5E E;  2B87 B;  4I1L A;  2WZ7 A;  4MN4 C;  1JY2 P;  3TGU E;  1VQL P;  2BS3 C;  3AEB D;  1SQV G;  2H8P D;  1M56 D;  2MKV A;  2KZI A;  2NPS B;  1IZN B;  1IFM A;  2YMY A;  4Y99 B;  4YPC A;  3SWK A;  4N6J A;  1Q81 Q;  3V4W A;  2WSE J;  1PGP A;  1LTJ B;  4AQR D;  3AE6 D;  2WSC J;  2WPS A;  5CMZ A;  1JY2 O;  1KN7 A;  2MJZ A;  3P4S C;  2C0X A;  1SQX G;  1N2D C;  1OIP A;  1NTK K;  3CIR C;  2GA1 A;  2ZXE B;  1J2J B;  1NGM B;  3P4S D;  2M3E A;  2HOD A;  4ZKU A;  2XZR A;  4D6T D;  2Y0D A;  1KTM A;  3CME P;  1YJN P;  2OYO A;  2W6B A;  3AE4 C;  1H8A A;  4NPF X;  3CWB D;  3UIA A;  3WUV A;  1T6A A;  3M0D C;  2OTK E;  3AEF C;  2L91 A;  4LC1 A;  4PD4 E;  2L5G B;  5E79 H;  3OA7 A;  2ZYA A;  2HG5 D;  1KFY C;  1OX3 A;  1GL2 D;  3AEF D;  3HE4 B;  3Q5P A;  1L0L J;  3H1K G;  1RQV A;  3FX0 A;  2AXT H;  1ZR2 A;  1YQ4 D;  3VRB C;  3AEE D;  1Y8A A;  1ZRT E;  2YXQ B;  3MGN A;  2M5A B;  1KOR A;  5GTH H;  3OJA B;  4OVN F;  2FXO A;  3T97 A;  1TFF A;  1P84 H;  3L73 G;  1NU1 J;  2K9Y A;  3AE7 C;  1N7S D;  2C0W A;  1N8R Q;  5CHX A;  4WB4 A;  3A0B E;  3AE7 D;  1J1D C;  2P58 A;  1LP1 A;  3L70 G;  4H0L D;  3VP8 A;  2R3S A;  2ZT9 B;  5APU A;  1VDF A;  4YSY D;  1URQ A;  1D7M A;  3A7O A;  3L74 G;  2HPC A;  3RK2 B;  1WMK A;  1ZOY D;  2K37 A;  2JDI H;  4N3Y B;  2NZ2 A;  3M9H A;  4R4M A;  2WMM A;  3AE8 C;  1YJW P;  1RF1 A;  5C2T C;  3BCC G;  3MIW A;  3BRV B;  4PV1 B;  1T2K C;  2M8R A;  1NTK E;  3AEC C;  3H1I E;  2D2C B;  3RK3 C;  2W6A A;  1S9K D;  3VR9 C;  3V2P A;  3GLM A;  5AW0 B;  2IX7 C;  1RH5 B;  3TYY A;  5AW9 B;  3C1L A;  2FXM A;  2I1J A;  1JUN A;  1JY3 N;  1BE3 D;  4YT0 C;  1RF0 A;  2FYN B;  3KXD A;  3H1J D;  5DJU B;  3O6Q A;  3II6 A;  1BGY G;  5KLV K;  3D6Z A;  1SQP D;  4YXW H;  1L0L K;  3P4P D;  3S1K A;  4UB8 H;  3IN6 A;  5KKZ B;  1J1E B;  1BCC G;  2IYO A;  1AQT A;  4D6T J;  2FFD A;  1PP9 G;  1L0N D;  2KS1 B;  1S5L X;  3L75 G;  4UB6 E;  2KNC B;  4FJV A;  3KDP B;  2QJY C;  3M0A A;  3CWB J;  1W2E A;  4IL6 X;  3FGA D;  3JCU E;  1G1J A;  5KAF E;  5CJ4 A;  2A06 E;  2B9B A;  2WSS H;  3KZI H;  1DH3 A;  4H44 D;  3M9B A;  1LT9 C;  4XFJ A;  1OW6 A;  1IFJ A;  5KTB A;  1CW5 A;  5EFW B;  5APT A;  2OYI B;  2HR3 