4YTPC

Crystal structure of porcine heart mitochondrial complex ii bound with n-[(4-tert-butylphenyl)methyl]-2-(trifluoromethyl)benzamide
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
total genus 52
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2015-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4ytpC01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 4ytpC02
4YSZD 2WP9D 3AEAC 3P4RC 3AE4C 1QLBC 1YQ4D 3AE1D 3VR8C 2B76D 3AE7C 2WU2D 3AE8C 2ACZD 4YTMC 3ABVC 2WS3D 3AEDC 3VR9D 3AEFD 2WQYD 3AE2C 4YTNC 4YSXD 3S9OA 1L0VC 1OW8A 3AEGD 4YT0D 1ZP0D 2WDQD 3P4PC 1ZOYC 4YSZC 2WU5D 2H89C 5C2TD 3AECD 2BS3C 1YQ4C 3AE1C 4KX6C 4YXDD 1OW7A 3AE3C 2WDRD 2G3AA 3AE8D 1PV3A 3AEGC 4YT0C 4YSYC 1NEKC 4YTPD 1E7PC 1NEND 3VRAC 1KFYC 2WP9C 2BS2C 3ABVD 3AEAD 2WS3C 4YXDC 3AEFC 3VRBD 3AE6D 3P4SD 2H89D 3AEED 3AE9D 5C3JD 3VR9C 3AE5D 3AE2D 3AEBD 1KF6C 2WDVC 3VRAD 3AE7D 3SFDC 3P4QD 3CIRC 2FBWC 2H88C 3AE6C 4YTPC 1ZOYD 2WQYC 3SFED 1K05A 4YTND 1K04A 4YSXC 4YTMD 2BS4C 1L0VD 1ZP0C 2WDQC 3P4PD 3AE5C 1NEKD 3B71A 3AE4D 1YQ3D 1KF6D 1NENC 1KTMA 3P4QC 2FBWD 2ACZC 2H88D 1OW6A 3AE9C 5C3JC 4YSYD 3P4RD 4KX6D 3SFEC 3AEBC 2WDVD 3VR8D 2B76C 1KFYD 2WU5C 2WU2C 3CIRD 3AEEC 5C2TC 3AE3D 3AECC 3AEDD 1YQ3C 3VRBC 3P4SC 2WDRC 3SFDD
chains in the Genus database with same CATH superfamily
2A45G 1BDDA 5KKZC 1JMMA 3ABVC 3AEDC 1FU1A 1RF1B 3VR9D 4CPGA 3CXHH 2B87A 5APYA 1M1JB 1Q82Q 2FYNC 4Y99B 1ZP0D 3HD7A 1S3JA 4WWIA 4NPDA 1M1KQ 1L4AA 1AQ5A 2OTLP 3LIDA 3G9RA 2WZ7A 4YT0C 2AEMA 1FAVA 1GD2E 3KDPB 3CCVP 1KFYC 1LTJC 1SQXG 5AVWB 2ZYAA 1QGKB 1ZLLA 2K88A 2WSEH 3AE9D 2HG5D 3FXDA 4GDOA 1FE6A 5KAFH 2QJPB 1TFFA 1LNQA 1L0VD 2KUBA 2RMZA 1VF5D 3P4PD 1YJNP 2QEXP 1KTMA 3T97A 2ZFYA 4PJ0H 2WPQA 1SQQG 2H88D 2WSFJ 1NAFA 1PGOA 1NGMB 2K1AA 2IFMA 3M91A 3BRTB 3HRNA 5AW1B 1FZEA 3AECC 3M0DA 1PGPA 2QRXA 2M8RA 2B89A 1MKMA 3HUSB 3SSUA 3PJSK 3WUTA 4AYCA 2O1JA 1SQVE 2SPZA 4YTMC 1PPJG 1X0TA 2KK7A 1ZRTD 4D6TJ 3BCCJ 1FJKA 3CLQA 3CC4P 4PD4H 2WT7A 1JO5A 2ZT9C 3AEGD 3Q2YA 1JMBA 2WVRA 4Y99C 5AW7B 1OW7A 2WDRD 3SWYA 1L0LE 2D2CB 1LTGC 3L73J 1MFTA 3JCUE 4IOIH 2KNCA 2BASA 5CJ0A 1GU5A 3AEAD 2P1JA 4N3YB 1IFMA 5AW5B 2L5GB 4U3FJ 1Y8AA 1HH0A 1GW3A 3FX0A 1NU1D 1NWQA 2OYHB 4Y28J 2WDVC 1OVRA 2E74D 1R5LA 2P58A 3MTUE 4YTPC 1L2PA 1L0LG 5APTA 3RK3C 1PL5A 4DDGA 4WY4C 4H44D 1SP4A 3H32B 1FDMA 5KLVD 3MHVA 4UB6H 3CCQP 2FBWD 2J58A 2YXRB 1YHQP 2I8DA 2ZT9B 1DH3A 1DD4A 2HPCB 1KN7A 3VRBC 1L4AB 3M9QA 2R32A 2E76C 3A7OA 1GL2D 2Y9ZA 5KJ7A 3WMM0 3VMXA 1YYCA 2FXMA 5APXA 4DT0A 3CC7P 4LGDE 3CXHE 2QG4A 4EOTA 1L0NJ 5K5GB 2JWAA 1SQQE 2L91A 4K35A 1YTZT 3V2RA 1PP9G 2Q3EA 4KT0J 3B4SA 5L8RJ 2AXCA 3V2NA 2A06E 2KZJA 2YIUB 4I6MC 3CXHD 5M1BA 3I55P 3B5ND 3H1LE 2E76D 3WU2E 3CD6P 4L75A 3II6A 1EDJA 4H13B 1EZVD 3RL0g 1JY2N 3W67A 3GLMA 5KJ7D 1NTZJ 1JY2O 1SQXK 2QJKC 5KLVG 1GW4A 2A45H 1SQVJ 2NRGA 3AE7D 2KSEA 3JCUH 3QH9A 1JY2P 3O6QA 2WDQC 4DHJA 1EZVE 4EI2A 3A0HH 1GK4A 4GOFA 3CC2P 3AE9C 3P4RD 5KAIH 4GOEA 1FZAA 3SWKA 3IN6A 3B5NA 3V2PA 3Q3DA 1VQ9P 4H0LC 2YKPA 4PV1D 1YQ3C 1BCCD 1EXJA 3D71A 1N7LA 2IPPA 3TK1A 2KXPB 2JR8A 3M0AA 3F5HA 4EDFA 5AW8B 1KB9I 4MN4C 1M1JA 5AW0B 3HE4A 2BEZF 3MUDA 1BE3D 2XKMA 1EDLA 5AW9B 5H2FH 2OYHA 3L72J 3MD0A 1ZRTE 1SQVK 1KYOE 2Q5UA 1R8EA 3L70D 3P32A 2WMMA 1OZHA 2E74C 1VQOP 3H32A 2M5AA 5CMZA 4WB4A 2R44A 2LKMA 2HR3A 2BCCJ 3V4QA 3L70E 2HPCA 1FBMA 1XTCC 1FZFA 1FC2C 1T2KD 3M06A 1MFZA 2WQYC 3GHGA 3H1HE 1K05A 3L73G 1N8RQ 1LTIC 4OH8B 4YSXC 3H1IG 1ZP0C 2Z4EA 1YQ3D 3E7KA 2YO3A 1J2JB 5BU8B 2FY8A 4W80A 1N73A 3CX5H 5CCHC 3G3ZA 1AA0A 2P2UA 3H6PA 5APWA 1XTGB 2N9BA 3H1HJ 1PPJD 4UB8E 4M3LA 5CCGA 2XZRA 1SQQJ 5B5EE 3S1KA 3D6ZA 1USEA 3GMAA 3IR9A 2E5YA 5AVTB 3BVHA 1KQGB 2XU6A 3EFFK 2ZYDA 1Y9BA 2E74B 1TU3F 1L0LD 