4YTPC

Crystal structure of porcine heart mitochondrial complex ii bound with n-[(4-tert-butylphenyl)methyl]-2-(trifluoromethyl)benzamide
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
total genus 52
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2015-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4ytpC01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 4ytpC02
3AECC 2WS3C 4YTMD 3VRBC 3AEGC 3AE6C 3VR9C 3P4RC 2WQYD 3P4RD 1NEND 2WDVC 4YTPC 2H88D 3AE7C 1L0VC 4YSXC 3VR8C 2WDRD 3B71A 3AEEC 3AEED 3P4SC 2BS4C 4KX6D 1OW6A 4YSYD 5C2TC 5C3JD 4YT0D 1KF6D 1YQ3C 1KF6C 2WP9D 4YTMC 3AE5C 3AECD 1NEKD 3AE5D 3P4QD 3AE1D 2WQYC 1QLBC 2ACZD 3CIRC 2ACZC 2BS2C 4YSXD 2WDRC 2H88C 4YTPD 1L0VD 3AE7D 3AE9D 3AEBC 3P4SD 3SFEC 4KX6C 1YQ4C 3AEAC 2WU2D 3AE8C 1YQ4D 3AEFD 5C2TD 4YTNC 3SFDC 3AE3C 1YQ3D 4YT0C 2FBWC 3VRBD 3AEGD 2WU5C 2WS3D 1K04A 3S9OA 1NEKC 3AEDD 1KTMA 2H89C 3AE4D 3AE1C 3CIRD 3ABVD 3VRAC 2B76C 3AE9C 2WDQC 1PV3A 3SFED 3AE8D 3AEFC 1E7PC 4YXDD 2WU2C 3AEAD 4YXDC 1KFYD 3P4PC 1ZP0D 1KFYC 3P4PD 3SFDD 1K05A 4YTND 5C3JC 3AE2C 3AE2D 1ZOYC 2WU5D 2WP9C 2FBWD 3P4QC 3AE4C 2H89D 3AE6D 3VR9D 3AEDC 2BS3C 2WDVD 2B76D 1OW8A 1NENC 3ABVC 2WDQD 3VRAD 3VR8D 3AEBD 4YSZD 4YSZC 2G3AA 1ZP0C 4YSYC 1OW7A 3AE3D 1ZOYD
chains in the Genus database with same CATH superfamily
1T3JA 3KYQA 3HTKA 3K5BA 1DH3A 1U7JA 1OXZA 2K1AA 2OTLP 1L0ND 2P58A 3VMZA 2BS4C 3RK2B 3WU2H 2JO1A 1UIXA 3VYIA 1NU1J 2IYOA 3CX5E 1YQ3C 3N7NA 3N4XA 1MUUA 1NTMK 2ZXXA 1JY3O 1DD4A 1ZRTE 1N7SD 2H88C 1KB9H 4DDGA 1RF1C 2Y9ZA 2OYHB 1SQBG 2WU2D 3I56P 1M8OB 4YTNC 3I55P 2R3SA 1BE3J 1LTSC 3H1HJ 3KPEA 2WVRA 1W2BO 1H0TA 2FYUK 3M9BA 1P84H 2WDQC 1IFMA 2LXCB 4RESB 1ZR4A 3HD7D 3GHGA 3H1IG 3G71P 3VOPA 3B5NC 1LTGC 2R32A 2B87A 2QJPC 1EDKA 1JY2N 1ZP0C 1JEKA 3RK2D 1KILB 1NKZB 4DHZA 3L72J 1YTZI 2YO2A 1LTJC 1HTLC 2AEFA 4YTMD 4I2LC 2CK3H 3EQ2A 1J1EC 3MUDC 4BRYB 1LT9B 2WDRD 3D6ZA 3CCLP 1KYOE 2WSFH 2YIUC 1USEA 3A5TA 5KAFH 4ZKUA 1QLBC 3H1HD 4YSXD 4GT1A 2ZFCA 2FYNC 5KLIC 1SQVK 3PRJA 3AEAC 5C2TD 3SWKA 3V4QA 1JY3N 2D2CB 1LTIC 5AW7B 3A3YB 3Q5SA 2E74B 1MKMA 4Y99C 2N9BA 1OWAA 1QL2A 1FE6A 2OYOA 2WITA 1MFZA 2JWAA 3RL0B 4JQ0D 2N1TD 4L75A 3M0DA 1S1CX 1PPJD 4H13D 3CLQA 4C7RA 2FY8A 4N78E 1GW4A 3CX5I 5APQA 2H89D 3VR9D 5B66E 1RF1A 1SQVD 1Q82Q 4IOIH 2W27A 5B5EE 3H1HG 1YJ9P 3AEBD 3M91A 1NAFA 4TLFA 5L8RJ 1L0NE 3P32A 4RJTA 3EWKA 3L72E 4XFJA 4U3FE 2WDVC 1L4AA 1LGHB 3D71A 2Q6QA 1Z56A 1NU1E 3TGUE 3SWYA 2E76C 1L0LJ 5APWA 5AW5B 2Z4EA 1ZMEC 4LC1A 3H6PA 3L75G 1GZLA 5BVZA 3CIRC 1PGPA 3VTPC 4PJ0H 2M5AA 3TF5A 4U7JA 2QA4P 3TGUD 3BCCJ 1EZVI 3AE8C 3AE3C 3E7KA 1J1DB 1JTHB 2C0WA 1BE3E 1K04A 2XNDH 4C7NB 1N7LA 4OH8B 3MUDA 2D2CC 3BCCD 2Y0CA 2E76D 1M7LA 2NRGA 1SQVE 1VQNP 3HD7C 5C3JC 2E75D 2AEMA 1BGYG 2FBWD 4N78D 3P4QC 1SQBD 2C0XA 1ZW0A 1ZXGA 3R2PA 2IFMA 2WSCJ 3IFMA 4PD4H 2OTKE 3R4YA 2QEXP 2M3BA 1GU5A 1SQVG 4BWNA 2PGDA 1W5CE 1URQB 1L0LG 4IL6E 1OIPA 1NTZG 2JWDA 1SQBJ 1VQ6P 3CWBG 2R3CA 3P4SC 4KX6D 1PP9G 2QJPB 2WSFJ 1LTTC 3TGUJ 5C3JD 2C9NY 5AVTB 1J1DC 2WPRA 3H1JJ 2XNXA 4GOFA 2IPPA 2WZ7A 2ZVNB 2XDJA 1G2CA 1X0TA 1L0NJ 1HWTC 3A7OA 4K35A 1PL5A 2YMKA 3TK1A 3H1LE 1VDFA 4R4MA 1YQ3D 3P8MC 1RE3C 1Y9BA 3P8CE 4NPFX 2WSCH 1OVUA 4OGQD 4EI2A 1AVOA 1SFCD 2RH0A 3O6QA 2VRSA 3L73J 1JMBA 3II6A 2IYPA 3A2AA 4YXDD 2ZYGA 3M06A 3SFDD 4R4LA 4QMAA 1GTWA 1GMJA 1SQXK 3AE6D 3OA7A 1QLED 2QRXA 2B9BA 3U1CA 3JCUH 3TDKA 1OVVA 1VQ9P 3CCUP 3L73D 2QG4A 5CJ4A 5KAIE 1M1KQ 4I6MC 1E79H 2KSEA 3L37A 4ASWA 3CL3D 4YSYC 3KZIH 1SQBK 3JCUE 1P84I 3IAOA 2M3EA 4PD4I 3AEGC 3E1RA 2DW3A 1ZV8A 1NEND 4YTPC 3L74J 3HTKB 3AE7C 4EIJA 1S5LX 1KQGB 5KAIH 2XU6A 1KMIZ 1LT9A 2FFDC 1LTBC 3Q3DA 4YTMC 5E79E 3RK3B 1URQD 4CPGA 1YI2P 3AE1D 1LNQA 1EXIA 5C39A 4JF7A 1GL2B 