4YTPC

Crystal structure of porcine heart mitochondrial complex ii bound with n-[(4-tert-butylphenyl)methyl]-2-(trifluoromethyl)benzamide
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 52
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2015-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4ytpC01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 4ytpC02
4YSYD 1NEND 1PV3A 4YTMD 3VR8D 3VRBC 2WDQD 3ABVC 1YQ4D 5C2TC 2ACZC 3AE1C 3AE3C 2BS4C 3SFED 1KF6D 3AE9D 2H88C 2WU5D 2WU2D 2B76C 3VR9D 3AEED 3P4SC 2WDVC 4YXDD 2WP9C 4KX6D 3P4QC 1NEKD 2WS3D 3AEFD 1KFYC 1L0VC 3AE2C 3VRAD 3CIRC 3AE7D 3AEGC 3SFDD 2H89D 3AE6C 2WQYD 1YQ3D 3S9OA 3AEBD 4YTMC 3AE8C 3AEDD 3P4RD 2WDQC 5C3JD 4YSXD 2FBWD 1YQ4C 2WDRD 1OW7A 2BS2C 3SFEC 1KF6C 1ZOYC 3AE9C 2WU5C 4YTNC 4YSZD 4YXDC 4YT0D 1K04A 4YTPD 4KX6C 5C2TD 3AE3D 3AE1D 3AEAD 1K05A 2WS3C 3P4PC 3P4SD 2WDVD 3AE4C 3VRAC 3AE7C 1KTMA 3AECD 4YSYC 1NENC 3VR8C 1ZP0D 2WQYC 3AE5D 1L0VD 1YQ3C 3AE2D 3CIRD 3AEDC 2WU2C 3VRBD 3VR9C 3AEEC 3ABVD 2WDRC 3AE6D 2ACZD 3AE8D 2G3AA 1NEKC 2FBWC 4YSZC 2H88D 3B71A 2B76D 4YT0C 2BS3C 3AEFC 4YTPC 3AEAC 1OW8A 2WP9D 1ZOYD 3P4QD 4YTND 3SFDC 2H89C 1E7PC 1KFYD 3AECC 1OW6A 3AEBC 3AEGD 3P4PD 1QLBC 3P4RC 1ZP0C 5C3JC 4YSXC 3AE5C 3AE4D
chains in the Genus database with same CATH superfamily
1Q86Q 2UWJE 3L71J 3IF4A 1FZFA 1J2JB 2KS1A 2FFDB 2PGDA 2ZYAA 1H0TB 2H8PD 2H88C 1N73B 4L76A 1IFIA 3P4SC 2OYHC 3TNUB 2OYHA 1TFFA 2ITAA 2E76C 4WY4D 2KOGA 1EDJA 1NKNA 3VONA 1LTTC 2B87B 1JY3O 3CC2P 2OTJP 2WQYD 4EIJA 1ZRTE 3O6QA 2RH0A 2YO2A 1RF1B 1NH4A 1VL2A 1DEBA 1P84H 1P84E 3H1KJ 3NXSA 5C39A 2FYUE 3RBZA 4WY4C 4OWFA 4WY4A 5GTIH 1FDMA 5GTIE 3AE4C 2B88A 2WSFH 4YSYC 1FOSF 3VR8C 2WQYC 2E5YA 2HODA 2E74C 1S3JA 1BGYJ 3Q5RA 4AQRD 5APSA 1JOCA 1ZV8A 3B71A 1YHQP 2I1JA 4XE5B 2GUVA 3U1AA 3H1ID 3V4WA 1URQB 1OW6A 2YO3A 3CXHD 4PV1B 2O3JA 1AQTA 1NEND 1NTZD 3HUSB 4N78D 2C9LY 3H1IE 1NU1E 2W83C 3RL0D 4EI2A 1PL5A 1VQNP 2K9JB 3SWKA 1R5SA 2KS1B 3CD6P 3E7KA 2WZ7A 3AE2C 3VRAD 1KB9H 2OYHB 3GHGC 3GHGA 1PGQA 3LIEA 2E76B 1Q2NA 3CWBG 3CCRP 4LDTA 2IX7C 4H0LB 2QM8A 3H1LD 4IFMA 1X22A 2PP6A 2FYUJ 2QRXA 1KILD 1FZCA 1AFOA 2WSFJ 3VRAC 1SQBG 4DT0A 2WPQA 3CIRD 1D7MA 3BASA 3L71G 3B8EB 2M3EA 5AW2B 1DEEG 2O01N 1NOHA 1H8AA 4TLFA 1T6AA 1TU3F 1XTGB 2O01H 2IBZG 5CJ0A 2HODB 4BRYA 1KILC 1KILA 1LTBC 4H44D 4U3FE 1IFMA 1SQVK 1S5LH 1S5LE 1BE3E 4I2LC 1PP9E 3D6YA 1NO4A 2FYNB 4EDFA 1U57A 1WT6A 1VQ9P 3H1IJ 1NU1J 3HE5A 5KLVK 3CCVP 2A45I 1YQ4D 2OTLP 1NVOA 3SFED 1LGHB 3H1HD 1SVFA 2B9BA 3NFQA 1NJIQ 1AVYA 3H1KG 4H44C 5K5GB 4K35A 3AE7D 3SFDD 4I7ZB 3CCLP 1M1JC 3H1HE 3M9BA 3FXDA 2KLVA 3SWFA 3TGUE 1M56D 2M3BA 1YQ4C 1QEXA 1KYOH 1KYOE 3M9HA 3SFEC 3GHGB 1BGYG 3V6IA 2G8YA 1HJBA 3CX5D 1LJ2A 3RL0B 2P1JA 2OTKE 2KSEA 3AE7C 3I56P 1JY2N 3G4SP 3II6A 1PIXA 1FZCB 1JB0J 2Z5HA 3GF3A 1WMKA 1JMBA 2ACZD 3CX5E 2O01J 1X79B 3VP8A 1FAVA 1KQFB 3MP7B 5KAIH 5KAIE 1J1DB 2MKVA 4U3FJ 1BE3J 1ZMEC 3HRNA 5B66E 1PP9J 3PJSK 2J58A 3KPEA 4BRYB 3CCQP 3M06A 3PTZA 2NPSD 2OQQA 3VYIA 4YTMD 2WDQD 1KN7A 1M7LA 2ACZC 3P32A 2NZ2A 2AXCA 3CMEP 4DHIB 1OXZA 2E42A 1JY3P 2FYUG 2QJPC 1M1KQ 1USEA 1Y8AA 5AVRB 1VQPP 3PHLA 1OFCX 1NTKK 1ZXGA 2YKQA 2V4HA 2NPSC 3H1HJ 2NPSA 4H44B 4YTMC 3TGUJ 2WDQC 2R44A 1X8YA 2HPCA 2IYOA 1YBKA 2WSEH 2CK3H 1SQPE 2M5AA 1NTMK 5KKZB 1VQ8P 4M3LA 1A02F 3JCUE 1K04A 2ZXEB 2Y0CA 1NWQA 1T2KD 1G1JA 4IL6H 4IL6E 1MFZA 2QJKC 5M1BA 4HJGH 4GDOA 3OAKA 2IYPA 1EZVI 2E75D 2IZ0A 1RH5B 1FJPA 3H1IG 1NU1G 3CWBD 5AW6B 2G3AA 2MJZA 3R2PA 1PGOA 1OW8A 3KZIH 1SQXE 3KZIE 4BXLA 4YTND 2K3RA 1VQ7P 1IFJA 5AW9B 2QA4P 4WWIA 1KMIZ 2C0WA 1GU4A 1SQBD 5CJ4A 1CI6A 1PV3A 4K3AA 3L71D 3CCEP 1L0NJ 3AE3C 2XV5A 2HFED 3AEED 1QX8A 4YXDD 2IBZD 1HUCA 2FFDC 2KIKA 1NEKD 4LC1A 1H0TA 1N73C 