2YO2A 2WT7B 1GMJA 3H25A 1NH4A 4YTNC 2KZIA 1EDKA 4YSXD 3MP7B 3S9OA 4H44B 5GTIH 2PRRA 4EIJA 1URQD 2IYPA 3VTPC 1EXIA 1NU1E 2WPVB 2YMYA 1VDFA 1NHLA 5AVSB 1HBWA 5KLVJ 2H7HA 2V7QH 2ZT9D 1IZNB 3AEGC 1BCCJ 3CCJP 1L4AD 1WRGA 1LWUC 5CCGD 1GL2B 2OYHC 4IFFA 4EYYQ 5TISE 1OX3A 3CCSP 1SFCB 2P7JA 3L74J 3AE5D 3AE2D 3H1JG 1HJ0A 2HODB 3OA7A 1X9VA 1URQA 1FZCC 2P10A 5KLIB 1NENC 4RJTA 2FKWB 3ITKA 3MZWB 1EQ7A 2WSSH 2E76B 1KFYD 2WSCH 2IZ1A 4H13D 3KPEA 2P67A 2E75C 1LGHB 1DX7A 3AEAC 3MUDC 2XV5A 3VONA 2ITAA 4BWNA 3H1KJ 2Q7CA 1N7SA 2WU2D 2A06D 2Y0EA 1S9KE 2M3BA 4D6TE 2M5AB 5KKZB 1SQPD 3EQ2A 3H1LD 1Q7YQ 1N86A 1LWUB 2JO1A 4GIFA 1IK9A 3H1LJ 1L0VC 4YT0D 1FOSE 2ZJSE 1A02J 3G71P 4R4LA 1HVVA 3TGUG 1T8ZA 3F89A 4ZNCA 3AE8D 1BE3E 1JOCA 1RF0C 1Y47A 4PV1B 3GG2A 1X22A 2R5BA 1LTTC 3EWKA 5AW4B 3USSA 4B86A 2JDIH 3ABVD 1LT9A 3VRBD 1NJIQ 3AE6D 3P4SD 4YXWH 2WSEJ 3O8ZA 2QJYC 2W6JH 3SFDC 3CIRC 1G1IA 3HE5B 2H88C 1IC2A 2BS4C 1JY3O 3L75G 3TGUE 1N73B 3TNUA 4U3FE 1NTKJ 4PD4I 1J1EC 4XFJA 1SQPJ 1KV4A 2DW3A 1KQSO 3AEBC 1KILB 1JNMA 3I56P 2YNYA 5GTHH 3AEEC 2C9NY 1S1CX 2W6BA 3C9IA 1VQLP 3JC22 1CI6B 2FXPA 1NTZD 5EFWB 2YMKA 3P4RC 4U3FG 1KYOD 4U3FD 1M57D 3CMEP 3GF3A 1Q90D 2O01J 4JPZB 1GL2A 4HB1A 1KMIZ 1KILE 4ZKPA 3RK3D 2K9JB 1NTMD 2ZFCA 1NTZE 3G6EP 1WT6A 3CI9A 2OTJP 2FYUJ 3QWOC 3HD7C 1GZLA 5TJHA 3L75J 2H43A 1KZUB 4DJGA 4PV1C 1NTKK 1KB9E 1IFJA 1HUCA 1FDIA 1SQVG 1OXZA 1LP1B 1YI2P 5TISH 1K9MQ 1YJ9P 4HJGH 2BCCE 2HODA 1LTJA 4I2LC 3GHGB 2FBWC 4C7NA 2QJYB 2IBZI 2OQQA 5KAFE 1S72P 1ZOYD 3SFED 4W7ZA 1VQ5P 1URQB 2KS1A 2HFED 2GA1A 4I6LA 2W6AA 1JY3N 3IAOA 1OMIA 1FOSF 3ZDMA 1EDIA 3H1KD 4L76A 1L0NG 4ZMDA 3V6IA 1FDOA 2QE7H 3SFDD 2W8ZA 1RE3C 1LJ2A 2FYUK 1SFCD 2C0XA 1LTAC 2KLVA 2JJLA 2VRSA 1OVVA 2FYNB 4OGQB 5GTHE 4A7PA 1A02F 4HH2A 2WDQD 3B5NC 3L35A 2KYVA 1VQNP 1KFMA 4O9BA 3RBZA 2WTYA 5AVRB 4YXDD 3P8MC 1SQBE 4I7ZC 5AW3B 1HWTC 3L71D 3L4FA 3L73E 1DIPA 1L0LJ 1VQ6P 1SQQD 2IDBA 2WP9C 1IFIA 3LW5H 2WS3C 3KYQA 3CCRP 1GTWA 3S4RA 4AQRD 1H8AA 2R3CA 3HUSA 2IYOA 1SQBD 3L74E 4BRYA 1EZVI 1KD1Q 1RH5B 5AVYB 1Q86Q 4U7JA 1NU1K 4NPFX 4UB8H 3LW5J 3AE5C 3CXHI 3PLNA 1URQC 2AEFA 4D6TD 2QM7A 1QX8A 2K9JA 2PAJA 1SQPE 4OVNF 2N1TB 2FFDB 3HUSC 2B76C 3CIRD 4QMAA 3CPWO 1AVOA 1KQLA 1GDTA 2KNCB 1FZCB 1YQ4D 4ZKUA 2V4HA 2CK3H 2IBZD 1G2CA 1LWUA 4I1LA 1SLQA 4XE5B 1BCCE 1DD3A 3L71G 1BE3J 2K9YA 4NPEA 3G4SP 1LP1A 3PP5A 1OW8A 1RQUA 4DHZA 3MIWA 3RL0B 1H0TB 1HGZA 4ASWA 1RE4C 2B9BA 3AE1C 1KILD 2QA4P 3D70A 3VMAA 1NTMJ 2CPSA 2AXTE 3H1JD 4I7ZB 2PP6A 2C9LY 5APVA 3TGUD 3AEFC 5AVXB 3CL3D 3VP9A 2BCCG 4C7NB 1AFOA 3RK3B 1JTHB 1IJDB 4WBAA 2NPSC 1KQFB 4GKGA 3H1JE 1KYOI 3A5TA 2A45I 3U59A 2WPSA 1Q2NA 1HGVA 2KIKA 2ZXEB 4L74A 3P4QC 4WVZA 1CSBA 3A0HE 1KILA 2O01N 2IX7C 3OJAB 1S5LE 1L0NK 3H1HD 1OWAA 3RK3E 5C2TC 1NTME 3Q5SA 3TSIA 4GT1A 3AEDD 4PD4D 2FFDC 3NXSA 1JCCA 4KJMA 3TGUJ 3FWNA 1LTSC 1AJYA 1PPJE 1LT1A 4GODA 1N7SD 1VF5C 3P4PC 1NTZK 3BRVB 3WU2H 1JUNA 1NKZB 1M1JC 2H89C 3H1KG 3R2PA 3CCUP 2BS3C 3FGAD 3O6QB 2E42A 1BCCG 4HKZH 1KYOH 2JWDA 4IFDK 1T2KC 1PGQA 2GUSA 1VQMP 3W68A 4OGQD 3GHGC 3RGUA 4FJVA 2O3JA 1PFIA 3WUVA 1YJWP 4BXLA 3PH0A 5KLVK 3C1LA 2RKLA 3H1JJ 2GUVA 1NAYA 3L75D 5E79H 4H13C 2XNXA 1SQBJ 3CCMP 2E75D 5C3JC 2WPRA 2Q9IA 5KLIC 3CX5E 1QVFO 4ASVA 1BGYG 2WU2C 4LLHA 1ZW0A 1YBKA 2KLUA 1L0ND 2O1KA 1ZR4A 1FZCA 2I1KA 3AE1D 3L71E 1VQ8P 1X79B 3L73D 1W2EA 2Y9YA 2MJZA 2FYZA 2ZVNB 1PIXA 1FZBA 1ZMEC 1H0TA 3T97B 2YKQA 4RKUJ 1S9KD 5C2TD 3AECD 4JYBA 1BSNA 2IBZG 1YQ4C 2N1TD 2Q1KA 3TDKA 2FXOA 3L70J 1R5SA 2H8PD 3GF7A 1MUUA 2QSIA 3HTKB 3OW2O 2BS2C 2Q6QA 2UWJE 3CX5I 2D2CC 3BASA 4YXDC 1SQBK 5APQA 1ZR2A 1NU1G 2GM4A 4HYTB 4YPCA 2AEJA 4BRYB 4Z1MH 1VQKP 1BGYJ 1MV8A 1JTHA 1Q81Q 1IK7A 1UIIA 3P8CE 1SQQK 4IL6H 3RL0D 2OYIB 4TT3H 5CCGC 3L72E 