1BCCG 5CHXA 2IBZD 3W68A 3L73G 4LGDE 5CCHC 3O8ZA 5B66H 3SWFA 1Y47A 1AJYA 5EFWB 1NEKC 1RH5B 2ZVOB 5KLIB 3VRAC 2O1JA 2ZYDA 1RF0A 2AXTE 1M1JC 1S72P 1MZ9A 1PGQA 2H7HA 2B88A 1FC2C 4D6TE 2ZAEB 4ZMDA 1P84D 3AEDC 1KQLA 1BSHA 4OGQC 3CCVP 1YIJP 1GL2A 3VR8D 4DCKA 1GK6A 4AUWA 1EZVG 3L71E 1VQMP 4FJVA 2ZT9D 2G3AA 2IFNA 3HRNA 1NTKD 4BXLA 1X22A 3MIWA 1N2DC 5CBOA 3H1LG 3TNUA 5APYA 3P4RC 3WUUA 2FYUG 3RK3E 1XTGB 3KDPB 1LT1A 1XTCC 4ZNCA 1FJKA 1FOSF 2P10A 1IJDB 2NZ2A 1LTJB 1KFMA 2UWJE 3RBXA 2KXPB 3CPWO 1KF6C 2BASA 1SQPD 4C46A 2Q3IA 2E5TA 3PLNA 5E79H 4WY4B 2B87B 1NTMG 5CCGD 4H0LC 1IO4A 3B5NA 1YQ4C 1SFCA 1YQ4D 2Q1KA 3M0AA 1LP1A 5AVWB 1JTHA 3KHUA 3L75J 4JPZB 1EC5A 1FZCC 1LWUA 3PJSK 4PV1D 3AE4D 2GUSA 3CXHH 3AE1C 1LP1B 2POHA 3AE8D 3UIAA 4GDOA 4YTND 2MJZA 2O3JA 1D7MA 1S4XA 3KQGA 1GU4A 2FYUJ 1LTAC 1SQQK 3VP8A 4N3YB 1AA0A 5BU5A 3CWBD 2RMZA 2YNYA 5BU8B 2ZT9B 1ZOYD 1EZVE 3L71G 3BRTB 3AECC 2YXQB 1OZHA 4O9BA 2WQYD 3A0BE 1NTKG 3JC22 4UB8H 1SQPK 2P67A 1URQA 4H44C 4D6TG 1BGYE 5AW4B 2ZT9C 2K9JA 4RKUJ 1HGVA 3L71J 2N9YB 1FZCA 2PAJA 3CMEP 1YITP 4JYBA 2W6AA 1CI6B 1L4AC 1N8RQ 4TT3H 1U57A 1SFCC 4UB6E 4L73A 4U3FG 1M1JB 3AEBC 4KX6C 1U7MA 2N1TC 3GHGC 4YXWH 1ZLLA 5DJTB 3GF7A 1NTMD 1MFTA 5KLVG 3KZIE 2JDIH 1N73A 3CI9A 3U59A 2HFED 2E74D 3L36A 1LWUB 3KXDA 1T2KD 2FXPA 3AE9C 3OW2O 1L0NK 1SQPE 3F89A 2FYUD 2FXOA 3AEAD 3O6QB 1KFYD 1KFYC 4HH2A 1PP9J 2WU5D 3W67A 3TGUG 1CW5A 3CD6P 3H25A 2HPCB 4NPDA 1YJNP 2I1JA 2BS3C 2WDVD 1KILE 5AVYB 1NENC 3ABVC 2PRRA 1HH0A 1PFIA 1MV8A 1DEEG 4YSZC 4WY4A 1JUNA 5GTIH 4YPCA 3L70D 3MTUE 3L4FA 2KS1B 1NO4A 2WS3C 3VRBC 1JY2O 2QJYC 3AE6C 2KUBA 4I7ZC 1FDMA 4MN4C 4KT0J 1KYOH 4OGQB 1H8AA 3WUTA 5AVUB 2KIKA 3WMM0 5CCGA 1TFFA 3BRVB 1S5LH 1E5WA 2LKMA 2WP9D 3VMXA 1ZR2A 3AECD 1G1IA 1KV4A 3H1JD 3LIEA 1VF5B 3GW6A 1NOHA 4BRYA 4KHXA 1L0VD 3CC4P 2A06E 2ZXEB 3MZWB 2ZYAA 3L72D 1KB9E 1HF9A 2AXTH 2P7JA 1NTZK 2OYIC 1FDIA 4YT0C 3H1KD 4L74A 4Y28J 2V7QJ 1PP9D 4IL6H 3CIRD 1EDIA 3HE4B 1JB0J 2R44A 1SLQA 5KLVD 1WT6A 2CPSA 2WU2C 3H1LJ 1CSBA 1ZP0D 2P1JA 2V4HA 1K05A 2E5YA 2J59M 4WWIA 2JP3A 3V6IA 5AW6B 4A7PA 3RBZA 5KKZC 1FU1A 1K9MQ 4H44B 4UB6H 2SPZA 3GMAA 1CI6A 2C9LY 2RN0A 1L2PA 1N7SB 1BCCJ 2P2UA 2H8PD 2R5DA 1BCCE 3VR8C 1SS1A 2IBZG 3TYYA 2O1KA 4HYTB 5AVVB 1FAVA 1JNMA 1L4AD 1NH4A 3MGNA 1IFPA 1WRGA 3P4QD 3H32A 3BATA 5KAFE 4GODA 4M3LA 4IFMA 3HE5B 4IFDK 5KTBA 3SFEC 3H1ID 1KN7A 3G3ZA 1DEBA 3VMYA 3G4SP 3C8VA 3H1JG 3AEFD 3Q5RA 1SQXE 4ZKPA 4WY4C 3Q1MA 2WS3D 1NHLA 3S9OA 3QH9A 4H0LB 1PGJA 3B5NB 1OVRA 3RL0g 1EDLA 2W6JH 2M5AB 3L75E 2QM7A 1T6AA 4WVZA 5TISE 5CJ0A 2OYHA 2OTJP 3LW5H 5AVQB 3WUVA 1L0LD 1FJPA 2FKWB 1NTZJ 3M9HA 1BCCD 1FBMA 5TJHA 1VQ5P 3V2RA 1LJ2A 3Q2YA 3H32B 2O01N 2BCCJ 3L72G 4I6LA 2KP8A 4YSZD 5B5EH 3FXDA 5TISH 1LTJA 3C1LA 5GTHE 4W7YA 1M1JA 2O01H 2W6BA 3VR9C 1GL2C 3HUSB 1YHQP 2PP6A 4HJGH 2FYNB 2NPSA 2PFXA 4GKGA 1BDCA 5CCHD 2A45I 3H1IJ 2OYIB 3RL0D 1PP9E 2JJLA 3LIDA 3LW5J 3F5HA 1JMMA 3AE9D 1LT9C 2FFDA 1VQ8P 1S3JA 1RQVA 3A0HE 2WT7A 2WMMA 5CCHA 1N73B 2IDBA 2WU5C 3P7KA 1PPJG 1IFNA 1P84E 3ITKA 3FGAD 1SQQG 2RKLA 4UB8E 3HE4A 1KFNA 1NTKK 4C7NA 1KC8Q 1M57D 3FXEA 2QJKC 1FZCB 1FZAA 3NFQA 1EQ7A 3E1IA 3CCMP 3OAKA 2KLUA 1NU1D 2E74C 4KJMA 2HR3A 2Y0EA 3L70E 5CCGC 3L70G 3S1KA 4I1LA 3VP9A 2ITAA 1BE3G 5APSA 2WWWA 1X79B 3T97B 3BCCG 2IBZE 2E75C 1L4AB 5AVRB 1IC2A 1RE4C 4PJ0E 2KOGA 3GLMA 1G2CB 2KS1A 4YSXC 1SQQD 2Q9IA 3AEEC 1NWQA 1OW6A 2FYUE 1VQLP 4I7ZB 2O01J 2L5GB 4PV1C 1S9KE 4W7ZA 3D6YA 1KQSO 5KJ7A 4RO0A 2ACZD 2ACZC 1NTME 3L35A 2LXBA 2R5BA 2WDRC 3GG2A 1SQQJ 5KJ7D 3CXHD 1GDTA 1YJWP 3P4SD 1HBWA 1FOSE 1YTZT 1JCDA 1HJ0A 4GIFA 3SFDC 2GM4A 3RL0C 3L73E 1Q86Q 2FXMA 1N7SA 3IF4A 3L74D 1FZFA 2H89C 1SQXJ 1RHZB 1AVYA 3H1HE 4NPEA 1USDA 1K73Q 2KZIA 1QVFO 1RY3A 3G9RA 1FS0E 