1L0VC 1N73A 3LW5H 3L71E 1HVVA 5KLIB 2QJPB 3V2PA 4PD4D 3HE4A 3GF7A 2LXBA 2WSEJ 1SQPJ 2B87A 2Q3IA 4L74A 1S1CX 1HJ0A 3PRJA 4YXDC 2J5UA 1VF5D 2HPCB 1T8ZA 2PRRA 2M5AB 1RF1C 3H1KD 2AEFA 4U3FG 5EFWB 1BE3G 3KYQA 3UIAA 3BCCE 1PP9G 4ZMDA 3H25A 2I8DA 2WPRA 3CCUP 3SWYA 3EWKA 1KQGB 1R5LA 3AE6D 1L0LK 1VDFA 1BDDA 3CI9A 1BGYD 2KI7B 1GK6A 1SQXJ 1FS0E 2NRGA 2R5DA 4MN4C 2WVRA 3M0AA 1JY2O 2BCCE 3TYYA 3IN6A 3H1HG 3TGUG 3L72J 1GK4A 2BS4C 1YYCA 2E75B 2YIUB 4DOJA 3HUSC 3HUSA 5AVSB 3OA7A 1RQUA 4AUWA 4TT3H 2HYNA 3OJAB 4H0LD 3AEFD 2R32A 1LT9A 3LW5J 3M91A 3VTPC 1NAFA 2KZJA 2K9JA 2Y0EA 4CPGA 5AW8B 1QVFO 1CW5A 2FBWD 4UB8H 4UB8E 3MUDA 1ZRTD 2FKWB 1KQLA 2ZFYA 4I6LA 3P8CD 2QM7A 2D2CD 3KHUA 2PFXA 1G1IA 4YT0D 3HE4B 1G2CA 1OVUA 3CXHI 1P84D 1SQQK 2AEJA 4H0LC 3MZWB 2FYUD 3BCCJ 3L70E 1JEKA 1Y47A 2YNYA 3KXDA 2Z5IA 3W67A 2HR3A 3P8CE 5BU5A 4OH8B 3TSIA 1IO4A 2J59M 1PPJE 2DW3A 3V4QA 1HGVA 3L36A 4N6JA 4W7ZA 1OZHA 3V5BA 1L0NG 4JYBA 4YT0C 1CZQA 2WT7B 1Q90D 1N7SB 3B5ND 2BCCJ 2KK7A 1W5CE 3USSA 1VF5B 5GTHH 5GTHE 3CCJP 3WUVA 5AVZB 5AW3B 2FYNC 3O8ZA 2KSJA 1SQPG 1NU1D 3AE9D 3D6ZA 5AVUB 1HF9A 3HTKB 2QE7H 2ZVOB 5APQA 3V2NA 1EXJA 1KORA 4HKZH 2QJYB 2N9BA 3B5NA 2RMZA 1BCCE 3MTUE 2YMYA 2Q1KA 1KB9D 2CPBA 4JBZA 3TK1A 1LT9B 4I7ZC 3AE9C 3H1JE 1SQVE 4W7YA 1FOSE 1SQXG 1KB9E 2JO1A 3EFGA 3L70J 1EQ7A 2QIWA 1NENC 1G2CB 3N7NA 1NKZB 3CCMP 3BRTB 1GW4A 1RHZB 3K5BA 1H88A 2PAJA 3RL0C 3EQ2A 2BASA 2WPSA 3QWOC 3L72G 1FZCC 2QEXP 1LTIC 3A0BH 3N4XA 3A0BE 2Q5UA 1KFNA 1PZQA 2JWDA 2W6AA 3P7KA 2D2CB 1OWAA 1NYHA 1AV1A 4U3FD 1XTCC 3AEGD 1BE3D 3P4PD 1QLBC 1J1DC 1PP9D 3CLQA 2Q3EA 2K9YA 2AEMA 3QH9A 1HWTC 2IDBA 2ZAEB 2JKVA 4JPZB 1OVRA 1SFCD 3PLNA 3CX5I 1AQ5A 1PGPA 5CHXA 1FJKA 2KLUA 2GA1A 1BCCJ 2W6JH 3BCCG 3CIRC 3AEGC 4B86A 1FDIA 3B4SA 2FXOA 3AEBD 3A2AA 3B5NB 5C3JD 1T3JA 2BEZF 3TGUD 5AVXB 1NTZK 1LNQA 3H1JJ 1SFCC 1VQ6P 3E1RA 1SQVJ 1SFCA 1KYOD 2YXRB 1K05A 3Q3DA 4L73A 1S9KD 1DX7A 5KKZC 4U7JA 5KLVJ 2BCCG 3RK2D 1NTKD 1L4AB 1BSNA 5CBNA 5CCHD 2K88A 5AVVB 3AE8D 1NTMD 1S9KE 3NTNA 1RF0C 1RF0A 2E5TA 5AW7B 1JY2P 2OARA 2W90A 1NTKE 2P2UA 2P58A 1FZEA 3SFDC 2Z4EA 2H43A 3RK2C 2C0XA 1MZ9A 1FZBA 3WU2H 4OGQD 3WU2E 2H7HA 1NTME 1LWUC 1LWUA 1FU1A 5CCHA 4DDIA 2A06E 4Y99B 5AW0B 3A5TA 5E79H 5E79E 1VQLP 2WU5D 3VR9D 4UB6H 1L0ND 4UB6E 2Q6QA 1DD3A 3CC7P 3GLMA 5BU8B 3IFMA 4I6MC 3L70G 3G3ZA 5CMZA 4OGQC 1IZNB 1M90Q 3S9OA 1L0NE 1PPJG 4YSXD 3MD0A 4PJ0H 4PJ0E 3CC4P 3Q5SA 2WU5C 2A45H 1KV4A 4YSZD 2XZRA 1YTZT 5KLIC 1SQPD 5DJTB 5C2TD 3AE1D 3E1IA 1SFCB 3EFFK 1FE6A 2HG5D 5DJUB 2I1KA 3AE5D 3VOPA 4R4MA 3WMM0 3R4YA 3G9RA 4WVZA 4WBAA 5L8RJ 2IBZI 5H2FH 3PH0A 1K8AQ 4YSZC 5APVA 2BEQD 2N1TD 1NTKJ 4H13D 1ZOYD 1R8EA 4DDGA 1S4XA 1SQXD 1E7PC 1W2EA 4PD4I 2KP8A 1BCCG 1FBMA 3V2RA 1NTMJ 3AE5C 2XKMA 4DCKA 3F89A 1VQMP 1GTWA 2LXCB 1IC2A 3RK2B 4ZNCA 1T2KC 1L0LD 2N1TA 3H1JG 1JCCA 1SQVG 3U1CA 4NPDA 3L72D 4H13C 1LWUB 3M9QA 2K37A 4YXWH 3GW6A 1HTLC 1EDLA 5AW5B 2E75C 1QL1A 2YIUC 5KLVG 3I55P 4JQ0D 2CPSA 2IFMA 1L0LE 3RK3E 2WMMA 1YQ3D 1QVGO 3L72E 4GODA 3CCSP 4WB4A 2GM4A 1NAYA 4OGQB 4YTNC 2E43A 1FZAA 1M57D 4C7RA 3G71P 1YJ9P 2LKMA 2WDVD 2YXQB 2IFNA 1MKMA 3BCCD 1ZP0D 2M0BA 4IOIH 1YQ3C 1U7JA 1N7SD 2XU6A 3AEEC 1BDCA 2V7QH 2LR2A 2POHA 1NEKC 1LTAC 3M0DA 3P4QD 4BWNA 4D6TG 3L74E 2WSSH 5APTA 2HLOA 1YJWP 2QG4A 2ZVNB 1ZP0C 2BCCD 2FXMA 2WT7A 1N7SC 1EZVE 1N7SA 3H6PA 3BVHA 1VF5C 1SQQE 2XNXA 1KF6D 1P84I 1LT1A 2WU2D 3Q2YA 3KDPB 1RE3A 3NMDA 3P4QC 5AVQB 1LTSC 3L73E 1SLQA 2RN0A 1HH0A 4ASWA 2N1TB 3ITKA 2C9NY 3HTKA 2O1KA 3L37A 4QMAA 4H13B 1VQ4P 2JR8A 2H89D 1L0LJ 3AE6C 3CMAP 3H32A 1A02J 2QJYC 1SQBK 3P4RD 4NPFX 4XFJA 3FX0A 1KF6C 2P7JA 3IR9A 2ZFCA 5KAFH 1LT9C 5KAFE 3AEAD 1NTKG 3RBXA 3P4SD 1PGJA 1KFMA 2OYIA 3L70D 3FGAD 4A7PA 3F5HA 3MUDC 1NTMG 1L2PA 1EXIA 