1VL2A 1KF6D 4PJ0E 2N1TC 4AUWA 4K3AA 2FFDA 4KHXA 4YSYD 2YKOA 2LR2A 2JKVA 2Z5HA 1JEKA 5CCHA 2W83C 2LXCB 2NPSD 1U57A 1KILC 3B71A 3CCLP 3JSVC 2E43A 1SQBG 2WP9D 3A0BH 1T6AA 3KZIE 3AE4C 1QLBC 3TF5A 1L4AC 2KOGA 2ACZD 1QL1A 1KC8Q 3RL0C 2W90A 4C7RA 1SFCA 3PHLA 1GK6A 3OAKA 3E1RA 1DEEG 2POHA 3N4XA 1H89A 3TYYA 3H1LG 1LT9C 1NTKE 1GL2C 2B88A 2BEQD 1FS0E 5CCHD 3EFGA 3NTNA 4YTPD 1NEND 5APSA 2NPSA 1PP9J 2W27A 1KB9H 1JY3P 1ZN5A 2H89D 3WUUA 1USDA 1NTKD 4H0LB 1N7SB 2QJKB 1VQPP 1KB9D 2ZVOB 2ZYGA 1N2DC 2R5DA 4YTMD 1T3UA 1NOHA 2BCCD 5B66E 1AVYA 2NZ2A 3L36A 4OGQC 1OVUA 1IFPA 2RN0A 2WDVD 1SQVD 2OGUA 2WU5C 1QLED 2QJPC 2WDRC 4JF7A 1IFDA 4IFMA 3MGNA 4L73A 3VMYA 1LT9B 3CX5D 3H1KE 3VR8C 5AVVB 3HTKA 3M9HA 2A06G 3NFQA 1RF0A 2IZ0A 2WQYD 3AE2C 3VP8A 4DZOA 1PP9E 2KI7B 3L74G 4C46A 5BU5A 2E75B 3H1HG 2M0BA 1DEBA 5DJTB 4DHIB 3GW6A 4KX6C 5CHXA 3NMDA 1U7JA 2OYIA 2V7QJ 1PV3A 1KFNA 2XNDH 2Q3IA 4LC1A 2R3SA 3VMZA 1NTMG 2PFXA 3H1IJ 5H2FE 3L75E 1M8OB 2E5TA 5AW2B 3U1AA 4TLFA 4R4MA 1SQPK 1NO4A 3AEED 5BVZA 4DDIA 3HE4B 1JCDA 2QVAA 3VR9C 2O01H 1PZQA 4IL6E 2I1JA 1S5LH 4WY4B 1OIPA 1G1JA 3AE6C 2M3EA 1K04A 1N7SC 1NEKD 3AE4D 4N78D 3E1IA 1UIXA 3U1CA 3IFMA 3L74D 2ACZC 1QL2A 3P8CD 1W2BO 1RE3A 3VR8D 2WSCJ 2OYOA 4H44C 1HF9A 1BE3G 3A0BE 3I5CA 3V4WA 3V2QA 1NU1J 5CBOA 2XDJA 2J5UA 1N73C 4N78E 1BSHA 2WITA 1J1EB 1E79H 3RK2B 3A3YB 3PRJA 2IFNA 1EC5A 1NKNA 1LTJB 2B87B 5B5EH 2OTKE 1SVFA 4D6TG 1U7MA 3L72G 4YSZC 2WU5D 2IBZE 2YIUC 3HD7B 1SFCC 2KS1B 3AE3C 2G3AA 1QVGO 1KORA 2FYUE 1K73Q 2NPSB 2K3RA 2K37A 5GTIE 3L72D 4LDTA 5AVUB 1E5WA 1K8AQ 3M9BA 5E79E 1YITP 1RE4A 1HJBA 1D7MA 1CZQA 3CWBJ 2OYIC 3PTZA 1MZ9A 1OFCX 3VRAD 3P4QD 2FYUD 4DOJA 2N9YB 3BCCE 2ZXXA 5KJ7C 2JP3A 2OARA 3H1IE 3VOPA 4JBZA 1ZXGA 1P84H 3RK2C 3SFEC 1SQXJ 3Q5RA 3M0DC 1YIJP 3P4SC 5C39A 1S2EA 1S4XA 1J1DC 4OWFA 4UB6E 1Z56A 1T3JA 1H88A 4H0LD 1SQXD 1L0LK 1RQVA 2WS3D 4PD4E 4DCKA 1VQ4P 1RF1A 2WWWA 1AQTA 1BDCA 1QEXA 3CCEP 1FJPA 1ZOYC 1RHZB 1HTLC 3A2AA 3RBXA 1VF5B 3VN0A 4N6JA 3UIAA 1SQXE 2QM8A 4YSYC 5CBNA 3Q5PA 3V5BA 1JB0J 3VRAC 2N1TA 2J59M 2FYUG 3Q1MA 2QIWA 2CPBA 1M90Q 1AV1A 4XA4A 3CWBG 2KP8A 1M7LA 1S5LX 1M56D 1G2CB 5AVQB 1EZVG 1LTBC 2JEEA 1VPCA 2Y0CA 1CW5A 1JM0A 2KSJA 5CJ4A 1VQ7P 2C0WA 3KZIH 2ZAEB 3L71J 5B66H 1OW6A 2KB7P 1SS1A 3B8EB 1PP9D 2Z5IA 2D2CD 3K5BA 1SQPG 4YSZD 1NTKG 4JQ0D 5AW6B 3SWFA 2LXBA 2YXQB 1P84E 3FWLA 2B76D 3AE7C 3HE5A 1NTMK 5KAIE 3AE8C 4WY4D 1J1DB 3CWBE 3AEFD 1L0NE 2HLOA 3C8VA 4RO0A 1PGJA 5DJUB 3TNUB 2AXTH 2PGDA 2MKVA 1X8YA 2HYNA 1W5CE 1BGYD 1P84D 4IL6X 3VYIA 3L70G 2RH0A 1NYHA 1CI6A 3CWBD 3IF4A 1RF1C 1NEKC 1E7PC 1WMKA 1ZV8A 5KTBA 1P84I 2G8YA 5AVZB 1GU4A 3P7KA 1RY3A 3D6YA 3RK2D 3L37A 1FZGA 1BGYE 5C3JD 1NVOA 2Y0DA 4RESB 3AEBD 1KF6C 3KXDA 4WY4A 2WSFH 3KHUA 5KLVE 3CMAP 3BCCG 4W7YA 3N7NA 3BATA 4YTND 1YTZI 3HD7D 1IFNA 3LIEA 1NTZG 3BCCD 5APUA 3KQGA 4KX6D 1IO4A 3R4YA 3H1ID 3B5NB 4JYCA 3FXEA 3AE3D
chains in the Genus database with same CATH topology
4YSZD 2E75C 2E76C 3D6ZA 2WP9D 3AEAC 2YMKA 3GMAA 3P4RC 3AE4C 5KKZC 1QLBC 1YQ4D 3AE1D 2J5UA 1KQGB 3VR8C 4H0LD 2B76D 3AE7C 1Y9BA 2E74B 2WU2D 3AE8C 4OGQB 2ACZD 1TU3F 3GF3A 1AJYA 4YTMC 1RQVA 3ABVC 2WS3D 1Q90D 2O01J 3AEDC 1GMJA 3VR9D 3AEFD 1DD3A 3H25A 2WQYD 3AE2C 3C8VA 1KMIZ 1KILE 2BEZF 4YTNC 2K9YA 2JO1A 1PIXA 2FYNC 4YSXD 1ZMEC 3S9OA 1L0VC 1OW8A 1RQUA 2ZT9C 3AEGD 1VF5C 1ZP0D 4H44B 2WDQD 3P4PC 4YT0D 3T97B 1ZOYC 2MKVA 3Q2YA 4YSZC 4RKUJ 2WU5D 2E75B 2H89C 4R4LA 1EXIA 2YIUC 5C2TD 2WPVB 3AECD 2BS3C 1ZRTE 3FGAD 2WDRC 1VF5B 4KT0J 1YQ4C 3AE1C 4KX6C 4YXDD 5L8RJ 1OW7A 3AE3C 4I7ZC 2G3AA 1R8EA 4IL6X 2WDRD 3D70A 3AE8D 3G9RA 3P4PD 1KORA 2E74C 2V7QJ 1PV3A 1NYHA 2ZT9D 3AEGC 5M1BA 4YT0C 2BEQD 2D2CB 4PV1B 1DIPA 3GF7A 4YSYC 3Q5PA 1NEKC 4YTPD 1E7PC 2QSIA 3EWKA 1NEND 1WMKA 