A;  1PGO A;  3H6P A;  1KZU B;  2JP3 A;  1RHZ B;  2JO1 A;  4WY4 A;  5M1B A;  3AEA C;  1VF5 C;  2R3C A;  3H1H D;  1NTZ D;  1SFC A;  1Y9B A;  2JR8 A;  4JF7 A;  4QMA A;  1X22 A;  2WIT A;  1QVG O;  2ZXX A;  3LIE A;  4KHX A;  1JB0 J;  4DZO A;  4WBA A;  1JY3 O;  3D70 A;  3WUT A;  3SFE C;  1LNQ A;  1Y47 A;  2RN0 A;  3C9I A;  1FJP A;  3VMA A;  3LW5 H;  1IFD A;  2E76 B;  2QIW A;  1DX7 A;  2HYN A;  1S5L E;  1PPJ G;  3HD7 C;  4K3A A;  1MFT A;  5H2F H;  2B88 A;  1Q82 Q;  3L71 D;  2Q5U A;  2NPS D;  3G9R A;  3EFG A;  3RBX A;  3HUS A;  4C7R A;  1M1J A;  3B5N A;  1AFO A;  5KLV E;  1YI2 P;  1L0V C;  4DDI A;  1N7S A;  1L0L E;  5KLI B;  1SQB D;  1GMJ A;  2IPP A;  4WVZ A;  2GM4 A;  3P32 A;  5APW A;  2E42 A;  5B5E H;  1CSB A;  2HFE D;  2R44 A;  2JKV A;  4JPZ B;  1ZXG A;  1NTM K;  4KX6 D;  1BE3 J;  3P4R C;  1NU1 E;  3H1J J;  1W5C E;  2WT7 A;  1S72 P;  4WWI A;  1BSN A;  4IOI H;  3AE5 D;  1FDI A;  1JEK A;  1Q90 D;  2N9B A;  4L74 A;  1KB9 E;  1NTM G;  1KYO E;  2KB7 P;  1J1D B;  2BCC D;  4ZMD A;  2KXP B;  1L0N J;  3H32 B;  1KIL B;  2H88 C;  4RJT A;  4K35 A;  2H43 A;  2H88 D;  4DT0 A;  3E1I A;  1UII A;  4LGD E;  2JJL A;  3I56 P;  1KQF B;  2FBW D;  3BVH A;  2ITA A;  2QSI A;  1E7P C;  3L72 D;  1FZF A;  5CCG C;  3ABV D;  1QLE D;  5AVU B;  1N7L A;  2KYV A;  3WU2 H;  4YSZ D;  2B76 C;  5CCG D;  1ZN5 A;  1NYH A;  4PD4 H;  2B76 D;  2ZT9 D;  4L75 A;  1JNM A;  3RK3 B;  2Q9I A;  1NTZ J;  1RE3 C;  3CD6 P;  1YQ3 D;  1EDK A;  2C9N Y;  1Q2N A;  3RK2 D;  2OYH A;  1N73 A;  1LTB C;  2YKQ A;  3TGU G;  3L36 A;  2KUB A;  4AYC A;  2IBZ D;  4PV1 C;  1FBM A;  1NAY A;  2N1T C;  4EIJ A;  2D2C C;  4D6T E;  5BVZ A; 
#chains in the Genus database with same CATH homology
 3AEG D;  1KIL E;  2JP3 A;  2FBW C;  4PV1 D;  3AE8 C;  1YQ4 C;  2JO1 A;  4U7J A;  1ZP0 C;  2BS4 C;  3AE5 D;  1L0V D;  1IK7 A;  3AEE C;  5M1B A;  1FDI A;  1FDO A;  2J5U A;  3AEA C;  4H13 D;  1Q90 D;  2D2C D;  1KTM A;  1VF5 C;  5C2T C;  1NEK C;  1U57 A;  1PIX A;  2E74 D;  1TU3 F;  4YTP D;  3AE4 C;  3AE9 C;  2G8Y A;  1OW8 A;  3EWK A;  3ABV C;  1KF6 C;  4PV1 B;  1DD4 A;  3AE1 C;  3AEC C;  3R4Y A;  1NEK D;  4H13 B;  4YSZ C;  3P4P C;  2D2C B;  3S9O A;  4YSX C;  