4ZKPA 3ABVD 2V7QJ 1J1EB 2WWWA 1PPJD 5B5EH 2A06G 5B5EE 1YIJP 1IK7A 5AVTB 3G6EP 3PP5A 2L91A 2BS3C 3AEFC 1RE4C 1RE4A 3AEAC 4GT1A 2WP9D 2QSIA 3L74J 1KB9I 3D70A 3I5CA 1GL2B 4KHXA 4I1LA 2FBWC 2W27A 3AE4D 5APYA 1HGZA 4YSYD 2JP3A 3VR8D 1AVOA 2D2CC 1LP1B 3ABVC 4JYCA 3W68A 2IZ1A 1MFTA 1SQQJ 3A7OA 4NPEA 2O1JA 2A45G 2E74D 3JC22 2SPZA 2WP9C 4IFFA 4KX6D 1EC5A 3C9IA 3L73J 1OX3A 2P10A 1JO5A 4Y28J 4IFDK 1JNMA 1BCCD 1S72P 2WTYA 4GOFA 1GDTA 1GZLA 3H32B 1L4AD 3B5NC 3H1JD 3S1KA 4KX6C 2Y9ZA 1SQVD 4OVNF 2P67A 2AXTH 2AXTE 1HBWA 4LLHA 4EYYQ 4EOTA 3C8VA 1FZGA 1KTMA 3AECD 2ZT9D 4XA4A 5KLVD 1JTHA 2XDJA 3AE2D 2B89A 1T3UA 2RKLA 2OYIB 2Y9YA 2YKPA 1L4AC 1L4AA 2VRSA 1PFIA 5KLVE 3WUUA 3CXHH 3CXHE 3VMZA 2KZIA 3AECC 1KFYD 2ZT9C 1AA0A 2FYUK 4DJGA 1NTZE 2ZXXA 2XNDH 1L0LG 4N78E 1KYOI 4RKUJ 1GU5A 4R4LA 1E5WA 4GOEA 2R3SA 4O9BA 1NHLA 1X0TA 3L75D 4RO0A 2WPVB 4Y99C 1FDOA 1X9VA 2K1AA 3VN0A 3O6QB 4L75A 3KQGA 1KFYC 4D6TD 3GG2A 3Q1MA 3LIDA 2IPPA 1ZN5A 3CPWO 1KZUB 1YI2P 3VMAA 5AW4B 4WY4B 3L75E 3H1LE 1N2DC 1GW3A 4D6TE 1KILE 2WSCH 1ZR2A 1IFNA 4YTPD 5KJ7D 1NU1K 1Q82Q 3P4PC 1OIPA 1U7MA 3L74G 2E74B 1YITP 1DIPA 2GUSA 5CCGD 1H89A 1EZVG 5KTBA 4DHZA 3BATA 1SQQG 1DD4A 1JTHB 1Q81Q 4YTPC 5KJ7C 5KJ7A 5AVWB 1GD2E 3L73G 1MV8A 5CCGC 3AEBC 5CCGA 1K73Q 1DH3A 1NTZJ 5C3JC 1S5LX 4Z1MH 2Q9IA 3WUTA 3T97A 2YKOA 1M8OB 1IK9A 1M1JA 2ZT9B 1RQVA 2A06D 4YPCA 5TISH 5TISE 4LGDE 3SSUA 3V2QA 4RJTA 1S2EA 4N3YB 3A0HH 3A0HE 3TDKA 5CCHC 2OGUA 1JMMA 3TF5A 3AE8C 1MUUA 3AEDD 1LTGC 1OVVA 3L75J 3H1LJ 1SP4A 5BVZA 3Q5PA 4D6TJ 2JJLA 2WSCJ 1YTZI 3VP9A 3CX5H 4GIFA 3CL3D 1JM0A 2QVAA 3JSVC 3RGUA 1NGMB 2ZJSE 2JDIH 2FXPA 1Z56A 5CBOA 4KT0J 5B66H 2N9YB 4GKGA 3AEDC 1VQOP 1JCDA 3VRBD 1KILB 3VR9C 3C1LA 1VQ5P 1EDIA 4C7NA 2B76D 4AYCA 1OMIA 3VMYA 1EDKA 2KYVA 3A3YB 2L5GB 1KC8Q 5APXA 4ASVA 2FYZA 3HE5B 1VQKP 4YSXC 1YJNP 4DHJA 1JY3N 2ZYDA 1E79H 5H2FE 3VRBC 2Q7CA 5C2TC 3AE1C 4HB1A 2B76C 3T97B 3ZDMA 1ZLLA 1QGKB 4HH2A 2WS3D 1GMJA 1M1JB 3JCUH 2FY8A 1AJYA 2KNCA 1N7LA 3HD7D 1W2BO 3RK3D 2N1TC 2WDRD 1OW7A 1Q7YQ 2BS2C 3D71A 3MIWA 2W6BA 1ZOYC 2KXPB 1QLED 3MHVA 3AE3D 3BRVB 2WS3C 2JEEA 1L0NK 3P8MC 3GMAA 4IL6X 2OYOA 4C46A 1IFPA 2WITA 1SS1A 1BSHA 3HD7C 3HD7A 1NTZG 1L0VD 3FWLA 3RK3C 3RL0g 3CWBE 3MGNA 2WDRC 3L35A 2R5BA 1ZW0A 1GL2D 5AVYB 2YMKA 1LTJC 1LTJA 1ZR4A 1J1EC 1SQPK 3L4FA 1N8RQ 4C7NB 1SQBE 2FFDA 3L74D 1RY3A 4DZOA 4ZKUA 1IFDA 1USDA 3TNUA 3M0DC 1EZVD 2M8RA 1GL2C 5APUA 1GL2A 3H1LG 3L75G 2IBZE 1SQQD 2WDVC 1LP1A 2KB7P 3OW2O 2W8ZA 2NPSB 4HYTB 3L73D 3U59A 1QL2A 1SQXK 1KD1Q 4FJVA 4PD4H 1RF1A 4PD4E 1WRGA 5AW1B 4KJMA 3VMXA 2JWAA 5TJHA 1RE3C 2KNCB 2QJKB 1URQD 1N86A 4PV1D 3H1KE 2ZYGA 2Y0DA 1IJDB 1Y9BA 3S4RA 3CWBJ 3IAOA 2WU2C 1JUNA 4RESB 1BGYE 1URQC 3FWNA 3HD7B 1URQA 1UIXA 2H88D 1CSBA 4PV1C 1FC2C 1KQSO 3RK3B 5APWA 2OYIC 1VPCA 1CI6B 2E76D 2H89C 1SQBJ 1K9MQ 4W80A 3FXEA 2R3CA 3P4RC 1UIIA 1LTJB 2KUBA 4JF7A
chains in the Genus database with same CATH topology
2OQQA 4Z1MH 2K9YA 4YSYD 1NEND 1PV3A 4YTMD 1U57A 2JP3A 4RKUJ 3VR8D 2D2CC 2WDQD 3ABVC 2IDBA 3VRBC 4R4LA 2FYNC 1YQ4D 2ZT9B 5C2TC 2ACZC 1VF5C 3AE1C 3AE3C 2BS4C 3SFED 1RQVA 1KF6D 2E75B 3AE9D 2H88C 3D6ZA 2WU5D 2WU2D 1PL5A 2E74D 2B76C 2NZ2A 3VR9D 3AEED 3Q2YA 3P4SC 3T97B 1HF9A 2WDVC 4YXDD 4H13C 2WP9C 4KX6D 3P4QC 1DD3A 1NEKD 2WPVB 1RQUA 3GLMA 2WS3D 2QJPC 1GMJA 2E76C 1FDOA 4H44C 1KORA 3AE5C 4TT3H 1EXJA 3AEFD 4H0LD 2E75C 1KFYC 1L0VC 2YIUC 3AE2C 3LW5J 2P10A 3VRAD 1AJYA 3AE7D 3AEGC 3CIRC 4Y28J 3Q1MA 3SFDD 4H13B 2H89D 4I7ZB 4OGQC 1FDIA 3AE6C 3RK3E 2WQYD 2E76B 4H44B 2QJYC 3S9OA 1YQ3D 3AE8C 3AEBD 4YTMC 3AEDD 3P4RD 3GF7A 2WDQC 1ZRTE 3O6QA 5C3JD 4YSXD 2BEZF 2WSEJ 4XFJA 2FBWD 1YQ4C 2WDRD 1OW7A 2BS2C 3Q5PA 3SFEC 3D71A 3Q5SA 4H0LB 1ZOYC 3AE9C 4I7ZC 1KF6C 2WU5C 4OGQB 4YTNC 