2WDQC 4I7ZB 1JB0J 2IDBA 3VRAC 2E76D 1KFYC 2G8YA 2WP9C 2BS2C 2WS3C 3ABVD 3AEAD 3Q1MA 4H13B 2D2CC 4PV1C 4YXDC 3AEFC 2QIWA 3RL0g 3AE6D 1FDIA 3VRBD 3GLMA 4R4MA 3P4SD 2WSEJ 2H89D 4OGQD 3D6YA 3AEED 2QJKC 2QJYC 3AE9D 5C3JD 3VR9C 3AE5D 4Z1MH 3AE2D 4Y28J 3AEBD 1KF6C 2WDVC 3VRAD 4H0LB 3AE7D 3SFDC 3P4QD 2E74D 1IK7A 4GDOA 1HJ0A 3CIRC 2FBWC 1S5LX 2H88C 2OQQA 3AE6C 4YTPC 1KQFB 1ZOYD 2WQYC 3SFED 1K05A 4YTND 4TT3H 2JP3A 4U7JA 1K04A 4YSXC 1PL5A 3LW5J 3O6QA 2BS4C 4YTMD 1L0VD 1VF5D 1ZP0C 4H13C 1VL2A 2P10A 3AE5C 4H44D 1NEKD 1YQ3D 1KF6D 1NENC 3AE4D 1KTMA 1UIXA 3P4QC 2NZ2A 3IAOA 4OGQC 4XFJA 2E75D 2FBWD 2ACZC 2H88D 1OW6A 2WSFJ 3AE9C 5C3JC 3P4SC 4YSYD 3P4RD 1OMIA 5KLIC 4KX6D 3SFEC 3AEBC 3Q5RA 3IN6A 1NGMB 2WDVD 3VR8D 3R4YA 3Q3DA 4H0LC 2B76C 2E76B 1KFYD 2WU5C 2WSCJ 2WU2C 3AEEC 3RK3E 3CIRD 3AE3D 5C2TC 2ZT9B 1S1CX 3Q5SA 3AECC 4H13D 4H44C 2D2CD 4PV1D 3AEDD 1YQ3C 1DD4A 3VRBC 1FDOA 1HF9A 1U57A 2FXPA 2QJPC 3D71A 1EXJA 3B71A 1MKMA 3SFDD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YSZ D;  2WP9 D;  3AEA C;  3P4R C;  3AE4 C;  1QLB C;  1YQ4 D;  3AE1 D;  3VR8 C;  2B76 D;  3AE7 C;  2WU2 D;  3AE8 C;  2ACZ D;  4YTM C;  3ABV C;  2WS3 D;  3AED C;  3VR9 D;  3AEF D;  2WQY D;  3AE2 C;  4YTN C;  4YSX D;  3S9O A;  1L0V C;  1OW8 A;  3AEG D;  4YT0 D;  1ZP0 D;  2WDQ D;  3P4P C;  1ZOY C;  4YSZ C;  2WU5 D;  2H89 C;  5C2T D;  3AEC D;  2BS3 C;  1YQ4 C;  3AE1 C;  4KX6 C;  4YXD D;  1OW7 A;  3AE3 C;  2WDR D;  2G3A A;  3AE8 D;  1PV3 A;  3AEG C;  4YT0 C;  4YSY C;  1NEK C;  4YTP D;  1E7P C;  1NEN D;  3VRA C;  1KFY C;  2WP9 C;  2BS2 C;  3ABV D;  3AEA D;  2WS3 C;  4YXD C;  3AEF C;  3VRB D;  3AE6 D;  3P4S D;  2H89 D;  3AEE D;  3AE9 D;  5C3J D;  3VR9 C;  3AE5 D;  3AE2 D;  3AEB D;  1KF6 C;  2WDV C;  3VRA D;  3AE7 D;  3SFD C;  3P4Q D;  3CIR C;  2FBW C;  2H88 C;  3AE6 C;  4YTP C;  1ZOY D;  2WQY C;  3SFE D;  1K05 A;  4YTN D;  1K04 A;  4YSX C;  4YTM D;  2BS4 C;  1L0V D;  1ZP0 C;  2WDQ C;  3P4P D;  3AE5 C;  1NEK D;  3B71 A;  3AE4 D;  1YQ3 D;  1KF6 D;  1NEN C;  1KTM A;  3P4Q C;  2FBW D;  2ACZ C;  2H88 D;  1OW6 A;  3AE9 C;  5C3J C;  4YSY D;  3P4R D;  4KX6 D;  3SFE C;  3AEB C;  2WDV D;  3VR8 D;  2B76 C;  1KFY D;  2WU5 C;  2WU2 C;  3CIR D;  3AEE C;  5C2T C;  3AE3 D;  3AEC C;  3AED D;  1YQ3 C;  3VRB C;  3P4S C;  2WDR C;  3SFD D; 
#chains in the Genus database with same CATH topology
 2A45 G;  1BDD A;  5KKZ C;  1JMM A;  3ABV C;  3AED C;  1FU1 A;  1RF1 B;  3VR9 D;  4CPG A;  3CXH H;  2B87 A;  5APY A;  1M1J B;  1Q82 Q;  2FYN C;  4Y99 B;  1ZP0 D;  3HD7 A;  1S3J A;  4WWI A;  4NPD A;  1M1K Q;  1L4A A;  1AQ5 A;  2OTL P;  3LID A;  3G9R A;  2WZ7 A;  4YT0 C;  2AEM A;  1FAV A;  1GD2 E;  3KDP B;  3CCV P;  1KFY C;  1LTJ C;  1SQX G;  5AVW B;  2ZYA A;  1QGK B;  1ZLL A;  2K88 A;  2WSE H;  3AE9 D;  2HG5 D;  3FXD A;  4GDO A;  1FE6 A;  5KAF H;  2QJP B;  1TFF A;  1LNQ A;  1L0V D;  2KUB A;  2RMZ A;  1VF5 D;  3P4P D;  1YJN P;  2QEX P;  1KTM A;  3T97 A;  2ZFY A;  4PJ0 H;  2WPQ A;  1SQQ G;  2H88 D;  2WSF J;  1NAF A;  1PGO A;  1NGM B;  2K1A A;  2IFM A;  3M91 A;  3BRT B;  3HRN A;  5AW1 B;  1FZE A;  3AEC C;  3M0D A;  1PGP A;  2QRX A;  2M8R A;  2B89 A;  1MKM A;  3HUS B;  3SSU A;  3PJS K;  3WUT A;  4AYC A;  2O1J A;  1SQV E;  2SPZ A;  4YTM C;  1PPJ G;  1X0T A;  2KK7 A;  1ZRT D;  4D6T J;  3BCC J;  1FJK A;  3CLQ A;  3CC4 P;  4PD4 H;  2WT7 A;  1JO5 A;  2ZT9 C;  3AEG D;  3Q2Y A;  1JMB A;  2WVR A;  4Y99 C;  5AW7 B;  1OW7 A;  2WDR D;  3SWY A;  1L0L E;  2D2C B;  1LTG C;  3L73 J;  1MFT A;  3JCU E;  4IOI H;  2KNC A;  2BAS A;  5CJ0 A;  1GU5 A;  3AEA D;  2P1J A;  4N3Y B;  1IFM A;  5AW5 B;  2L5G B;  4U3F J;  1Y8A A;  1HH0 A;  1GW3 A;  3FX0 A;  1NU1 D;  1NWQ A;  2OYH B;  4Y28 J;  