1KB9D 2Y0DA 1K8AQ 2WSEH 3TSIA 3WU2E 3IN6A 2QJYB 5AW1B 2QE7H 3H1JE 1SQXD 1IK7A 1OW8A 2K9YA 1NKNA 2Q3EA 1ZN5A 3BVHA 3HD7A 2Q5UA 1FZEA 1VPCA 2BEZF 1VQ4P 3PP5A 1BSNA 2QJKB 2BEQD 1PIXA 4H13C 2K88A 2BCCD 4PD4D 3MP7B 1EXJA 2H88D 1N7SC 3I5CA 2NPSB 3VN0A 5H2FH 1FZGA 1KILA 4YSYD 1VL2A 4DZOA 1YBKA 5AW3B 3PH0A 3CXHI 1KF6D 1QGKB 3AE5C 2QM8A 1R8EA 1OFCX 2E43A 1Q81Q 4HKZH 1Y8AA 2NPSD 1TU3F 1SQVJ 4JYCA 1QVGO 2AEJA 3RK2C 5H2FE 3RK3C 2KYVA 1BDDA 2FBWC 1AV1A 4ASVA 3VRBD 1NTKJ 1KORA 5AVSB 2IBZI 1X9VA 2XV5A 3ABVD 2B76C 3NMDA 3SFED 5KLVJ 5KLVE 1RE3A 1NAYA 3BCCE 3S4RA 1SQPJ 5GTHH 1IFIA 3AE2C 1KZUB 3H1KE 2WTYA 5APVA 1DD3A 2NPSC 3VONA 2B89A 5KJ7C 1L0LE 2YKOA 1FDOA 4WB4A 1OW7A 3L75D 1NYHA 3L74G 3V2QA 1QEXA 4K3AA 2L91A 1VQKP 1VQOP 2KZJA 1L0VC 3H1IE 5C2TC 2Q7CA 1RF1B 1QL1A 4OVNF 4YT0D 1UIIA 1GW3A 3OJAB 1GL2D 1PZQA 3CCEP 2V7QH 1NJIQ 5APTA 3CCJP 2HODB 3CWBJ 2A45H 5KKZB 2HG5D 5AW0B 3EFGA 5AVXB 3GHGB 5AW2B 1PPJE 1S5LE 3CXHE 3FX0A 1NTZE 2HYNA 2H43A 2OQQA 1N86A 3FWLA 5CBNA 1G1JA 4H13B 1L0LK 4DJGA 3QWOC 2N1TA 4EYYQ 2WP9C 1JO5A 3V2PA 5AVZB 2WPSA 1GD2E 2KK7A 2I1KA 3HUSA 4Z1MH 1SQQE 4DT0A 3AE3D 2W8ZA 4IFFA 1NU1K 3NXSA 1A02J 1KB9I 1S2EA 1VQPP 2WPQA 1NGMB 1IK9A 1Q7YQ 1M56D 4PV1B 3MHVA 3A0BH 1RE4A 3B71A 4HB1A 2KLVA 2LR2A 3H1KG 1GK4A 2QIWA 3FWNA 1QX8A 1NVOA 2YMYA 1KILC 1SQXG 3V2NA 1N73C 3CCSP 2QVAA 1EZVD 2QSIA 1JY3P 2W90A 3NTNA 3TNUB 2WQYC 5DJUB 2OGUA 2JEEA 2ZJSE 2BS2C 1J1EB 2Z5IA 2XZRA 2HPCA 2D2CD 3L70J 1YYCA 2YKPA 1HJBA 3ZDMA 1J2JB 3B4SA 1H0TB 3T97A 2ZFYA 1SFCB 4GOEA 4B86A 3D70A 4L76A 1NU1G 5K5GB 2OYHC 2YXRB 2N1TB 1SP4A 2Y9YA 3M9QA 2WPVB 3CX5H 1KQFB 1E7PC 4DHJA 4YXDC 1JY2P 3MD0A 3V5BA 2K3RA 3P4PD 1T3UA 2AXCA 1KILD 1L0NG 2E75B 2J58A 4IL6X 3CMAP 2M8RA 3JSVC 4WY4D 4N6JA 4Y99B 2WDQD 3Q5PA 3G6EP 1JOCA 3PTZA 1R5LA 2I8DA 2KSJA 4U3FJ 2K9JB 2WT7B 1IFDA 1ZRTD 1OMIA 2E76B 1JCCA 2WSEJ 2FFDB 1JM0A 2IZ0A 2IX7C 4H0LD 3CX5D 4XE5B 3AEED 1X8YA 3RK3D 5CMZA 2KNCA 2HLOA 4D6TJ 1URQC 1BE3D 3SSUA 2YO3A 5APUA 1BGYD 4DHIB 2YIUB 4PD4E 5APXA 2BCCE 1AQTA 1A02F 2M0BA 1AFOA 2HODA 3H1KJ 3CCRP 1H89A 5AW8B 1VF5C 2BCCG 1IZNB 5AW9B 4D6TD 3AEGD 2JKVA 4LLHA 1W2EA 1KTMA 3P8CD 2FYZA 3PHLA 2KI7B 3CWBE 1DX7A 3A0HH 1PV3A 1HGZA 3GF3A 3CCQP 2J5UA 1HVVA 2CPBA 3H1LD 2A45G 5M1BA 2KB7P 4AYCA 4JBZA 4U3FD 1ZOYC 1KYOI 2MKVA 2YKQA 2OARA 1OX3A 1CZQA 1KD1Q 3AE4C 2JR8A 3IR9A 1IFJA 2B76D 1LWUC 4H44D 4EOTA 1H88A 1R5SA 1WMKA 3HUSC 3L74E 2GA1A 3P4RD 2A06G 3HE5A 2KNCB 2K37A 1AQ5A 2GUVA 5KLVK 1HUCA 1RF0C 1Q90D 1S9KD 1BGYJ 4LDTA 3C9IA 1EDJA 2IZ1A 2E42A 3VMAA 1NTZD 4EDFA 1NEKD 3B8EB 3AE5D 1SQBE 1VQ7P 1FZBA 1M90Q 3USSA 1T2KC 2WSSH 4YTPD 3AE7D 4WBAA 1RQUA 3CC2P 3BASA 3EFFK 3HD7B 3AEDD 3B5ND 3CC7P 1NTKE 1KYOD 2A06D 2W83C 1DIPA 4DDIA 4OWFA 4XA4A 3L71D 3AEFC 2G8YA 4DOJA 3P4PC 3RGUA 3V4WA 3AE2D 1VF5D 3U1AA 1PGOA 1SVFA 1T8ZA 2Z5HA 1SQPG 5GTIE 3VRAD 2XKMA 4AQRD 4W80A 3M0DC 1NTMJ 1Q2NA 2OYIA
chains in the Genus database with same CATH topology
1OMIA 3AECC 2WS3C 4YTMD 2E76B 3VRBC 3AEGC 2QJYC 3AE6C 3EWKA 3VR9C 2WSEJ 3P4RC 4I7ZC 2WQYD 1NGMB 3P4RD 3RK3E 3GLMA 4KT0J 4XFJA 1NEND 1EXJA 2WDVC 4OGQB 4YTPC 2H88D 3AE7C 4PV1B 1L0VC 3D71A 4YSXC 3VR8C 4H0LD 1S5LX 3B71A 4H44C 3D6ZA 2WDRD 3AEEC 2P10A 3AEED 3P4SC 1KQGB 1Q90D 2BS4C 4KX6D 1OW6A 2ZT9C 2NZ2A 4YSYD 2QIWA 1VL2A 5C2TC 2WSFJ 4RKUJ 2JO1A 1UIXA 2E76C 5C3JD 1KMIZ 2YIUC 4YT0D 4I7ZB 1KF6D 1YQ3C 1KF6C 2E75C 3Q3DA 2WP9D 4YTMC 2O01J 3AE5C 3AECD 1R8EA 1NEKD 3AE5D 4H13C 2QSIA 4PV1C 3D6YA 3P4QD 1ZMEC 3AE1D 2WQYC 1QLBC 3LW5J 1VF5B 2ACZD 4TT3H 3CIRC 1U57A 1EXIA 1DD4A 2ACZC 2BS2C 4YSXD 4H0LC 1ZRTE 1TU3F 2H88C 2WDRC 4YTPD 1L0VD 3AE7D 3AE9D 3AEBC 4U7JA 3SFEC 3P4SD 2FYNC 5KLIC 4KX6C 1PL5A 2YMKA 2D2CD 3C8VA 1YQ4C 3AEAC 2WU2D 3AE8C 1YQ4D 3AEFD 3Q5RA 3GF7A 5C2TD 