1S1CX 1HJ0A 1VL2A 2D2CD 4YSZD 5KLIC 2WSCJ 2G8YA 1KILE 4YXDC 4YT0D 2J5UA 1K04A 4YTPD 4PV1D 4KX6C 1VF5D 5C2TD 3AE3D 3AE1D 3AEAD 1K05A 2WS3C 3Q3DA 2JO1A 3P4PC 2QJKC 4H0LC 5KKZC 3GMAA 3P4SD 2WDVD 2QIWA 3AE4C 3C8VA 2WSFJ 2E74B 4IL6X 1NGMB 3VRAC 4U7JA 3AE7C 5M1BA 1DIPA 1KTMA 3AECD 4YSYC 1NENC 4GDOA 3H25A 2FXPA 2ZT9D 1MKMA 3VR8C 1Y9BA 3FGAD 1ZP0D 4KT0J 2E75D 3EWKA 1PIXA 2WQYC 1KQGB 3AE5D 1L0VD 1YQ3C 3AE2D 4R4MA 3CIRD 3R4YA 3AEDC 3IAOA 1JB0J 3G9RA 3RL0g 2WU2C 2E74C 1EXIA 3VRBD 3GF3A 3VR9C 3AEEC 5L8RJ 2WDRC 2V7QJ 3ABVD 3AE6D 1WMKA 3Q5RA 2ACZD 1IK7A 3AE8D 1TU3F 1DD4A 2G3AA 1NEKC 4YSZC 1UIXA 2BEQD 2O01J 2YMKA 2H88D 3B71A 2B76D 4YT0C 2BS3C 3AEFC 4YTPC 1KQFB 4PV1C 4H13D 3AEAC 1OW8A 1OMIA 2WP9D 1ZOYD 3P4QD 4YTND 1R8EA 1Q90D 2MKVA 2QSIA 3SFDC 2E76D 4H44D 3D70A 2H89C 1ZMEC 1E7PC 2D2CB 1KMIZ 3AECC 1KFYD 1NYHA 3D6YA 1OW6A 3AEBC 2ZT9C 3AEGD 3P4PD 1QLBC 3P4RC 4PV1B 1VF5B 1ZP0C 1S5LX 5C3JC 4YSXC 3IN6A 4OGQD 2FBWC 3AE4D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YSY D;  1NEN D;  1PV3 A;  4YTM D;  3VR8 D;  3VRB C;  2WDQ D;  3ABV C;  1YQ4 D;  5C2T C;  2ACZ C;  3AE1 C;  3AE3 C;  2BS4 C;  3SFE D;  1KF6 D;  3AE9 D;  2H88 C;  2WU5 D;  2WU2 D;  2B76 C;  3VR9 D;  3AEE D;  3P4S C;  2WDV C;  4YXD D;  2WP9 C;  4KX6 D;  3P4Q C;  1NEK D;  2WS3 D;  3AEF D;  1KFY C;  1L0V C;  3AE2 C;  3VRA D;  3CIR C;  3AE7 D;  3AEG C;  3SFD D;  2H89 D;  3AE6 C;  2WQY D;  1YQ3 D;  3S9O A;  3AEB D;  4YTM C;  3AE8 C;  3AED D;  3P4R D;  2WDQ C;  5C3J D;  4YSX D;  2FBW D;  1YQ4 C;  2WDR D;  1OW7 A;  2BS2 C;  3SFE C;  1KF6 C;  1ZOY C;  3AE9 C;  2WU5 C;  4YTN C;  4YSZ D;  4YXD C;  4YT0 D;  1K04 A;  4YTP D;  4KX6 C;  5C2T D;  3AE3 D;  3AE1 D;  3AEA D;  1K05 A;  2WS3 C;  3P4P C;  3P4S D;  2WDV D;  3AE4 C;  3VRA C;  3AE7 C;  1KTM A;  3AEC D;  4YSY C;  1NEN C;  3VR8 C;  1ZP0 D;  2WQY C;  3AE5 D;  1L0V D;  1YQ3 C;  3AE2 D;  3CIR D;  3AED C;  2WU2 C;  3VRB D;  3VR9 C;  3AEE C;  3ABV D;  2WDR C;  3AE6 D;  2ACZ D;  3AE8 D;  2G3A A;  1NEK C;  2FBW C;  4YSZ C;  2H88 D;  3B71 A;  2B76 D;  4YT0 C;  2BS3 C;  3AEF C;  4YTP C;  3AEA C;  1OW8 A;  2WP9 D;  1ZOY D;  3P4Q D;  4YTN D;  3SFD C;  2H89 C;  1E7P C;  1KFY D;  3AEC C;  1OW6 A;  3AEB C;  3AEG D;  3P4P D;  1QLB C;  3P4R C;  1ZP0 C;  5C3J C;  4YSX C;  3AE5 C;  3AE4 D; 
#chains in the Genus database with same CATH topology
 1Q86 Q;  2UWJ E;  3L71 J;  3IF4 A;  1FZF A;  1J2J B;  2KS1 A;  2FFD B;  2PGD A;  2ZYA A;  1H0T B;  2H8P D;  2H88 C;  1N73 B;  4L76 A;  1IFI A;  3P4S C;  2OYH C;  3TNU B;  2OYH A;  1TFF A;  2ITA A;  2E76 C;  4WY4 D;  2KOG A;  1EDJ A;  1NKN A;  3VON A;  1LTT C;  2B87 B;  1JY3 O;  3CC2 P;  2OTJ P;  2WQY D;  4EIJ A;  1ZRT E;  3O6Q A;  2RH0 A;  2YO2 A;  1RF1 B;  1NH4 A;  1VL2 A;  1DEB A;  1P84 H;  1P84 E;  3H1K J;  3NXS A;  5C39 A;  2FYU E;  3RBZ A;  4WY4 C;  4OWF A;  4WY4 A;  5GTI H;  1FDM A;  5GTI E;  3AE4 C;  2B88 A;  2WSF H;  4YSY C;  1FOS F;  3VR8 C;  2WQY C;  2E5Y A;  2HOD A;  2E74 C;  1S3J A;  1BGY J;  3Q5R A;  4AQR D;  5APS A;  1JOC A;  1ZV8 A;  3B71 A;  1YHQ P;  2I1J A;  4XE5 B;  2GUV A;  3U1A A;  3H1I D;  3V4W A;  1URQ B;  1OW6 A;  2YO3 A;  3CXH D;  4PV1 B;  2O3J A;  1AQT A;  1NEN D;  1NTZ D;  3HUS B;  4N78 D;  2C9L Y;  3H1I E;  1NU1 E;  2W83 C;  3RL0 D;  4EI2 A;  1PL5 A;  1VQN P;  2K9J B;  3SWK A;  1R5S A;  2KS1 B;  3CD6 P;  3E7K A;  2WZ7 A;  3AE2 C;  3VRA D;  1KB9 H;  2OYH B;  3GHG C;  3GHG A;  1PGQ A;  3LIE A;  2E76 B;  1Q2N A;  3CWB G;  3CCR P;  4LDT A;  2IX7 C;  4H0L B;  2QM8 A;  3H1L D;  4IFM A;  1X22 A;  2PP6 A;  2FYU J;  2QRX A;  1KIL D;  1FZC A;  1AFO A;  2WSF J;  3VRA C;  1SQB G;  4DT0 A;  2WPQ A;  3CIR D;  1D7M A;  3BAS A;  3L71 G;  3B8E B;  2M3E