2WDV C;  1OVR A;  2E74 D;  1R5L A;  2P58 A;  3MTU E;  4YTP C;  1L2P A;  1L0L G;  5APT A;  3RK3 C;  1PL5 A;  4DDG A;  4WY4 C;  4H44 D;  1SP4 A;  3H32 B;  1FDM A;  5KLV D;  3MHV A;  4UB6 H;  3CCQ P;  2FBW D;  2J58 A;  2YXR B;  1YHQ P;  2I8D A;  2ZT9 B;  1DH3 A;  1DD4 A;  2HPC B;  1KN7 A;  3VRB C;  1L4A B;  3M9Q A;  2R32 A;  2E76 C;  3A7O A;  1GL2 D;  2Y9Z A;  5KJ7 A;  3WMM 0;  3VMX A;  1YYC A;  2FXM A;  5APX A;  4DT0 A;  3CC7 P;  4LGD E;  3CXH E;  2QG4 A;  4EOT A;  1L0N J;  5K5G B;  2JWA A;  1SQQ E;  2L91 A;  4K35 A;  1YTZ T;  3V2R A;  1PP9 G;  2Q3E A;  4KT0 J;  3B4S A;  5L8R J;  2AXC A;  3V2N A;  2A06 E;  2KZJ A;  2YIU B;  4I6M C;  3CXH D;  5M1B A;  3I55 P;  3B5N D;  3H1L E;  2E76 D;  3WU2 E;  3CD6 P;  4L75 A;  3II6 A;  1EDJ A;  4H13 B;  1EZV D;  3RL0 g;  1JY2 N;  3W67 A;  3GLM A;  5KJ7 D;  1NTZ J;  1JY2 O;  1SQX K;  2QJK C;  5KLV G;  1GW4 A;  2A45 H;  1SQV J;  2NRG A;  3AE7 D;  2KSE A;  3JCU H;  3QH9 A;  1JY2 P;  3O6Q A;  2WDQ C;  4DHJ A;  1EZV E;  4EI2 A;  3A0H H;  1GK4 A;  4GOF A;  3CC2 P;  3AE9 C;  3P4R D;  5KAI H;  4GOE A;  1FZA A;  3SWK A;  3IN6 A;  3B5N A;  3V2P A;  3Q3D A;  1VQ9 P;  4H0L C;  2YKP A;  4PV1 D;  1YQ3 C;  1BCC D;  1EXJ A;  3D71 A;  1N7L A;  2IPP A;  3TK1 A;  2KXP B;  2JR8 A;  3M0A A;  3F5H A;  4EDF A;  5AW8 B;  1KB9 I;  4MN4 C;  1M1J A;  5AW0 B;  3HE4 A;  2BEZ F;  3MUD A;  1BE3 D;  2XKM A;  1EDL A;  5AW9 B;  5H2F H;  2OYH A;  3L72 J;  3MD0 A;  1ZRT E;  1SQV K;  1KYO E;  2Q5U A;  1R8E A;  3L70 D;  3P32 A;  2WMM A;  1OZH A;  2E74 C;  1VQO P;  3H32 A;  2M5A A;  5CMZ A;  4WB4 A;  2R44 A;  2LKM A;  2HR3 A;  2BCC J;  3V4Q A;  3L70 E;  2HPC A;  1FBM A;  1XTC C;  1FZF A;  1FC2 C;  1T2K D;  3M06 A;  1MFZ A;  2WQY C;  3GHG A;  3H1H E;  1K05 A;  3L73 G;  1N8R Q;  1LTI C;  4OH8 B;  4YSX C;  3H1I G;  1ZP0 C;  2Z4E A;  1YQ3 D;  3E7K A;  2YO3 A;  1J2J B;  5BU8 B;  2FY8 A;  4W80 A;  1N73 A;  3CX5 H;  5CCH C;  3G3Z A;  1AA0 A;  2P2U A;  3H6P A;  5APW A;  1XTG B;  2N9B A;  3H1H J;  1PPJ D;  4UB8 E;  4M3L A;  5CCG A;  2XZR A;  1SQQ J;  5B5E E;  3S1K A;  3D6Z A;  1USE A;  3GMA A;  3IR9 A;  2E5Y A;  5AVT B;  3BVH A;  1KQG B;  2XU6 A;  3EFF K;  2ZYD A;  1Y9B A;  2E74 B;  1TU3 F;  1L0L D;  2YO2 A;  2WT7 B;  1GMJ A;  3H25 A;  1NH4 A;  4YTN C;  2KZI A;  1EDK A;  4YSX D;  3MP7 B;  3S9O A;  4H44 B;  5GTI H;  2PRR A;  4EIJ A;  1URQ D;  2IYP A;  3VTP C;  1EXI A;  1NU1 E;  2WPV B;  2YMY A;  1VDF A;  1NHL A;  5AVS B;  1HBW A;  5KLV J;  2H7H A;  2V7Q H;  2ZT9 D;  1IZN B;  3AEG C;  1BCC J;  3CCJ P;  1L4A D;  1WRG A;  1LWU C;  5CCG D;  1GL2 B;  2OYH C;  4IFF A;  4EYY Q;  5TIS E;  1OX3 A;  3CCS P;  1SFC B;  2P7J A;  3L74 J;  3AE5 D;  3AE2 D;  3H1J G;  1HJ0 A;  2HOD B;  3OA7 A;  1X9V A;  1URQ A;  1FZC C;  2P10 A;  5KLI B;  1NEN C;  4RJT A;  2FKW B;  3ITK A;  3MZW B;  1EQ7 A;  2WSS H;  2E76 B;  1KFY D;  2WSC H;  2IZ1 A;  4H13 D;  3KPE A;  2P67 A;  2E75 C;  1LGH B;  1DX7 A;  3AEA C;  3MUD C;  2XV5 A;  3VON A;  2ITA A;  4BWN A;  3H1K J;  2Q7C A;  1N7S A;  2WU2 D;  2A06 D;  2Y0E A;  1S9K E;  2M3B A;  4D6T E;  2M5A B;  5KKZ B;  1SQP D;  3EQ2 A;  3H1L D;  1Q7Y Q;  1N86 A;  1LWU B;  2JO1 A;  4GIF A;  1IK9 A;  3H1L J;  1L0V C;  4YT0 D;  1FOS E;  2ZJS E;  1A02 J;  3G71 P;  4R4L A;  1HVV A;  3TGU G;  1T8Z A;  3F89 A;  4ZNC A;  3AE8 D;  1BE3 E;  1JOC A;  1RF0 C;  1Y47 A;  4PV1 B;  3GG2 A;  1X22 A;  2R5B A;  1LTT C;  3EWK A;  5AW4 B;  3USS A;  4B86 A;  2JDI H;  3ABV D;  1LT9 A;  3VRB D;  1NJI Q;  3AE6 D;  3P4S D;  4YXW H;  2WSE J;  3O8Z A;  2QJY C;  2W6J H;  3SFD C;  3CIR C;  1G1I A;  3HE5 B;  2H88 C;  1IC2 A;  2BS4 C;  1JY3 O;  3L75 G;  3TGU E;  1N73 B;  3TNU A;  4U3F E;  1NTK J;  4PD4 I;  1J1E