1HJ0A 1RQVA 4YTNC 4R4MA 3SFDC 1HF9A 3AE3C 1YQ3D 1RQUA 2D2CB 1FDIA 4YT0C 2IDBA 1Y9BA 2FBWC 1VF5C 3VRBD 3AEGD 4Y28J 2WU5C 2V7QJ 1KORA 3Q5SA 3Q1MA 2E74B 3D70A 1K04A 3S9OA 4H0LB 1AJYA 1NEKC 2WS3D 3AEDD 4PV1D 1MKMA 2H89C 4OGQD 3RL0g 2E74D 1KTMA 3AE4D 3O6QA 3FGAD 3AE1C 3CIRD 3ABVD 3VRAC 2B76C 2FXPA 3AE9C 2WDQC 1JB0J 1PV3A 1ZOYD 3SFED 1DIPA 2WPVB 3GF3A 2J5UA 3G9RA 3AE8D 3AEFC 1KQFB 2D2CC 1E7PC 2G8YA 4YXDD 2OQQA 2WU2C 3AEAD 5M1BA 4YXDC 1KFYD 2E76D 4GDOA 1ZP0D 3P4PC 2QJKC 1KFYC 3P4PD 3SFDD 1K05A 4YTND 2E75B 4H13B 5C3JC 4R4LA 3AE2C 4IL6X 3AE2D 2JP3A 1S1CX 3IN6A 2E75D 2MKVA 1ZOYC 4H13D 2WP9C 1VF5D 2FBWD 2WU5D 3P4QC 1GMJA 3AE4C 5KKZC 2H89D 2E74C 3H25A 3AE6D 3AEDC 3Q2YA 3VR9D 4OGQC 1DD3A 2BS3C 2WDVD 1IK7A 2B76D 1KILE 1OW8A 2K9YA 3ABVC 4H44B 3Q5PA 4Z1MH 1NENC 2WDQD 4H44D 3GMAA 2WSCJ 3VRAD 3VR8D 3AEBD 1WMKA 2QJPC 2ZT9D 1FDOA 2BEZF 4YSZD 4YSZC 3R4YA 2G3AA 1ZP0C 4YSYC 1OW7A 3IAOA 5L8RJ 3AE3D 1NYHA 2BEQD 3T97B 2ZT9B 1PIXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AEC C;  2WS3 C;  4YTM D;  3VRB C;  3AEG C;  3AE6 C;  3VR9 C;  3P4R C;  2WQY D;  3P4R D;  1NEN D;  2WDV C;  4YTP C;  2H88 D;  3AE7 C;  1L0V C;  4YSX C;  3VR8 C;  2WDR D;  3B71 A;  3AEE C;  3AEE D;  3P4S C;  2BS4 C;  4KX6 D;  1OW6 A;  4YSY D;  5C2T C;  5C3J D;  4YT0 D;  1KF6 D;  1YQ3 C;  1KF6 C;  2WP9 D;  4YTM C;  3AE5 C;  3AEC D;  1NEK D;  3AE5 D;  3P4Q D;  3AE1 D;  2WQY C;  1QLB C;  2ACZ D;  3CIR C;  2ACZ C;  2BS2 C;  4YSX D;  2WDR C;  2H88 C;  4YTP D;  1L0V D;  3AE7 D;  3AE9 D;  3AEB C;  3P4S D;  3SFE C;  4KX6 C;  1YQ4 C;  3AEA C;  2WU2 D;  3AE8 C;  1YQ4 D;  3AEF D;  5C2T D;  4YTN C;  3SFD C;  3AE3 C;  1YQ3 D;  4YT0 C;  2FBW C;  3VRB D;  3AEG D;  2WU5 C;  2WS3 D;  1K04 A;  3S9O A;  1NEK C;  3AED D;  1KTM A;  2H89 C;  3AE4 D;  3AE1 C;  3CIR D;  3ABV D;  3VRA C;  2B76 C;  3AE9 C;  2WDQ C;  1PV3 A;  3SFE D;  3AE8 D;  3AEF C;  1E7P C;  4YXD D;  2WU2 C;  3AEA D;  4YXD C;  1KFY D;  3P4P C;  1ZP0 D;  1KFY C;  3P4P D;  3SFD D;  1K05 A;  4YTN D;  5C3J C;  3AE2 C;  3AE2 D;  1ZOY C;  2WU5 D;  2WP9 C;  2FBW D;  3P4Q C;  3AE4 C;  2H89 D;  3AE6 D;  3VR9 D;  3AED C;  2BS3 C;  2WDV D;  2B76 D;  1OW8 A;  1NEN C;  3ABV C;  2WDQ D;  3VRA D;  3VR8 D;  3AEB D;  4YSZ D;  4YSZ C;  2G3A A;  1ZP0 C;  4YSY C;  1OW7 A;  3AE3 D;  1ZOY D; 
#chains in the Genus database with same CATH topology
 1T3J A;  3KYQ A;  3HTK A;  3K5B A;  1DH3 A;  1U7J A;  1OXZ A;  2K1A A;  2OTL P;  1L0N D;  2P58 A;  3VMZ A;  2BS4 C;  3RK2 B;  3WU2 H;  2JO1 A;  1UIX A;  3VYI A;  1NU1 J;  2IYO A;  3CX5 E;  1YQ3 C;  3N7N A;  3N4X A;  1MUU A;  1NTM K;  2ZXX A;  1JY3 O;  1DD4 A;  1ZRT E;  1N7S D;  2H88 C;  1KB9 H;  4DDG A;  1RF1 C;  2Y9Z A;  2OYH B;  1SQB G;  2WU2 D;  3I56 P;  1M8O B;  4YTN C;  3I55 P;  2R3S A;  1BE3 J;  1LTS C;  3H1H J;  3KPE A;  2WVR A;  1W2B O;  1H0T A;  2FYU K;  3M9B A;  1P84 H;  2WDQ C;  1IFM A;  2LXC B;  4RES B;  1ZR4 A;  3HD7 D;  3GHG A;  3H1I G;  3G71 P;  3VOP A;  3B5N C;  1LTG C;  2R32 A;  2B87 A;  2QJP C;  1EDK A;  1JY2 N;  1ZP0 C;  1JEK A;  3RK2 D;  1KIL B;  1NKZ B;  4DHZ A;  3L72 J;  1YTZ I;  2YO2 A;  1LTJ C;  1HTL C;  2AEF A;  4YTM D;  4I2L C;  2CK3 H;  3EQ2 A;  1J1E C;  3MUD C;  4BRY B;  1LT9 B;  2WDR D;  3D6Z A;  3CCL P;  1KYO E;  2WSF H;  2YIU C;  1USE A;  3A5T A;  5KAF H;  4ZKU A;  1QLB C;  3H1H D;  4YSX D;  4GT1 A;  2ZFC A;  2FYN C;  5KLI C;  1SQV K;  3PRJ A;  3AEA C;  5C2T D;  3SWK A;  3V4Q A;  1JY3 N;  2D2C B;  1LTI C;  5AW7 B;  3A3Y B;  3Q5S A;  2E74 B;  1MKM A;  4Y99 C;  2N9B A;  1OWA A;  1QL2 A;  1FE6 A;  2OYO A;  2WIT A;  1MFZ A;  2JWA A;  3RL0 B;  4JQ0 D;  2N1T D;  4L75 A;  3M0D A;  1S1C X;  1PPJ D;  4H13 D;  3CLQ A;  4C7R A;  2FY8 A;  