1Y9B A;  1PL5 A;  2E75 C;  2H88 C;  2WS3 D;  3AE9 D;  3AEF C;  2E74 B;  2WU2 D;  3VR9 C;  1DIP A;  2BS2 C;  4YTN D;  2WDR D;  3AE1 D;  4YTM C;  1S1C X;  4YXD D;  1K05 A;  2H89 D;  3GLM A;  3SFD C;  2ZT9 C;  1KFY C;  4YSX D;  3P4R D;  3AEB C;  1K04 A;  2H88 D;  3AEF D;  1JB0 J;  2E76 C;  2WDQ C;  3CIR D;  4OGQ D;  4Z1M H;  3Q5P A;  2V7Q J;  3D70 A;  2WQY C;  3Q3D A;  2WSF J;  5KKZ C;  2YMK A;  1RQV A;  3SFE C;  1RQU A;  4H0L C;  1KQF B;  2FBW D;  2E76 D;  1YQ4 D;  1QLB C;  1ZP0 D;  3AE8 D;  3AED C;  4YT0 C;  3VRB C;  3AEE D;  2WDV C;  3P4Q C;  1YQ3 C;  2WU5 C;  3AEA D;  1R8E A;  1PV3 A;  2QSI A;  4KT0 J;  4I7Z C;  1VF5 D;  4OGQ B;  1ZRT E;  1E7P C;  2G3A A;  4YSY C;  5C2T D;  3O6Q A;  2QJP C;  1KOR A;  2BEQ D;  3AE4 D;  3RK3 E;  2WP9 C;  2FXP A;  3ABV D;  1KF6 D;  2WU5 D;  3VRA C;  2WPV B;  2E76 B;  2QIW A;  3D6Z A;  3Q2Y A;  5C3J C;  3AEC D;  3IAO A;  3C8V A;  4YSZ D;  3P4P D;  2B76 C;  3AE6 C;  3GF3 A;  4H44 C;  5KLI C;  2E75 D;  1VF5 B;  3IN6 A;  4KX6 C;  3AE2 C;  3VRA D;  2K9Y A;  2YIU C;  3T97 B;  3VR9 D;  2O01 J;  4RKU J;  4YTM D;  1NYH A;  3H25 A;  3G9R A;  2B76 D;  4Y28 J;  1ZOY C;  2ZT9 D;  3AE7 C;  3D71 A;  4I7Z B;  1KFY D;  1NEN C;  2BS3 C;  2QJK C;  3AEB D;  2P10 A;  2WDQ D;  1S5L X;  2E75 B;  3AE3 C;  3Q5R A;  1DD3 A;  2MKV A;  2WQY D;  3AE7 D;  3SFE D;  1NEN D;  3AE5 C;  2QJY C;  1L0V C;  1OMI A;  3GF7 A;  4H0L D;  4H13 C;  3B71 A;  3LW5 J;  1HF9 A;  4YT0 D;  3AED D;  1GMJ A;  1HJ0 A;  2ZT9 B;  2WDV D;  3P4Q D;  3VRB D;  2BEZ F;  1KQG B;  1YQ3 D;  4IL6 X;  3FGA D;  2E74 C;  2IDB A;  3VR8 C;  4YSY D;  4YTP C;  3Q1M A;  1MKM A;  4GDO A;  3SFD D;  2WP9 D;  4H0L B;  3VR8 D;  2WSE J;  5C3J D;  2ACZ C;  1VL2 A;  1KMI Z;  1EXI A;  2WS3 C;  3AE6 D;  4H44 D;  2WSC J;  1UIX A;  2WU2 C;  2OQQ A;  4XFJ A;  1OW6 A;  4KX6 D;  4YTN C;  2WDR C;  3AE2 D;  1OW7 A;  4YXD C;  2H89 C;  5L8R J;  3RL0 g;  3P4S C;  2ACZ D;  1WMK A;  2FYN C;  3P4R C;  3AEG C;  4PV1 C;  1ZME C;  1ZOY D;  3CIR C;  4OGQ C;  4TT3 H;  3D6Y A;  1NGM B;  1AJY A;  4R4L A;  2D2C C;  3GMA A;  4H44 B;  3Q5S A;  3P4S D;  2NZ2 A;  3AE3 D;  4R4M A;  1EXJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...