C;  4XFJ A;  1SQP J;  1KV4 A;  2DW3 A;  1KQS O;  3AEB C;  1KIL B;  1JNM A;  3I56 P;  2YNY A;  5GTH H;  3AEE C;  2C9N Y;  1S1C X;  2W6B A;  3C9I A;  1VQL P;  3JC2 2;  1CI6 B;  2FXP A;  1NTZ D;  5EFW B;  2YMK A;  3P4R C;  4U3F G;  1KYO D;  4U3F D;  1M57 D;  3CME P;  3GF3 A;  1Q90 D;  2O01 J;  4JPZ B;  1GL2 A;  4HB1 A;  1KMI Z;  1KIL E;  4ZKP A;  3RK3 D;  2K9J B;  1NTM D;  2ZFC A;  1NTZ E;  3G6E P;  1WT6 A;  3CI9 A;  2OTJ P;  2FYU J;  3QWO C;  3HD7 C;  1GZL A;  5TJH A;  3L75 J;  2H43 A;  1KZU B;  4DJG A;  4PV1 C;  1NTK K;  1KB9 E;  1IFJ A;  1HUC A;  1FDI A;  1SQV G;  1OXZ A;  1LP1 B;  1YI2 P;  5TIS H;  1K9M Q;  1YJ9 P;  4HJG H;  2BCC E;  2HOD A;  1LTJ A;  4I2L C;  3GHG B;  2FBW C;  4C7N A;  2QJY B;  2IBZ I;  2OQQ A;  5KAF E;  1S72 P;  1ZOY D;  3SFE D;  4W7Z A;  1VQ5 P;  1URQ B;  2KS1 A;  2HFE D;  2GA1 A;  4I6L A;  2W6A A;  1JY3 N;  3IAO A;  1OMI A;  1FOS F;  3ZDM A;  1EDI A;  3H1K D;  4L76 A;  1L0N G;  4ZMD A;  3V6I A;  1FDO A;  2QE7 H;  3SFD D;  2W8Z A;  1RE3 C;  1LJ2 A;  2FYU K;  1SFC D;  2C0X A;  1LTA C;  2KLV A;  2JJL A;  2VRS A;  1OVV A;  2FYN B;  4OGQ B;  5GTH E;  4A7P A;  1A02 F;  4HH2 A;  2WDQ D;  3B5N C;  3L35 A;  2KYV A;  1VQN P;  1KFM A;  4O9B A;  3RBZ A;  2WTY A;  5AVR B;  4YXD D;  3P8M C;  1SQB E;  4I7Z C;  5AW3 B;  1HWT C;  3L71 D;  3L4F A;  3L73 E;  1DIP A;  1L0L J;  1VQ6 P;  1SQQ D;  2IDB A;  2WP9 C;  1IFI A;  3LW5 H;  2WS3 C;  3KYQ A;  3CCR P;  1GTW A;  3S4R A;  4AQR D;  1H8A A;  2R3C A;  3HUS A;  2IYO A;  1SQB D;  3L74 E;  4BRY A;  1EZV I;  1KD1 Q;  1RH5 B;  5AVY B;  1Q86 Q;  4U7J A;  1NU1 K;  4NPF X;  4UB8 H;  3LW5 J;  3AE5 C;  3CXH I;  3PLN A;  1URQ C;  2AEF A;  4D6T D;  2QM7 A;  1QX8 A;  2K9J A;  2PAJ A;  1SQP E;  4OVN F;  2N1T B;  2FFD B;  3HUS C;  2B76 C;  3CIR D;  4QMA A;  3CPW O;  1AVO A;  1KQL A;  1GDT A;  2KNC B;  1FZC B;  1YQ4 D;  4ZKU A;  2V4H A;  2CK3 H;  2IBZ D;  1G2C A;  1LWU A;  4I1L A;  1SLQ A;  4XE5 B;  1BCC E;  1DD3 A;  3L71 G;  1BE3 J;  2K9Y A;  4NPE A;  3G4S P;  1LP1 A;  3PP5 A;  1OW8 A;  1RQU A;  4DHZ A;  3MIW A;  3RL0 B;  1H0T B;  1HGZ A;  4ASW A;  1RE4 C;  2B9B A;  3AE1 C;  1KIL D;  2QA4 P;  3D70 A;  3VMA A;  1NTM J;  2CPS A;  2AXT E;  3H1J D;  4I7Z B;  2PP6 A;  2C9L Y;  5APV A;  3TGU D;  3AEF C;  5AVX B;  3CL3 D;  3VP9 A;  2BCC G;  4C7N B;  1AFO A;  3RK3 B;  1JTH B;  1IJD B;  4WBA A;  2NPS C;  1KQF B;  4GKG A;  3H1J E;  1KYO I;  3A5T A;  2A45 I;  3U59 A;  2WPS A;  1Q2N A;  1HGV A;  2KIK A;  2ZXE B;  4L74 A;  3P4Q C;  4WVZ A;  1CSB A;  3A0H E;  1KIL A;  2O01 N;  2IX7 C;  3OJA B;  1S5L E;  1L0N K;  3H1H D;  1OWA A;  3RK3 E;  5C2T C;  1NTM E;  3Q5S A;  3TSI A;  4GT1 A;  3AED D;  4PD4 D;  2FFD C;  3NXS A;  1JCC A;  4KJM A;  3TGU J;  3FWN A;  1LTS C;  1AJY A;  1PPJ E;  1LT1 A;  4GOD A;  1N7S D;  1VF5 C;  3P4P C;  1NTZ K;  3BRV B;  3WU2 H;  1JUN A;  1NKZ B;  1M1J C;  2H89 C;  3H1K G;  3R2P A;  3CCU P;  2BS3 C;  3FGA D;  3O6Q B;  2E42 A;  1BCC G;  4HKZ H;  1KYO H;  2JWD A;  4IFD K;  1T2K C;  1PGQ A;  2GUS A;  1VQM P;  3W68 A;  4OGQ D;  3GHG C;  3RGU A;  4FJV A;  2O3J A;  1PFI A;  3WUV A;  1YJW P;  4BXL A;  3PH0 A;  5KLV K;  3C1L A;  2RKL A;  3H1J J;  2GUV A;  1NAY A;  3L75 D;  5E79 H;  4H13 C;  2XNX A;  1SQB J;  3CCM P;  2E75 D;  5C3J C;  2WPR A;  2Q9I A;  5KLI C;  3CX5 E;  1QVF O;  4ASV A;  1BGY G;  2WU2 C;  4LLH A;  1ZW0 A;  1YBK A;  2KLU A;  1L0N D;  2O1K A;  1ZR4 A;  1FZC A;  2I1K A;  3AE1 D;  3L71 E;  1VQ8 P;  1X79 B;  3L73 D;  1W2E A;  2Y9Y A;  2MJZ A;  2FYZ A;  2ZVN B;  1PIX A;  1FZB A;  1ZME C;  1H0T A;  3T97 B;  2YKQ A;  4RKU J;  1S9K D;  5C2T D;  3AEC D;  4JYB A;  1BSN A;  2IBZ G;  1YQ4 C;  2N1T D;  2Q1K A;  3TDK A;  2FXO A;  3L70 