4N78 E;  1GW4 A;  3CX5 I;  5APQ A;  2H89 D;  3VR9 D;  5B66 E;  1RF1 A;  1SQV D;  1Q82 Q;  4IOI H;  2W27 A;  5B5E E;  3H1H G;  1YJ9 P;  3AEB D;  3M91 A;  1NAF A;  4TLF A;  5L8R J;  1L0N E;  3P32 A;  4RJT A;  3EWK A;  3L72 E;  4XFJ A;  4U3F E;  2WDV C;  1L4A A;  1LGH B;  3D71 A;  2Q6Q A;  1Z56 A;  1NU1 E;  3TGU E;  3SWY A;  2E76 C;  1L0L J;  5APW A;  5AW5 B;  2Z4E A;  1ZME C;  4LC1 A;  3H6P A;  3L75 G;  1GZL A;  5BVZ A;  3CIR C;  1PGP A;  3VTP C;  4PJ0 H;  2M5A A;  3TF5 A;  4U7J A;  2QA4 P;  3TGU D;  3BCC J;  1EZV I;  3AE8 C;  3AE3 C;  3E7K A;  1J1D B;  1JTH B;  2C0W A;  1BE3 E;  1K04 A;  2XND H;  4C7N B;  1N7L A;  4OH8 B;  3MUD A;  2D2C C;  3BCC D;  2Y0C A;  2E76 D;  1M7L A;  2NRG A;  1SQV E;  1VQN P;  3HD7 C;  5C3J C;  2E75 D;  2AEM A;  1BGY G;  2FBW D;  4N78 D;  3P4Q C;  1SQB D;  2C0X A;  1ZW0 A;  1ZXG A;  3R2P A;  2IFM A;  2WSC J;  3IFM A;  4PD4 H;  2OTK E;  3R4Y A;  2QEX P;  2M3B A;  1GU5 A;  1SQV G;  4BWN A;  2PGD A;  1W5C E;  1URQ B;  1L0L G;  4IL6 E;  1OIP A;  1NTZ G;  2JWD A;  1SQB J;  1VQ6 P;  3CWB G;  2R3C A;  3P4S C;  4KX6 D;  1PP9 G;  2QJP B;  2WSF J;  1LTT C;  3TGU J;  5C3J D;  2C9N Y;  5AVT B;  1J1D C;  2WPR A;  3H1J J;  2XNX A;  4GOF A;  2IPP A;  2WZ7 A;  2ZVN B;  2XDJ A;  1G2C A;  1X0T A;  1L0N J;  1HWT C;  3A7O A;  4K35 A;  1PL5 A;  2YMK A;  3TK1 A;  3H1L E;  1VDF A;  4R4M A;  1YQ3 D;  3P8M C;  1RE3 C;  1Y9B A;  3P8C E;  4NPF X;  2WSC H;  1OVU A;  4OGQ D;  4EI2 A;  1AVO A;  1SFC D;  2RH0 A;  3O6Q A;  2VRS A;  3L73 J;  1JMB A;  3II6 A;  2IYP A;  3A2A A;  4YXD D;  2ZYG A;  3M06 A;  3SFD D;  4R4L A;  4QMA A;  1GTW A;  1GMJ A;  1SQX K;  3AE6 D;  3OA7 A;  1QLE D;  2QRX A;  2B9B A;  3U1C A;  3JCU H;  3TDK A;  1OVV A;  1VQ9 P;  3CCU P;  3L73 D;  2QG4 A;  5CJ4 A;  5KAI E;  1M1K Q;  4I6M C;  1E79 H;  2KSE A;  3L37 A;  4ASW A;  3CL3 D;  4YSY C;  3KZI H;  1SQB K;  3JCU E;  1P84 I;  3IAO A;  2M3E A;  4PD4 I;  3AEG C;  3E1R A;  2DW3 A;  1ZV8 A;  1NEN D;  4YTP C;  3L74 J;  3HTK B;  3AE7 C;  4EIJ A;  1S5L X;  1KQG B;  5KAI H;  2XU6 A;  1KMI Z;  1LT9 A;  2FFD C;  1LTB C;  3Q3D A;  4YTM C;  5E79 E;  3RK3 B;  1URQ D;  4CPG A;  1YI2 P;  3AE1 D;  1LNQ A;  1EXI A;  5C39 A;  4JF7 A;  1GL2 B;  1BCC G;  5CHX A;  2IBZ D;  3W68 A;  3L73 G;  4LGD E;  5CCH C;  3O8Z A;  5B66 H;  3SWF A;  1Y47 A;  1AJY A;  5EFW B;  1NEK C;  1RH5 B;  2ZVO B;  5KLI B;  3VRA C;  2O1J A;  2ZYD A;  1RF0 A;  2AXT E;  1M1J C;  1S72 P;  1MZ9 A;  1PGQ A;  2H7H A;  2B88 A;  1FC2 C;  4D6T E;  2ZAE B;  4ZMD A;  1P84 D;  3AED C;  1KQL A;  1BSH A;  4OGQ C;  3CCV P;  1YIJ P;  1GL2 A;  3VR8 D;  4DCK A;  1GK6 A;  4AUW A;  1EZV G;  3L71 E;  1VQM P;  4FJV A;  2ZT9 D;  2G3A A;  2IFN A;  3HRN A;  1NTK D;  4BXL A;  1X22 A;  3MIW A;  1N2D C;  5CBO A;  3H1L G;  3TNU A;  5APY A;  3P4R C;  3WUU A;  2FYU G;  3RK3 E;  1XTG B;  3KDP B;  1LT1 A;  1XTC C;  4ZNC A;  1FJK A;  1FOS F;  2P10 A;  1IJD B;  2NZ2 A;  1LTJ B;  1KFM A;  2UWJ E;  3RBX A;  2KXP B;  3CPW O;  1KF6 C;  2BAS A;  1SQP D;  4C46 A;  2Q3I A;  2E5T A;  3PLN A;  5E79 H;  4WY4 B;  2B87 B;  1NTM G;  5CCG D;  4H0L C;  1IO4 A;  3B5N A;  1YQ4 C;  1SFC A;  1YQ4 D;  2Q1K A;  3M0A A;  1LP1 A;  5AVW B;  1JTH A;  3KHU A;  3L75 J;  4JPZ B;  1EC5 A;  1FZC C;  1LWU A;  3PJS K;  4PV1 D;  3AE4 D;  2GUS A;  3CXH H;  3AE1 C;  1LP1 B;  2POH A;  3AE8 D;  3UIA A;  4GDO A;  4YTN D;  2MJZ A;  2O3J A;  1D7M A;  1S4X A;  3KQG A;  1GU4 A;  2FYU J;  1LTA C;  1SQQ K;  3VP8 A;  4N3Y B;  1AA0 A;  5BU5 A;  3CWB D;  2RMZ A;  2YNY A;  5BU8 B;  2ZT9 B;  1ZOY D;  1EZV E;  3L71 G;  3BRT B;  3AEC C;  2YXQ B;  1OZH A;  4O9B A;  2WQY D;  3A0B E;  1NTK G;  3JC2 2;  4UB8 H;  1SQP K;  2P67 A;  1URQ A;  4H44 