A;  5AW2 B;  1DEE G;  2O01 N;  1NOH A;  1H8A A;  4TLF A;  1T6A A;  1TU3 F;  1XTG B;  2O01 H;  2IBZ G;  5CJ0 A;  2HOD B;  4BRY A;  1KIL C;  1KIL A;  1LTB C;  4H44 D;  4U3F E;  1IFM A;  1SQV K;  1S5L H;  1S5L E;  1BE3 E;  4I2L C;  1PP9 E;  3D6Y A;  1NO4 A;  2FYN B;  4EDF A;  1U57 A;  1WT6 A;  1VQ9 P;  3H1I J;  1NU1 J;  3HE5 A;  5KLV K;  3CCV P;  2A45 I;  1YQ4 D;  2OTL P;  1NVO A;  3SFE D;  1LGH B;  3H1H D;  1SVF A;  2B9B A;  3NFQ A;  1NJI Q;  1AVY A;  3H1K G;  4H44 C;  5K5G B;  4K35 A;  3AE7 D;  3SFD D;  4I7Z B;  3CCL P;  1M1J C;  3H1H E;  3M9B A;  3FXD A;  2KLV A;  3SWF A;  3TGU E;  1M56 D;  2M3B A;  1YQ4 C;  1QEX A;  1KYO H;  1KYO E;  3M9H A;  3SFE C;  3GHG B;  1BGY G;  3V6I A;  2G8Y A;  1HJB A;  3CX5 D;  1LJ2 A;  3RL0 B;  2P1J A;  2OTK E;  2KSE A;  3AE7 C;  3I56 P;  1JY2 N;  3G4S P;  3II6 A;  1PIX A;  1FZC B;  1JB0 J;  2Z5H A;  3GF3 A;  1WMK A;  1JMB A;  2ACZ D;  3CX5 E;  2O01 J;  1X79 B;  3VP8 A;  1FAV A;  1KQF B;  3MP7 B;  5KAI H;  5KAI E;  1J1D B;  2MKV A;  4U3F J;  1BE3 J;  1ZME C;  3HRN A;  5B66 E;  1PP9 J;  3PJS K;  2J58 A;  3KPE A;  4BRY B;  3CCQ P;  3M06 A;  3PTZ A;  2NPS D;  2OQQ A;  3VYI A;  4YTM D;  2WDQ D;  1KN7 A;  1M7L A;  2ACZ C;  3P32 A;  2NZ2 A;  2AXC A;  3CME P;  4DHI B;  1OXZ A;  2E42 A;  1JY3 P;  2FYU G;  2QJP C;  1M1K Q;  1USE A;  1Y8A A;  5AVR B;  1VQP P;  3PHL A;  1OFC X;  1NTK K;  1ZXG A;  2YKQ A;  2V4H A;  2NPS C;  3H1H J;  2NPS A;  4H44 B;  4YTM C;  3TGU J;  2WDQ C;  2R44 A;  1X8Y A;  2HPC A;  2IYO A;  1YBK A;  2WSE H;  2CK3 H;  1SQP E;  2M5A A;  1NTM K;  5KKZ B;  1VQ8 P;  4M3L A;  1A02 F;  3JCU E;  1K04 A;  2ZXE B;  2Y0C A;  1NWQ A;  1T2K D;  1G1J A;  4IL6 H;  4IL6 E;  1MFZ A;  2QJK C;  5M1B A;  4HJG H;  4GDO A;  3OAK A;  2IYP A;  1EZV I;  2E75 D;  2IZ0 A;  1RH5 B;  1FJP A;  3H1I G;  1NU1 G;  3CWB D;  5AW6 B;  2G3A A;  2MJZ A;  3R2P A;  1PGO A;  1OW8 A;  3KZI H;  1SQX E;  3KZI E;  4BXL A;  4YTN D;  2K3R A;  1VQ7 P;  1IFJ A;  5AW9 B;  2QA4 P;  4WWI A;  1KMI Z;  2C0W A;  1GU4 A;  1SQB D;  5CJ4 A;  1CI6 A;  1PV3 A;  4K3A A;  3L71 D;  3CCE P;  1L0N J;  3AE3 C;  2XV5 A;  2HFE D;  3AEE D;  1QX8 A;  4YXD D;  2IBZ D;  1HUC A;  2FFD C;  2KIK A;  1NEK D;  4LC1 A;  1H0T A;  1N73 C;  1L0V C;  1N73 A;  3LW5 H;  3L71 E;  1HVV A;  5KLI B;  2QJP B;  3V2P A;  4PD4 D;  3HE4 A;  3GF7 A;  2LXB A;  2WSE J;  1SQP J;  2B87 A;  2Q3I A;  4L74 A;  1S1C X;  1HJ0 A;  3PRJ A;  4YXD C;  2J5U A;  1VF5 D;  2HPC B;  1T8Z A;  2PRR A;  2M5A B;  1RF1 C;  3H1K D;  2AEF A;  4U3F G;  5EFW B;  1BE3 G;  3KYQ A;  3UIA A;  3BCC E;  1PP9 G;  4ZMD A;  3H25 A;  2I8D A;  2WPR A;  3CCU P;  3SWY A;  3EWK A;  1KQG B;  1R5L A;  3AE6 D;  1L0L K;  1VDF A;  1BDD A;  3CI9 A;  1BGY D;  2KI7 B;  1GK6 A;  1SQX J;  1FS0 E;  2NRG A;  2R5D A;  4MN4 C;  2WVR A;  3M0A A;  1JY2 O;  2BCC E;  3TYY A;  3IN6 A;  3H1H G;  3TGU G;  3L72 J;  1GK4 A;  2BS4 C;  1YYC A;  2E75 B;  2YIU B;  4DOJ A;  3HUS C;  3HUS A;  5AVS B;  3OA7 A;  1RQU A;  4AUW A;  4TT3 H;  2HYN A;  3OJA B;  4H0L D;  3AEF D;  2R32 A;  1LT9 A;  3LW5 J;  3M91 A;  3VTP C;  1NAF A;  2KZJ A;  2K9J A;  2Y0E A;  4CPG A;  5AW8 B;  1QVF O;  1CW5 A;  2FBW D;  4UB8 H;  4UB8 E;  3MUD A;  1ZRT D;  2FKW B;  1KQL A;  2ZFY A;  4I6L A;  3P8C D;  2QM7 A;  2D2C D;  3KHU A;  2PFX A;  1G1I A;  4YT0 D;  3HE4 B;  1G2C A;  1OVU A;  3CXH I;  1P84 D;  1SQQ K;  2AEJ A;  4H0L C;  3MZW B;  2FYU D;  3BCC J;  3L70 E;  1JEK A;  1Y47 A;  2YNY A;  3KXD A;  2Z5I A;  3W67 A;  2HR3 A;  3P8C E;  5BU5 A;  4OH8 B;  3TSI A;  1IO4 A;  2J59 M;  1PPJ E;  2DW3 A;  3V4Q A;  1HGV A;  3L36 A;  4N6J A;  4W7Z A;  1OZH A;  3V5B A;  1L0N G;  4JYB A;  4YT0 C;  1CZQ A;  2WT7 B;  1Q90 D;  1N7S B;  