J;  1R5S A;  2H8P D;  3GF7 A;  1MUU A;  2QSI A;  3HTK B;  3OW2 O;  2BS2 C;  2Q6Q A;  2UWJ E;  3CX5 I;  2D2C C;  3BAS A;  4YXD C;  1SQB K;  5APQ A;  1ZR2 A;  1NU1 G;  2GM4 A;  4HYT B;  4YPC A;  2AEJ A;  4BRY B;  4Z1M H;  1VQK P;  1BGY J;  1MV8 A;  1JTH A;  1Q81 Q;  1IK7 A;  1UII A;  3P8C E;  1SQQ K;  4IL6 H;  3RL0 D;  2OYI B;  4TT3 H;  5CCG C;  3L72 E;  1VL2 A;  1KF6 D;  4PJ0 E;  2N1T C;  4AUW A;  4K3A A;  2FFD A;  4KHX A;  4YSY D;  2YKO A;  2LR2 A;  2JKV A;  2Z5H A;  1JEK A;  5CCH A;  2W83 C;  2LXC B;  2NPS D;  1U57 A;  1KIL C;  3B71 A;  3CCL P;  3JSV C;  2E43 A;  1SQB G;  2WP9 D;  3A0B H;  1T6A A;  3KZI E;  3AE4 C;  1QLB C;  3TF5 A;  1L4A C;  2KOG A;  2ACZ D;  1QL1 A;  1KC8 Q;  3RL0 C;  2W90 A;  4C7R A;  1SFC A;  3PHL A;  1GK6 A;  3OAK A;  3E1R A;  1DEE G;  2POH A;  3N4X A;  1H89 A;  3TYY A;  3H1L G;  1LT9 C;  1NTK E;  1GL2 C;  2B88 A;  2BEQ D;  1FS0 E;  5CCH D;  3EFG A;  3NTN A;  4YTP D;  1NEN D;  5APS A;  2NPS A;  1PP9 J;  2W27 A;  1KB9 H;  1JY3 P;  1ZN5 A;  2H89 D;  3WUU A;  1USD A;  1NTK D;  4H0L B;  1N7S B;  2QJK B;  1VQP P;  1KB9 D;  2ZVO B;  2ZYG A;  1N2D C;  2R5D A;  4YTM D;  1T3U A;  1NOH A;  2BCC D;  5B66 E;  1AVY A;  2NZ2 A;  3L36 A;  4OGQ C;  1OVU A;  1IFP A;  2RN0 A;  2WDV D;  1SQV D;  2OGU A;  2WU5 C;  1QLE D;  2QJP C;  2WDR C;  4JF7 A;  1IFD A;  4IFM A;  3MGN A;  4L73 A;  3VMY A;  1LT9 B;  3CX5 D;  3H1K E;  3VR8 C;  5AVV B;  3HTK A;  3M9H A;  2A06 G;  3NFQ A;  1RF0 A;  2IZ0 A;  2WQY D;  3AE2 C;  3VP8 A;  4DZO A;  1PP9 E;  2KI7 B;  3L74 G;  4C46 A;  5BU5 A;  2E75 B;  3H1H G;  2M0B A;  1DEB A;  5DJT B;  4DHI B;  3GW6 A;  4KX6 C;  5CHX A;  3NMD A;  1U7J A;  2OYI A;  2V7Q J;  1PV3 A;  1KFN A;  2XND H;  2Q3I A;  4LC1 A;  2R3S A;  3VMZ A;  1NTM G;  2PFX A;  3H1I J;  5H2F E;  3L75 E;  1M8O B;  2E5T A;  5AW2 B;  3U1A A;  4TLF A;  4R4M A;  1SQP K;  1NO4 A;  3AEE D;  5BVZ A;  4DDI A;  3HE4 B;  1JCD A;  2QVA A;  3VR9 C;  2O01 H;  1PZQ A;  4IL6 E;  2I1J A;  1S5L H;  4WY4 B;  1OIP A;  1G1J A;  3AE6 C;  2M3E A;  1K04 A;  1N7S C;  1NEK D;  3AE4 D;  4N78 D;  3E1I A;  1UIX A;  3U1C A;  3IFM A;  3L74 D;  2ACZ C;  1QL2 A;  3P8C D;  1W2B O;  1RE3 A;  3VR8 D;  2WSC J;  2OYO A;  4H44 C;  1HF9 A;  1BE3 G;  3A0B E;  3I5C A;  3V4W A;  3V2Q A;  1NU1 J;  5CBO A;  2XDJ A;  2J5U A;  1N73 C;  4N78 E;  1BSH A;  2WIT A;  1J1E B;  1E79 H;  3RK2 B;  3A3Y B;  3PRJ A;  2IFN A;  1EC5 A;  1NKN A;  1LTJ B;  2B87 B;  5B5E H;  2OTK E;  1SVF A;  4D6T G;  1U7M A;  3L72 G;  4YSZ C;  2WU5 D;  2IBZ E;  2YIU C;  3HD7 B;  1SFC C;  2KS1 B;  3AE3 C;  2G3A A;  1QVG O;  1KOR A;  2FYU E;  1K73 Q;  2NPS B;  2K3R A;  2K37 A;  5GTI E;  3L72 D;  4LDT A;  5AVU B;  1E5W A;  1K8A Q;  3M9B A;  5E79 E;  1YIT P;  1RE4 A;  1HJB A;  1D7M A;  1CZQ A;  3CWB J;  2OYI C;  3PTZ A;  1MZ9 A;  1OFC X;  3VRA D;  3P4Q D;  2FYU D;  4DOJ A;  2N9Y B;  3BCC E;  2ZXX A;  5KJ7 C;  2JP3 A;  2OAR A;  3H1I E;  3VOP A;  4JBZ A;  1ZXG A;  1P84 H;  3RK2 C;  3SFE C;  1SQX J;  3Q5R A;  3M0D C;  1YIJ P;  3P4S C;  5C39 A;  1S2E A;  1S4X A;  1J1D C;  4OWF A;  4UB6 E;  1Z56 A;  1T3J A;  1H88 A;  4H0L D;  1SQX D;  1L0L K;  1RQV A;  2WS3 D;  4PD4 E;  4DCK A;  1VQ4 P;  1RF1 A;  2WWW A;  1AQT A;  1BDC A;  1QEX A;  3CCE P;  1FJP A;  1ZOY C;  1RHZ B;  1HTL C;  3A2A A;  3RBX A;  1VF5 B;  3VN0 A;  4N6J A;  3UIA A;  1SQX E;  2QM8 A;  4YSY C;  5CBN A;  3Q5P A;  3V5B A;  1JB0 J;  3VRA C;  2N1T A;  2J59 M;  2FYU G;  3Q1M A;  2QIW A;  2CPB A;  1M90 Q;  1AV1 A;  4XA4 A;  3CWB G;  2KP8 A;  1M7L A;  1S5L X;  1M56 D;  1G2C B;  5AVQ B;  1EZV G;  1LTB C;  2JEE A;  1VPC A;  2Y0C A;  1CW5 A;  1JM0 A;  2KSJ A;  5CJ4 A;  1VQ7 P;  2C0W A;  3KZI H;  2ZAE B;  3L71 J;  