C;  4D6T G;  1BGY E;  5AW4 B;  2ZT9 C;  2K9J A;  4RKU J;  1HGV A;  3L71 J;  2N9Y B;  1FZC A;  2PAJ A;  3CME P;  1YIT P;  4JYB A;  2W6A A;  1CI6 B;  1L4A C;  1N8R Q;  4TT3 H;  1U57 A;  1SFC C;  4UB6 E;  4L73 A;  4U3F G;  1M1J B;  3AEB C;  4KX6 C;  1U7M A;  2N1T C;  3GHG C;  4YXW H;  1ZLL A;  5DJT B;  3GF7 A;  1NTM D;  1MFT A;  5KLV G;  3KZI E;  2JDI H;  1N73 A;  3CI9 A;  3U59 A;  2HFE D;  2E74 D;  3L36 A;  1LWU B;  3KXD A;  1T2K D;  2FXP A;  3AE9 C;  3OW2 O;  1L0N K;  1SQP E;  3F89 A;  2FYU D;  2FXO A;  3AEA D;  3O6Q B;  1KFY D;  1KFY C;  4HH2 A;  1PP9 J;  2WU5 D;  3W67 A;  3TGU G;  1CW5 A;  3CD6 P;  3H25 A;  2HPC B;  4NPD A;  1YJN P;  2I1J A;  2BS3 C;  2WDV D;  1KIL E;  5AVY B;  1NEN C;  3ABV C;  2PRR A;  1HH0 A;  1PFI A;  1MV8 A;  1DEE G;  4YSZ C;  4WY4 A;  1JUN A;  5GTI H;  4YPC A;  3L70 D;  3MTU E;  3L4F A;  2KS1 B;  1NO4 A;  2WS3 C;  3VRB C;  1JY2 O;  2QJY C;  3AE6 C;  2KUB A;  4I7Z C;  1FDM A;  4MN4 C;  4KT0 J;  1KYO H;  4OGQ B;  1H8A A;  3WUT A;  5AVU B;  2KIK A;  3WMM 0;  5CCG A;  1TFF A;  3BRV B;  1S5L H;  1E5W A;  2LKM A;  2WP9 D;  3VMX A;  1ZR2 A;  3AEC D;  1G1I A;  1KV4 A;  3H1J D;  3LIE A;  1VF5 B;  3GW6 A;  1NOH A;  4BRY A;  4KHX A;  1L0V D;  3CC4 P;  2A06 E;  2ZXE B;  3MZW B;  2ZYA A;  3L72 D;  1KB9 E;  1HF9 A;  2AXT H;  2P7J A;  1NTZ K;  2OYI C;  1FDI A;  4YT0 C;  3H1K D;  4L74 A;  4Y28 J;  2V7Q J;  1PP9 D;  4IL6 H;  3CIR D;  1EDI A;  3HE4 B;  1JB0 J;  2R44 A;  1SLQ A;  5KLV D;  1WT6 A;  2CPS A;  2WU2 C;  3H1L J;  1CSB A;  1ZP0 D;  2P1J A;  2V4H A;  1K05 A;  2E5Y A;  2J59 M;  4WWI A;  2JP3 A;  3V6I A;  5AW6 B;  4A7P A;  3RBZ A;  5KKZ C;  1FU1 A;  1K9M Q;  4H44 B;  4UB6 H;  2SPZ A;  3GMA A;  1CI6 A;  2C9L Y;  2RN0 A;  1L2P A;  1N7S B;  1BCC J;  2P2U A;  2H8P D;  2R5D A;  1BCC E;  3VR8 C;  1SS1 A;  2IBZ G;  3TYY A;  2O1K A;  4HYT B;  5AVV B;  1FAV A;  1JNM A;  1L4A D;  1NH4 A;  3MGN A;  1IFP A;  1WRG A;  3P4Q D;  3H32 A;  3BAT A;  5KAF E;  4GOD A;  4M3L A;  4IFM A;  3HE5 B;  4IFD K;  5KTB A;  3SFE C;  3H1I D;  1KN7 A;  3G3Z A;  1DEB A;  3VMY A;  3G4S P;  3C8V A;  3H1J G;  3AEF D;  3Q5R A;  1SQX E;  4ZKP A;  4WY4 C;  3Q1M A;  2WS3 D;  1NHL A;  3S9O A;  3QH9 A;  4H0L B;  1PGJ A;  3B5N B;  1OVR A;  3RL0 g;  1EDL A;  2W6J H;  2M5A B;  3L75 E;  2QM7 A;  1T6A A;  4WVZ A;  5TIS E;  5CJ0 A;  2OYH A;  2OTJ P;  3LW5 H;  5AVQ B;  3WUV A;  1L0L D;  1FJP A;  2FKW B;  1NTZ J;  3M9H A;  1BCC D;  1FBM A;  5TJH A;  1VQ5 P;  3V2R A;  1LJ2 A;  3Q2Y A;  3H32 B;  2O01 N;  2BCC J;  3L72 G;  4I6L A;  2KP8 A;  4YSZ D;  5B5E H;  3FXD A;  5TIS H;  1LTJ A;  3C1L A;  5GTH E;  4W7Y A;  1M1J A;  2O01 H;  2W6B A;  3VR9 C;  1GL2 C;  3HUS B;  1YHQ P;  2PP6 A;  4HJG H;  2FYN B;  2NPS A;  2PFX A;  4GKG A;  1BDC A;  5CCH D;  2A45 I;  3H1I J;  2OYI B;  3RL0 D;  1PP9 E;  2JJL A;  3LID A;  3LW5 J;  3F5H A;  1JMM A;  3AE9 D;  1LT9 C;  2FFD A;  1VQ8 P;  1S3J A;  1RQV A;  3A0H E;  2WT7 A;  2WMM A;  5CCH A;  1N73 B;  2IDB A;  2WU5 C;  3P7K A;  1PPJ G;  1IFN A;  1P84 E;  3ITK A;  3FGA D;  1SQQ G;  2RKL A;  4UB8 E;  3HE4 A;  1KFN A;  1NTK K;  4C7N A;  1KC8 Q;  1M57 D;  3FXE A;  2QJK C;  1FZC B;  1FZA A;  3NFQ A;  1EQ7 A;  3E1I A;  3CCM P;  3OAK A;  2KLU A;  1NU1 D;  2E74 C;  4KJM A;  2HR3 A;  2Y0E A;  3L70 E;  5CCG C;  3L70 G;  3S1K A;  4I1L A;  3VP9 A;  2ITA A;  1BE3 G;  5APS A;  2WWW A;  1X79 B;  3T97 B;  3BCC G;  2IBZ E;  2E75 C;  1L4A B;  5AVR B;  1IC2 A;  1RE4 C;  4PJ0 E;  2KOG A;  3GLM A;  1G2C B;  2KS1 A;  4YSX C;  1SQQ D;  2Q9I A;  3AEE C;  1NWQ A;  1OW6 A;  2FYU E;  1VQL P;  4I7Z B;  2O01 J;  2L5G B;  4PV1 C;  1S9K E;  4W7Z A;  3D6Y A;  1KQS O;  5KJ7 A;  4RO0 A;  2ACZ D;  2ACZ C;  1NTM E;  3L35 