3B5N D;  2BCC J;  2KK7 A;  1W5C E;  3USS A;  1VF5 B;  5GTH H;  5GTH E;  3CCJ P;  3WUV A;  5AVZ B;  5AW3 B;  2FYN C;  3O8Z A;  2KSJ A;  1SQP G;  1NU1 D;  3AE9 D;  3D6Z A;  5AVU B;  1HF9 A;  3HTK B;  2QE7 H;  2ZVO B;  5APQ A;  3V2N A;  1EXJ A;  1KOR A;  4HKZ H;  2QJY B;  2N9B A;  3B5N A;  2RMZ A;  1BCC E;  3MTU E;  2YMY A;  2Q1K A;  1KB9 D;  2CPB A;  4JBZ A;  3TK1 A;  1LT9 B;  4I7Z C;  3AE9 C;  3H1J E;  1SQV E;  4W7Y A;  1FOS E;  1SQX G;  1KB9 E;  2JO1 A;  3EFG A;  3L70 J;  1EQ7 A;  2QIW A;  1NEN C;  1G2C B;  3N7N A;  1NKZ B;  3CCM P;  3BRT B;  1GW4 A;  1RHZ B;  3K5B A;  1H88 A;  2PAJ A;  3RL0 C;  3EQ2 A;  2BAS A;  2WPS A;  3QWO C;  3L72 G;  1FZC C;  2QEX P;  1LTI C;  3A0B H;  3N4X A;  3A0B E;  2Q5U A;  1KFN A;  1PZQ A;  2JWD A;  2W6A A;  3P7K A;  2D2C B;  1OWA A;  1NYH A;  1AV1 A;  4U3F D;  1XTC C;  3AEG D;  1BE3 D;  3P4P D;  1QLB C;  1J1D C;  1PP9 D;  3CLQ A;  2Q3E A;  2K9Y A;  2AEM A;  3QH9 A;  1HWT C;  2IDB A;  2ZAE B;  2JKV A;  4JPZ B;  1OVR A;  1SFC D;  3PLN A;  3CX5 I;  1AQ5 A;  1PGP A;  5CHX A;  1FJK A;  2KLU A;  2GA1 A;  1BCC J;  2W6J H;  3BCC G;  3CIR C;  3AEG C;  4B86 A;  1FDI A;  3B4S A;  2FXO A;  3AEB D;  3A2A A;  3B5N B;  5C3J D;  1T3J A;  2BEZ F;  3TGU D;  5AVX B;  1NTZ K;  1LNQ A;  3H1J J;  1SFC C;  1VQ6 P;  3E1R A;  1SQV J;  1SFC A;  1KYO D;  2YXR B;  1K05 A;  3Q3D A;  4L73 A;  1S9K D;  1DX7 A;  5KKZ C;  4U7J A;  5KLV J;  2BCC G;  3RK2 D;  1NTK D;  1L4A B;  1BSN A;  5CBN A;  5CCH D;  2K88 A;  5AVV B;  3AE8 D;  1NTM D;  1S9K E;  3NTN A;  1RF0 C;  1RF0 A;  2E5T A;  5AW7 B;  1JY2 P;  2OAR A;  2W90 A;  1NTK E;  2P2U A;  2P58 A;  1FZE A;  3SFD C;  2Z4E A;  2H43 A;  3RK2 C;  2C0X A;  1MZ9 A;  1FZB A;  3WU2 H;  4OGQ D;  3WU2 E;  2H7H A;  1NTM E;  1LWU C;  1LWU A;  1FU1 A;  5CCH A;  4DDI A;  2A06 E;  4Y99 B;  5AW0 B;  3A5T A;  5E79 H;  5E79 E;  1VQL P;  2WU5 D;  3VR9 D;  4UB6 H;  1L0N D;  4UB6 E;  2Q6Q A;  1DD3 A;  3CC7 P;  3GLM A;  5BU8 B;  3IFM A;  4I6M C;  3L70 G;  3G3Z A;  5CMZ A;  4OGQ C;  1IZN B;  1M90 Q;  3S9O A;  1L0N E;  1PPJ G;  4YSX D;  3MD0 A;  4PJ0 H;  4PJ0 E;  3CC4 P;  3Q5S A;  2WU5 C;  2A45 H;  1KV4 A;  4YSZ D;  2XZR A;  1YTZ T;  5KLI C;  1SQP D;  5DJT B;  5C2T D;  3AE1 D;  3E1I A;  1SFC B;  3EFF K;  1FE6 A;  2HG5 D;  5DJU B;  2I1K A;  3AE5 D;  3VOP A;  4R4M A;  3WMM 0;  3R4Y A;  3G9R A;  4WVZ A;  4WBA A;  5L8R J;  2IBZ I;  5H2F H;  3PH0 A;  1K8A Q;  4YSZ C;  5APV A;  2BEQ D;  2N1T D;  1NTK J;  4H13 D;  1ZOY D;  1R8E A;  4DDG A;  1S4X A;  1SQX D;  1E7P C;  1W2E A;  4PD4 I;  2KP8 A;  1BCC G;  1FBM A;  3V2R A;  1NTM J;  3AE5 C;  2XKM A;  4DCK A;  3F89 A;  1VQM P;  1GTW A;  2LXC B;  1IC2 A;  3RK2 B;  4ZNC A;  1T2K C;  1L0L D;  2N1T A;  3H1J G;  1JCC A;  1SQV G;  3U1C A;  4NPD A;  3L72 D;  4H13 C;  1LWU B;  3M9Q A;  2K37 A;  4YXW H;  3GW6 A;  1HTL C;  1EDL A;  5AW5 B;  2E75 C;  1QL1 A;  2YIU C;  5KLV G;  3I55 P;  4JQ0 D;  2CPS A;  2IFM A;  1L0L E;  3RK3 E;  2WMM A;  1YQ3 D;  1QVG O;  3L72 E;  4GOD A;  3CCS P;  4WB4 A;  2GM4 A;  1NAY A;  4OGQ B;  4YTN C;  2E43 A;  1FZA A;  1M57 D;  4C7R A;  3G71 P;  1YJ9 P;  2LKM A;  2WDV D;  2YXQ B;  2IFN A;  1MKM A;  3BCC D;  1ZP0 D;  2M0B A;  4IOI H;  1YQ3 C;  1U7J A;  1N7S D;  2XU6 A;  3AEE C;  1BDC A;  2V7Q H;  2LR2 A;  2POH A;  1NEK C;  1LTA C;  3M0D A;  3P4Q D;  4BWN A;  4D6T G;  3L74 E;  2WSS H;  5APT A;  2HLO A;  1YJW P;  2QG4 A;  2ZVN B;  1ZP0 C;  2BCC D;  2FXM A;  2WT7 A;  1N7S C;  1EZV E;  1N7S A;  3H6P A;  3BVH A;  1VF5 C;  1SQQ E;  2XNX A;  1KF6 D;  1P84 I;  1LT1 A;  2WU2 D;  3Q2Y A;  3KDP B;  1RE3 A;  3NMD A;  3P4Q C;  5AVQ B;  1LTS C;  3L73 E;  1SLQ A;  2RN0 A;  1HH0 A;  4ASW A;  2N1T B;  3ITK A;  2C9N