5B66 H;  1OW6 A;  2KB7 P;  1SS1 A;  3B8E B;  1PP9 D;  2Z5I A;  2D2C D;  3K5B A;  1SQP G;  4YSZ D;  1NTK G;  4JQ0 D;  5AW6 B;  3SWF A;  2LXB A;  2YXQ B;  1P84 E;  3FWL A;  2B76 D;  3AE7 C;  3HE5 A;  1NTM K;  5KAI E;  3AE8 C;  4WY4 D;  1J1D B;  3CWB E;  3AEF D;  1L0N E;  2HLO A;  3C8V A;  4RO0 A;  1PGJ A;  5DJU B;  3TNU B;  2AXT H;  2PGD A;  2MKV A;  1X8Y A;  2HYN A;  1W5C E;  1BGY D;  1P84 D;  4IL6 X;  3VYI A;  3L70 G;  2RH0 A;  1NYH A;  1CI6 A;  3CWB D;  3IF4 A;  1RF1 C;  1NEK C;  1E7P C;  1WMK A;  1ZV8 A;  5KTB A;  1P84 I;  2G8Y A;  5AVZ B;  1GU4 A;  3P7K A;  1RY3 A;  3D6Y A;  3RK2 D;  3L37 A;  1FZG A;  1BGY E;  5C3J D;  1NVO A;  2Y0D A;  4RES B;  3AEB D;  1KF6 C;  3KXD A;  4WY4 A;  2WSF H;  3KHU A;  5KLV E;  3CMA P;  3BCC G;  4W7Y A;  3N7N A;  3BAT A;  4YTN D;  1YTZ I;  3HD7 D;  1IFN A;  3LIE A;  1NTZ G;  3BCC D;  5APU A;  3KQG A;  4KX6 D;  1IO4 A;  3R4Y A;  3H1I D;  3B5N B;  4JYC A;  3FXE A;  3AE3 D; 
#chains in the Genus database with same CATH homology
 4YSZ D;  2E75 C;  2E76 C;  3D6Z A;  2WP9 D;  3AEA C;  2YMK A;  3GMA A;  3P4R C;  3AE4 C;  5KKZ C;  1QLB C;  1YQ4 D;  3AE1 D;  2J5U A;  1KQG B;  3VR8 C;  4H0L D;  2B76 D;  3AE7 C;  1Y9B A;  2E74 B;  2WU2 D;  3AE8 C;  4OGQ B;  2ACZ D;  1TU3 F;  3GF3 A;  1AJY A;  4YTM C;  1RQV A;  3ABV C;  2WS3 D;  1Q90 D;  2O01 J;  3AED C;  1GMJ A;  3VR9 D;  3AEF D;  1DD3 A;  3H25 A;  2WQY D;  3AE2 C;  3C8V A;  1KMI Z;  1KIL E;  2BEZ F;  4YTN C;  2K9Y A;  2JO1 A;  1PIX A;  2FYN C;  4YSX D;  1ZME C;  3S9O A;  1L0V C;  1OW8 A;  1RQU A;  2ZT9 C;  3AEG D;  1VF5 C;  1ZP0 D;  4H44 B;  2WDQ D;  3P4P C;  4YT0 D;  3T97 B;  1ZOY C;  2MKV A;  3Q2Y A;  4YSZ C;  4RKU J;  2WU5 D;  2E75 B;  2H89 C;  4R4L A;  1EXI A;  2YIU C;  5C2T D;  2WPV B;  3AEC D;  2BS3 C;  1ZRT E;  3FGA D;  2WDR C;  1VF5 B;  4KT0 J;  1YQ4 C;  3AE1 C;  4KX6 C;  4YXD D;  5L8R J;  1OW7 A;  3AE3 C;  4I7Z C;  2G3A A;  1R8E A;  4IL6 X;  2WDR D;  3D70 A;  3AE8 D;  3G9R A;  3P4P D;  1KOR A;  2E74 C;  2V7Q J;  1PV3 A;  1NYH A;  2ZT9 D;  3AEG C;  5M1B A;  4YT0 C;  2BEQ D;  2D2C B;  4PV1 B;  1DIP A;  3GF7 A;  4YSY C;  3Q5P A;  1NEK C;  4YTP D;  1E7P C;  2QSI A;  3EWK A;  1NEN D;  1WMK A;  2WDQ C;  4I7Z B;  1JB0 J;  2IDB A;  3VRA C;  2E76 D;  1KFY C;  2G8Y A;  2WP9 C;  2BS2 C;  2WS3 C;  3ABV D;  3AEA D;  3Q1M A;  4H13 B;  2D2C C;  4PV1 C;  4YXD C;  3AEF C;  2QIW A;  3RL0 g;  3AE6 D;  1FDI A;  3VRB D;  3GLM A;  4R4M A;  3P4S D;  2WSE J;  2H89 D;  4OGQ D;  3D6Y A;  3AEE D;  2QJK C;  2QJY C;  3AE9 D;  5C3J D;  3VR9 C;  3AE5 D;  4Z1M H;  3AE2 D;  4Y28 J;  3AEB D;  1KF6 C;  2WDV C;  3VRA D;  4H0L B;  3AE7 D;  3SFD C;  3P4Q D;  2E74 D;  1IK7 A;  4GDO A;  1HJ0 A;  3CIR C;  2FBW C;  1S5L X;  2H88 C;  2OQQ A;  3AE6 C;  4YTP C;  1KQF B;  1ZOY D;  2WQY C;  3SFE D;  1K05 A;  4YTN D;  4TT3 H;  2JP3 A;  4U7J A;  1K04 A;  4YSX C;  1PL5 A;  3LW5 J;  3O6Q A;  2BS4 C;  4YTM D;  1L0V D;  1VF5 D;  1ZP0 C;  4H13 C;  1VL2 A;  2P10 A;  3AE5 C;  4H44 D;  1NEK D;  1YQ3 D;  1KF6 D;  1NEN C;  3AE4 D;  1KTM A;  1UIX A;  3P4Q C;  2NZ2 A;  3IAO A;  4OGQ C;  4XFJ A;  2E75 D;  2FBW D;  2ACZ C;  2H88 D;  1OW6 A;  2WSF J;  3AE9 C;  5C3J C;  3P4S C;  4YSY D;  3P4R D;  1OMI A;  5KLI C;  4KX6 D;  3SFE C;  3AEB C;  3Q5R A;  3IN6 A;  1NGM B;  2WDV D;  3VR8 D;  3R4Y A;  3Q3D A;  4H0L C;  2B76 C;  2E76 B;  1KFY D;  2WU5 C;  2WSC J;  2WU2 C;  3AEE C;  3RK3 E;  3CIR D;  3AE3 D;  5C2T C;  2ZT9 B;  1S1C X;  3Q5S A;  3AEC C;  4H13 D;  4H44 C;  2D2C D;  4PV1 D;  3AED D;  1YQ3 C;  1DD4 A;  3VRB C;  1FDO A;  1HF9 A;  1U57 A;  2FXP A;  2QJP C;  3D71 A;  1EXJ A;  3B71 A;  1MKM A;  3SFD D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...