A;  2LXB A;  2R5B A;  2WDR C;  3GG2 A;  1SQQ J;  5KJ7 D;  3CXH D;  1GDT A;  1YJW P;  3P4S D;  1HBW A;  1FOS E;  1YTZ T;  1JCD A;  1HJ0 A;  4GIF A;  3SFD C;  2GM4 A;  3RL0 C;  3L73 E;  1Q86 Q;  2FXM A;  1N7S A;  3IF4 A;  3L74 D;  1FZF A;  2H89 C;  1SQX J;  1RHZ B;  1AVY A;  3H1H E;  4NPE A;  1USD A;  1K73 Q;  2KZI A;  1QVF O;  1RY3 A;  3G9R A;  1FS0 E;  1KB9 D;  2Y0D A;  1K8A Q;  2WSE H;  3TSI A;  3WU2 E;  3IN6 A;  2QJY B;  5AW1 B;  2QE7 H;  3H1J E;  1SQX D;  1IK7 A;  1OW8 A;  2K9Y A;  1NKN A;  2Q3E A;  1ZN5 A;  3BVH A;  3HD7 A;  2Q5U A;  1FZE A;  1VPC A;  2BEZ F;  1VQ4 P;  3PP5 A;  1BSN A;  2QJK B;  2BEQ D;  1PIX A;  4H13 C;  2K88 A;  2BCC D;  4PD4 D;  3MP7 B;  1EXJ A;  2H88 D;  1N7S C;  3I5C A;  2NPS B;  3VN0 A;  5H2F H;  1FZG A;  1KIL A;  4YSY D;  1VL2 A;  4DZO A;  1YBK A;  5AW3 B;  3PH0 A;  3CXH I;  1KF6 D;  1QGK B;  3AE5 C;  2QM8 A;  1R8E A;  1OFC X;  2E43 A;  1Q81 Q;  4HKZ H;  1Y8A A;  2NPS D;  1TU3 F;  1SQV J;  4JYC A;  1QVG O;  2AEJ A;  3RK2 C;  5H2F E;  3RK3 C;  2KYV A;  1BDD A;  2FBW C;  1AV1 A;  4ASV A;  3VRB D;  1NTK J;  1KOR A;  5AVS B;  2IBZ I;  1X9V A;  2XV5 A;  3ABV D;  2B76 C;  3NMD A;  3SFE D;  5KLV J;  5KLV E;  1RE3 A;  1NAY A;  3BCC E;  3S4R A;  1SQP J;  5GTH H;  1IFI A;  3AE2 C;  1KZU B;  3H1K E;  2WTY A;  5APV A;  1DD3 A;  2NPS C;  3VON A;  2B89 A;  5KJ7 C;  1L0L E;  2YKO A;  1FDO A;  4WB4 A;  1OW7 A;  3L75 D;  1NYH A;  3L74 G;  3V2Q A;  1QEX A;  4K3A A;  2L91 A;  1VQK P;  1VQO P;  2KZJ A;  1L0V C;  3H1I E;  5C2T C;  2Q7C A;  1RF1 B;  1QL1 A;  4OVN F;  4YT0 D;  1UII A;  1GW3 A;  3OJA B;  1GL2 D;  1PZQ A;  3CCE P;  2V7Q H;  1NJI Q;  5APT A;  3CCJ P;  2HOD B;  3CWB J;  2A45 H;  5KKZ B;  2HG5 D;  5AW0 B;  3EFG A;  5AVX B;  3GHG B;  5AW2 B;  1PPJ E;  1S5L E;  3CXH E;  3FX0 A;  1NTZ E;  2HYN A;  2H43 A;  2OQQ A;  1N86 A;  3FWL A;  5CBN A;  1G1J A;  4H13 B;  1L0L K;  4DJG A;  3QWO C;  2N1T A;  4EYY Q;  2WP9 C;  1JO5 A;  3V2P A;  5AVZ B;  2WPS A;  1GD2 E;  2KK7 A;  2I1K A;  3HUS A;  4Z1M H;  1SQQ E;  4DT0 A;  3AE3 D;  2W8Z A;  4IFF A;  1NU1 K;  3NXS A;  1A02 J;  1KB9 I;  1S2E A;  1VQP P;  2WPQ A;  1NGM B;  1IK9 A;  1Q7Y Q;  1M56 D;  4PV1 B;  3MHV A;  3A0B H;  1RE4 A;  3B71 A;  4HB1 A;  2KLV A;  2LR2 A;  3H1K G;  1GK4 A;  2QIW A;  3FWN A;  1QX8 A;  1NVO A;  2YMY A;  1KIL C;  1SQX G;  3V2N A;  1N73 C;  3CCS P;  2QVA A;  1EZV D;  2QSI A;  1JY3 P;  2W90 A;  3NTN A;  3TNU B;  2WQY C;  5DJU B;  2OGU A;  2JEE A;  2ZJS E;  2BS2 C;  1J1E B;  2Z5I A;  2XZR A;  2HPC A;  2D2C D;  3L70 J;  1YYC A;  2YKP A;  1HJB A;  3ZDM A;  1J2J B;  3B4S A;  1H0T B;  3T97 A;  2ZFY A;  1SFC B;  4GOE A;  4B86 A;  3D70 A;  4L76 A;  1NU1 G;  5K5G B;  2OYH C;  2YXR B;  2N1T B;  1SP4 A;  2Y9Y A;  3M9Q A;  2WPV B;  3CX5 H;  1KQF B;  1E7P C;  4DHJ A;  4YXD C;  1JY2 P;  3MD0 A;  3V5B A;  2K3R A;  3P4P D;  1T3U A;  2AXC A;  1KIL D;  1L0N G;  2E75 B;  2J58 A;  4IL6 X;  3CMA P;  2M8R A;  3JSV C;  4WY4 D;  4N6J A;  4Y99 B;  2WDQ D;  3Q5P A;  3G6E P;  1JOC A;  3PTZ A;  1R5L A;  2I8D A;  2KSJ A;  4U3F J;  2K9J B;  2WT7 B;  1IFD A;  1ZRT D;  1OMI A;  2E76 B;  1JCC A;  2WSE J;  2FFD B;  1JM0 A;  2IZ0 A;  2IX7 C;  4H0L D;  3CX5 D;  4XE5 B;  3AEE D;  1X8Y A;  3RK3 D;  5CMZ A;  2KNC A;  2HLO A;  4D6T J;  1URQ C;  1BE3 D;  3SSU A;  2YO3 A;  5APU A;  1BGY D;  4DHI B;  2YIU B;  4PD4 E;  5APX A;  2BCC E;  1AQT A;  1A02 F;  2M0B A;  1AFO A;  2HOD A;  3H1K J;  3CCR P;  1H89 A;  5AW8 B;  1VF5 C;  2BCC G;  1IZN B;  5AW9 B;  4D6T D;  3AEG D;  2JKV A;  4LLH A;  1W2E A;  1KTM A;  3P8C D;  2FYZ A;  3PHL A;  2KI7 B;  3CWB E;  1DX7 A;  3A0H H;  1PV3 A;  1HGZ A;  3GF3 A;  3CCQ P;  2J5U A;  1HVV A;  2CPB A;  3H1L D;  