Y;  3HTK A;  2O1K A;  3L37 A;  4QMA A;  4H13 B;  1VQ4 P;  2JR8 A;  2H89 D;  1L0L J;  3AE6 C;  3CMA P;  3H32 A;  1A02 J;  2QJY C;  1SQB K;  3P4R D;  4NPF X;  4XFJ A;  3FX0 A;  1KF6 C;  2P7J A;  3IR9 A;  2ZFC A;  5KAF H;  1LT9 C;  5KAF E;  3AEA D;  1NTK G;  3RBX A;  3P4S D;  1PGJ A;  1KFM A;  2OYI A;  3L70 D;  3FGA D;  4A7P A;  3F5H A;  3MUD C;  1NTM G;  1L2P A;  1EXI A;  4ZKP A;  3ABV D;  2V7Q J;  1J1E B;  2WWW A;  1PPJ D;  5B5E H;  2A06 G;  5B5E E;  1YIJ P;  1IK7 A;  5AVT B;  3G6E P;  3PP5 A;  2L91 A;  2BS3 C;  3AEF C;  1RE4 C;  1RE4 A;  3AEA C;  4GT1 A;  2WP9 D;  2QSI A;  3L74 J;  1KB9 I;  3D70 A;  3I5C A;  1GL2 B;  4KHX A;  4I1L A;  2FBW C;  2W27 A;  3AE4 D;  5APY A;  1HGZ A;  4YSY D;  2JP3 A;  3VR8 D;  1AVO A;  2D2C C;  1LP1 B;  3ABV C;  4JYC A;  3W68 A;  2IZ1 A;  1MFT A;  1SQQ J;  3A7O A;  4NPE A;  2O1J A;  2A45 G;  2E74 D;  3JC2 2;  2SPZ A;  2WP9 C;  4IFF A;  4KX6 D;  1EC5 A;  3C9I A;  3L73 J;  1OX3 A;  2P10 A;  1JO5 A;  4Y28 J;  4IFD K;  1JNM A;  1BCC D;  1S72 P;  2WTY A;  4GOF A;  1GDT A;  1GZL A;  3H32 B;  1L4A D;  3B5N C;  3H1J D;  3S1K A;  4KX6 C;  2Y9Z A;  1SQV D;  4OVN F;  2P67 A;  2AXT H;  2AXT E;  1HBW A;  4LLH A;  4EYY Q;  4EOT A;  3C8V A;  1FZG A;  1KTM A;  3AEC D;  2ZT9 D;  4XA4 A;  5KLV D;  1JTH A;  2XDJ A;  3AE2 D;  2B89 A;  1T3U A;  2RKL A;  2OYI B;  2Y9Y A;  2YKP A;  1L4A C;  1L4A A;  2VRS A;  1PFI A;  5KLV E;  3WUU A;  3CXH H;  3CXH E;  3VMZ A;  2KZI A;  3AEC C;  1KFY D;  2ZT9 C;  1AA0 A;  2FYU K;  4DJG A;  1NTZ E;  2ZXX A;  2XND H;  1L0L G;  4N78 E;  1KYO I;  4RKU J;  1GU5 A;  4R4L A;  1E5W A;  4GOE A;  2R3S A;  4O9B A;  1NHL A;  1X0T A;  3L75 D;  4RO0 A;  2WPV B;  4Y99 C;  1FDO A;  1X9V A;  2K1A A;  3VN0 A;  3O6Q B;  4L75 A;  3KQG A;  1KFY C;  4D6T D;  3GG2 A;  3Q1M A;  3LID A;  2IPP A;  1ZN5 A;  3CPW O;  1KZU B;  1YI2 P;  3VMA A;  5AW4 B;  4WY4 B;  3L75 E;  3H1L E;  1N2D C;  1GW3 A;  4D6T E;  1KIL E;  2WSC H;  1ZR2 A;  1IFN A;  4YTP D;  5KJ7 D;  1NU1 K;  1Q82 Q;  3P4P C;  1OIP A;  1U7M A;  3L74 G;  2E74 B;  1YIT P;  1DIP A;  2GUS A;  5CCG D;  1H89 A;  1EZV G;  5KTB A;  4DHZ A;  3BAT A;  1SQQ G;  1DD4 A;  1JTH B;  1Q81 Q;  4YTP C;  5KJ7 C;  5KJ7 A;  5AVW B;  1GD2 E;  3L73 G;  1MV8 A;  5CCG C;  3AEB C;  5CCG A;  1K73 Q;  1DH3 A;  1NTZ J;  5C3J C;  1S5L X;  4Z1M H;  2Q9I A;  3WUT A;  3T97 A;  2YKO A;  1M8O B;  1IK9 A;  1M1J A;  2ZT9 B;  1RQV A;  2A06 D;  4YPC A;  5TIS H;  5TIS E;  4LGD E;  3SSU A;  3V2Q A;  4RJT A;  1S2E A;  4N3Y B;  3A0H H;  3A0H E;  3TDK A;  5CCH C;  2OGU A;  1JMM A;  3TF5 A;  3AE8 C;  1MUU A;  3AED D;  1LTG C;  1OVV A;  3L75 J;  3H1L J;  1SP4 A;  5BVZ A;  3Q5P A;  4D6T J;  2JJL A;  2WSC J;  1YTZ I;  3VP9 A;  3CX5 H;  4GIF A;  3CL3 D;  1JM0 A;  2QVA A;  3JSV C;  3RGU A;  1NGM B;  2ZJS E;  2JDI H;  2FXP A;  1Z56 A;  5CBO A;  4KT0 J;  5B66 H;  2N9Y B;  4GKG A;  3AED C;  1VQO P;  1JCD A;  3VRB D;  1KIL B;  3VR9 C;  3C1L A;  1VQ5 P;  1EDI A;  4C7N A;  2B76 D;  4AYC A;  1OMI A;  3VMY A;  1EDK A;  2KYV A;  3A3Y B;  2L5G B;  1KC8 Q;  5APX A;  4ASV A;  2FYZ A;  3HE5 B;  1VQK P;  4YSX C;  1YJN P;  4DHJ A;  1JY3 N;  2ZYD A;  1E79 H;  5H2F E;  3VRB C;  2Q7C A;  5C2T C;  3AE1 C;  4HB1 A;  2B76 C;  3T97 B;  3ZDM A;  1ZLL A;  1QGK B;  4HH2 A;  2WS3 D;  1GMJ A;  1M1J B;  3JCU H;  2FY8 A;  1AJY A;  2KNC A;  1N7L A;  3HD7 D;  1W2B O;  3RK3 D;  2N1T C;  2WDR D;  1OW7 A;  1Q7Y Q;  2BS2 C;  3D71 A;  3MIW A;  2W6B A;  1ZOY C;  2KXP B;  1QLE D;  3MHV A;  3AE3 D;  3BRV B;  2WS3 C;  2JEE A;  1L0N K;  3P8M C;  3GMA A;  4IL6 X;  2OYO A;  4C46 A;  1IFP A;  2WIT A;  1SS1 A;  1BSH A;  3HD7 C;  3HD7 A;  1NTZ G;  1L0V D;  3FWL A;  3RK3 C;  3RL0 g;  3CWB E;  3MGN A;  2WDR C;  3L35 A;  2R5B A;  1ZW0 A;  1GL2 D;  5AVY B;  2YMK A;  1LTJ C;  1LTJ A;  1ZR4 A;  1J1E C;  1SQP K;  3L4F A;  1N8R Q;  4C7N B;  1SQB E;  2FFD A;  3L74 D;  1RY3 A;  4DZO A;  4ZKU A;  1IFD A;  1USD A;  3TNU A;  3M0D C;  1EZV D;  2M8R A;  1GL2 C;  5APU A;  1GL2 A;  3H1L G;  3L75 G;  2IBZ E;  1SQQ D;  2WDV C;  1LP1 A;  2KB7 P;  3OW2 O;  2W8Z A;  2NPS B;  4HYT B;  3L73 D;  3U59 A;  1QL2 A;  1SQX K;  1KD1 Q;  4FJV A;  4PD4 H;  1RF1 A;  4PD4 E;  1WRG A;  5AW1 B;  4KJM A;  3VMX A;  2JWA A;  5TJH A;  1RE3 C;  2KNC B;  2QJK B;  1URQ D;  1N86 A;  4PV1 D;  3H1K E;  2ZYG A;  2Y0D A;  1IJD B;  1Y9B A;  3S4R A;  3CWB J;  3IAO A;  2WU2 C;  1JUN A;  4RES B;  1BGY E;  1URQ C;  3FWN A;  3HD7 B;  1URQ A;  1UIX A;  2H88 D;  1CSB A;  4PV1 C;  1FC2 C;  1KQS O;  3RK3 B;  5APW A;  2OYI C;  1VPC A;  1CI6 B;  2E76 D;  2H89 C;  1SQB J;  1K9M Q;  4W80 A;  3FXE A;  2R3C A;  3P4R C;  1UII A;  1LTJ B;  2KUB A;  4JF7 A; 
#chains in the Genus database with same CATH homology
 2OQQ A;  4Z1M H;  2K9Y A;  4YSY D;  1NEN D;  1PV3 A;  4YTM D;  1U57 A;  2JP3 A;  4RKU J;  3VR8 D;  2D2C C;  2WDQ D;  3ABV C;  2IDB A;  3VRB C;  4R4L A;  2FYN C;  1YQ4 D;  2ZT9 B;  5C2T C;  2ACZ C;  1VF5 C;  3AE1 C;  3AE3 C;  2BS4 C;  3SFE D;  1RQV A;  1KF6 D;  2E75 B;  3AE9 D;  2H88 C;  3D6Z A;  2WU5 D;  2WU2 D;  1PL5 A;  2E74 D;  2B76 C;  2NZ2 A;  3VR9 D;  3AEE D;  3Q2Y A;  3P4S C;  3T97 B;  1HF9 A;  2WDV C;  4YXD D;  4H13 C;  2WP9 C;  4KX6 D;  3P4Q C;  1DD3 A;  1NEK D;  2WPV B;  1RQU A;  3GLM A;  2WS3 D;  2QJP C;  1GMJ A;  2E76 C;  1FDO A;  4H44 C;  1KOR A;  3AE5 C;  4TT3 H;  1EXJ A;  3AEF D;  4H0L D;  2E75 C;  1KFY C;  1L0V C;  2YIU C;  3AE2 C;  3LW5 J;  2P10 A;  3VRA D;  1AJY A;  3AE7 D;  3AEG C;  3CIR C;  4Y28 J;  3Q1M A;  3SFD D;  4H13 B;  2H89 D;  4I7Z B;  4OGQ C;  1FDI A;  3AE6 C;  3RK3 E;  2WQY D;  2E76 B;  4H44 B;  2QJY C;  3S9O A;  1YQ3 D;  3AE8 C;  3AEB D;  4YTM C;  3AED D;  3P4R D;  3GF7 A;  2WDQ C;  1ZRT E;  3O6Q A;  5C3J D;  4YSX D;  2BEZ F;  2WSE J;  4XFJ A;  2FBW D;  1YQ4 C;  2WDR D;  1OW7 A;  2BS2 C;  3Q5P A;  3SFE C;  3D71 A;  3Q5S A;  4H0L B;  1ZOY C;  3AE9 C;  4I7Z C;  1KF6 C;  2WU5 C;  4OGQ B;  4YTN C;  1S1C X;  1HJ0 A;  1VL2 A;  2D2C D;  4YSZ D;  5KLI C;  2WSC J;  2G8Y A;  1KIL E;  4YXD C;  4YT0 D;  2J5U A;  1K04 A;  4YTP D;  4PV1 D;  4KX6 C;  1VF5 D;  5C2T D;  3AE3 D;  3AE1 D;  3AEA D;  1K05 A;  2WS3 C;  3Q3D A;  2JO1 A;  3P4P C;  2QJK C;  4H0L C;  5KKZ C;  3GMA A;  3P4S D;  2WDV D;  2QIW A;  3AE4 C;  3C8V A;  2WSF J;  2E74 B;  4IL6 X;  1NGM B;  3VRA C;  4U7J A;  3AE7 C;  5M1B A;  1DIP A;  1KTM A;  3AEC D;  4YSY C;  1NEN C;  4GDO A;  3H25 A;  2FXP A;  2ZT9 D;  1MKM A;  3VR8 C;  1Y9B A;  3FGA D;  1ZP0 D;  4KT0 J;  2E75 D;  3EWK A;  1PIX A;  2WQY C;  1KQG B;  3AE5 D;  1L0V D;  1YQ3 C;  3AE2 D;  4R4M A;  3CIR D;  3R4Y A;  3AED C;  3IAO A;  1JB0 J;  3G9R A;  3RL0 g;  2WU2 C;  2E74 C;  1EXI A;  3VRB D;  3GF3 A;  3VR9 C;  3AEE C;  5L8R J;  2WDR C;  2V7Q J;  3ABV D;  3AE6 D;  1WMK A;  3Q5R A;  2ACZ D;  1IK7 A;  3AE8 D;  1TU3 F;  1DD4 A;  2G3A A;  1NEK C;  4YSZ C;  1UIX A;  2BEQ D;  2O01 J;  2YMK A;  2H88 D;  3B71 A;  2B76 D;  4YT0 C;  2BS3 C;  3AEF C;  4YTP C;  1KQF B;  4PV1 C;  4H13 D;  3AEA C;  1OW8 A;  1OMI A;  2WP9 D;  1ZOY D;  3P4Q D;  4YTN D;  1R8E A;  1Q90 D;  2MKV A;  2QSI A;  3SFD C;  2E76 D;  4H44 D;  3D70 A;  2H89 C;  1ZME C;  1E7P C;  2D2C B;  1KMI Z;  3AEC C;  1KFY D;  1NYH A;  3D6Y A;  1OW6 A;  3AEB C;  2ZT9 C;  3AEG D;  3P4P D;  1QLB C;  3P4R C;  4PV1 B;  1VF5 B;  1ZP0 C;  1S5L X;  5C3J C;  4YSX C;  3IN6 A;  4OGQ D;  2FBW C;  3AE4 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...