2A45 G;  5M1B A;  2KB7 P;  4AYC A;  4JBZ A;  4U3F D;  1ZOY C;  1KYO I;  2MKV A;  2YKQ A;  2OAR A;  1OX3 A;  1CZQ A;  1KD1 Q;  3AE4 C;  2JR8 A;  3IR9 A;  1IFJ A;  2B76 D;  1LWU C;  4H44 D;  4EOT A;  1H88 A;  1R5S A;  1WMK A;  3HUS C;  3L74 E;  2GA1 A;  3P4R D;  2A06 G;  3HE5 A;  2KNC B;  2K37 A;  1AQ5 A;  2GUV A;  5KLV K;  1HUC A;  1RF0 C;  1Q90 D;  1S9K D;  1BGY J;  4LDT A;  3C9I A;  1EDJ A;  2IZ1 A;  2E42 A;  3VMA A;  1NTZ D;  4EDF A;  1NEK D;  3B8E B;  3AE5 D;  1SQB E;  1VQ7 P;  1FZB A;  1M90 Q;  3USS A;  1T2K C;  2WSS H;  4YTP D;  3AE7 D;  4WBA A;  1RQU A;  3CC2 P;  3BAS A;  3EFF K;  3HD7 B;  3AED D;  3B5N D;  3CC7 P;  1NTK E;  1KYO D;  2A06 D;  2W83 C;  1DIP A;  4DDI A;  4OWF A;  4XA4 A;  3L71 D;  3AEF C;  2G8Y A;  4DOJ A;  3P4P C;  3RGU A;  3V4W A;  3AE2 D;  1VF5 D;  3U1A A;  1PGO A;  1SVF A;  1T8Z A;  2Z5H A;  1SQP G;  5GTI E;  3VRA D;  2XKM A;  4AQR D;  4W80 A;  3M0D C;  1NTM J;  1Q2N A;  2OYI A; 
#chains in the Genus database with same CATH homology
 1OMI A;  3AEC C;  2WS3 C;  4YTM D;  2E76 B;  3VRB C;  3AEG C;  2QJY C;  3AE6 C;  3EWK A;  3VR9 C;  2WSE J;  3P4R C;  4I7Z C;  2WQY D;  1NGM B;  3P4R D;  3RK3 E;  3GLM A;  4KT0 J;  4XFJ A;  1NEN D;  1EXJ A;  2WDV C;  4OGQ B;  4YTP C;  2H88 D;  3AE7 C;  4PV1 B;  1L0V C;  3D71 A;  4YSX C;  3VR8 C;  4H0L D;  1S5L X;  3B71 A;  4H44 C;  3D6Z A;  2WDR D;  3AEE C;  2P10 A;  3AEE D;  3P4S C;  1KQG B;  1Q90 D;  2BS4 C;  4KX6 D;  1OW6 A;  2ZT9 C;  2NZ2 A;  4YSY D;  2QIW A;  1VL2 A;  5C2T C;  2WSF J;  4RKU J;  2JO1 A;  1UIX A;  2E76 C;  5C3J D;  1KMI Z;  2YIU C;  4YT0 D;  4I7Z B;  1KF6 D;  1YQ3 C;  1KF6 C;  2E75 C;  3Q3D A;  2WP9 D;  4YTM C;  2O01 J;  3AE5 C;  3AEC D;  1R8E A;  1NEK D;  3AE5 D;  4H13 C;  2QSI A;  4PV1 C;  3D6Y A;  3P4Q D;  1ZME C;  3AE1 D;  2WQY C;  1QLB C;  3LW5 J;  1VF5 B;  2ACZ D;  4TT3 H;  3CIR C;  1U57 A;  1EXI A;  1DD4 A;  2ACZ C;  2BS2 C;  4YSX D;  4H0L C;  1ZRT E;  1TU3 F;  2H88 C;  2WDR C;  4YTP D;  1L0V D;  3AE7 D;  3AE9 D;  3AEB C;  4U7J A;  3SFE C;  3P4S D;  2FYN C;  5KLI C;  4KX6 C;  1PL5 A;  2YMK A;  2D2C D;  3C8V A;  1YQ4 C;  3AEA C;  2WU2 D;  3AE8 C;  1YQ4 D;  3AEF D;  3Q5R A;  3GF7 A;  5C2T D;  1HJ0 A;  1RQV A;  4YTN C;  4R4M A;  3SFD C;  1HF9 A;  3AE3 C;  1YQ3 D;  1RQU A;  2D2C B;  1FDI A;  4YT0 C;  2IDB A;  1Y9B A;  2FBW C;  1VF5 C;  3VRB D;  3AEG D;  4Y28 J;  2WU5 C;  2V7Q J;  1KOR A;  3Q5S A;  3Q1M A;  2E74 B;  3D70 A;  1K04 A;  3S9O A;  4H0L B;  1AJY A;  1NEK C;  2WS3 D;  3AED D;  4PV1 D;  1MKM A;  2H89 C;  4OGQ D;  3RL0 g;  2E74 D;  1KTM A;  3AE4 D;  3O6Q A;  3FGA D;  3AE1 C;  3CIR D;  3ABV D;  3VRA C;  2B76 C;  2FXP A;  3AE9 C;  2WDQ C;  1JB0 J;  1PV3 A;  1ZOY D;  3SFE D;  1DIP A;  2WPV B;  3GF3 A;  2J5U A;  3G9R A;  3AE8 D;  3AEF C;  1KQF B;  2D2C C;  1E7P C;  2G8Y A;  4YXD D;  2OQQ A;  2WU2 C;  3AEA D;  5M1B A;  4YXD C;  1KFY D;  2E76 D;  4GDO A;  1ZP0 D;  3P4P C;  2QJK C;  1KFY C;  3P4P D;  3SFD D;  1K05 A;  4YTN D;  2E75 B;  4H13 B;  5C3J C;  4R4L A;  3AE2 C;  4IL6 X;  3AE2 D;  2JP3 A;  1S1C X;  3IN6 A;  2E75 D;  2MKV A;  1ZOY C;  4H13 D;  2WP9 C;  1VF5 D;  2FBW D;  2WU5 D;  3P4Q C;  1GMJ A;  3AE4 C;  5KKZ C;  2H89 D;  2E74 C;  3H25 A;  3AE6 D;  3AED C;  3Q2Y A;  3VR9 D;  4OGQ C;  1DD3 A;  2BS3 C;  2WDV D;  1IK7 A;  2B76 D;  1KIL E;  1OW8 A;  2K9Y A;  3ABV C;  4H44 B;  3Q5P A;  4Z1M H;  1NEN C;  2WDQ D;  4H44 D;  3GMA A;  2WSC J;  3VRA D;  3VR8 D;  3AEB D;  1WMK A;  2QJP C;  2ZT9 D;  1FDO A;  2BEZ F;  4YSZ D;  4YSZ C;  3R4Y A;  2G3A A;  1ZP0 C;  4YSY C;  1OW7 A;  3IAO A;  5L8R J;  3AE3 D;  1NYH A;  2BEQ D;  3T97 B;  2ZT9 B;  1PIX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...