4YTPC

Crystal structure of porcine heart mitochondrial complex ii bound with n-[(4-tert-butylphenyl)methyl]-2-(trifluoromethyl)benzamide
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
total genus 52
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2015-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4ytpC01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 4ytpC02
2B76C 3P4PD 3AE9D 3P4QC 3AE3D 4YSXC 3P4PC 3AE3C 3ABVD 4YT0D 1OW6A 3VRBD 3ABVC 4YT0C 1K04A 1KTMA 1NEND 3VR9D 3AE7D 4YTND 1NENC 3VR9C 3AE7C 3AE2D 4YTNC 2WDVC 2WP9D 2WS3D 2WQYD 3AE6D 3AE2C 2WP9C 3AE1D 2WS3C 3AE6C 3P4QD 4YSXD 3AE1C 1NEKD 1NEKC 3AEDD 3AEAD 3AEDC 3AEAC 3AECD 1PV3A 3AECC 4YTPD 2WDVD 1YQ3C 1YQ4D 4YTPC 3CIRD 3SFED 1YQ4C 3AE8D 3CIRC 4YTMC 3SFEC 3AE8C 3AE5D 3AEFD 3P4SD 3AE5C 3AEFC 3P4SC 3S9OA 4KX6D 4YSYD 3AEED 4KX6C 1KFYD 4YSYC 3AEEC 2G3AA 3SFDD 2WDQD 1KFYC 3SFDC 2WDRD 2WDQC 1YQ3D 3AEGC 2H89C 2WDRC 1L0VD 2WU5D 4YTMD 2BS3C 3VRAD 1QLBC 1L0VC 3P4RD 2WU5C 3VRAC 1KF6D 4YXDD 3P4RC 3B71A 2WU2D 1KF6C 3AE9C 4YXDC 2WU2C 2ACZD 4YSZD 1OW7A 1K05A 2ACZC 4YSZC 3AEBD 2H88D 3VRBC 5C3JD 3VR8D 5C2TD 3AEBC 2H88C 3VR8C 5C3JC 5C2TC 3AEGD 2H89D 3AE4D 1E7PC 1ZOYD 2FBWD 1ZP0D 3AE4C 1ZOYC 2FBWC 1ZP0C 2WQYC 2B76D 2BS2C 1OW8A 2BS4C
chains in the Genus database with same CATH superfamily
3AE9D 3I5CA 3P4PC 3H1JG 3AE3C 2OTLP 1JCDA 3CD6P 2B87A 1WT6A 2DW3A 2ZFYA 3P8MC 2W6JH 3H1KE 1BE3G 1JOCA 4H44D 2WS3D 1L4AC 2ZT9C 4I6MC 3FWNA 1SP4A 4YPCA 3CXHE 1OFCX 4BRYA 1YJ9P 1J1DC 1VQOP 3KZIH 1KMIZ 3WU2H 1EC5A 2QEXP 3B5NA 2KS1A 3FXDA 1L0ND 1N7LA 2IBZE 2FFDC 3W68A 3RK3D 3HE4B 1FZCB 3AEED 3CCLP 5AVZB 1VPCA 5H2FH 2M8RA 4R4MA 1W2BO 2KZIA 3H1HD 1SQVD 3RBXA 5KTBA 1M7LA 3UIAA 3L72D 2YKPA 5L8RJ 1TFFA 3H1KG 2WITA 2NZ2A 4RESB 5B66H 5TJHA 3GHGA 4PV1B 4NPDA 4Y99C 1BDCA 1EDLA 2YO2A 1AFOA 3PH0A 1H88A 1YJNP 1KILA 5E79E 3IN6A 3I56P 3Q3DA 2H43A 2Z5IA 2BCCD 2IYOA 3ZDMA 1SQBD 3CCUP 3IR9A 2Y9ZA 1USDA 1CI6A 1H0TB 2HFED 2QJYC 2YKQA 3HD7A 2P2UA 1GL2A 3VR9D 4N78D 1W2EA 3S4RA 1LP1A 1PGPA 1VQLP 1EDJA 4GOFA 4H44C 2WS3C 3RL0g 1FJKA 2B88A 3H1LJ 2K1AA 4LGDE 1L4AB 1BGYJ 2ZT9B 3P8CE 5AW8B 2M5AB 1J1DB 1LJ2A 2E76D 3Q5PA 3WUUA 2C9NY 2A06E 1AQ5A 3AE8D 2L5GB 1R5SA 1GDTA 1JB0J 3U1CA 3RK3C 2FFDB 3QWOC 2P67A 4YSYD 2CPBA 2JR8A 3AEEC 2B9BA 2M3EA 3MUDC 1AVOA 3AEGC 4D6TJ 2WU5D 1NTKK 1BGYE 3M9QA 3FXEA 1NAFA 3CCEP 5AW6B 1RF1A 1EXJA 1OVVA 1JEKA 1G1IA 2A45I 2FXMA 3V2RA 4Y99B 2WSCH 1KN7A 3VMAA 2K9JA 3V4WA 2A06G 1LGHB 2IFMA 5GTIE 3KXDA 3SWFA 1DX7A 4YT0D 2ZXEB 1VQ8P 4D6TE 4K35A 1LNQA 1R5LA 1LTIC 4WY4A 3VR9C 2QJYB 1S72P 1GK4A 3H1LG 2JO1A 4R4LA 2XNDH 1L0LJ 5B5EH 1BGYG 4BWNA 2RKLA 2W27A 3H1IJ 4H44B 3VN0A 2GM4A 4JPZB 2JKVA 4RO0A 2WDVD 1L0LK 3HUSA 2E5YA 1EZVI 2PRRA 2L91A 4UB6E 3LW5J 3V4QA 1JTHA 1KFMA 3AE8C 3P4SD 1KILE 3TDKA 5APYA 4KX6D 3CXHH 1VQKP 2FXOA 4YSYC 2PFXA 2WMMA 2G3AA 4D6TG 5AVVB 3RK3B 1UIXA 2NPSD 2M0BA 1YYCA 3VMYA 1L0LE 3P4RD 2WU5C 5APVA 2K88A 1KF6D 3H1IE 1Y8AA 4DOJA 3MHVA 1SQQJ 2ZFCA 1K05A 1ZRTE 2HODB 3JSVC 2WTYA 1A02J 1FS0E 2OTKE 2KUBA 1IK9A 3B8EB 3A7OA 5AVUB 2KZJA 3R4YA 1HVVA 1SQQK 4DHJA 2H8PD 2KXPB 3A2AA 1VQ5P 3PRJA 1FBMA 3L37A 3F5HA 2OGUA 1HGVA 4YT0C 5M1BA 1JY2O 1X79B 4C7RA 2VRSA 1N2DC 2E42A 2WSFJ 5AW7B 1L0LG 1SQQE 2W6BA 1QEXA 4AYCA 1UIIA 3H1IG 1Q81Q 3WU2E 5CBOA 1RE4A 1NTMJ 1OXZA 1IZNB 4DZOA 1M1JC 1GD2E 1K73Q 2I1JA 1KB9D 1SS1A 3SFED 1USEA 1HJBA 1CZQA 3PLNA 4W7ZA 2WPRA 1NTMK 1P84E 3P4SC 3KPEA 3L73J 1U7MA 3M0AA 4KX6C 2WDQD 2W6AA 2O01N 2BEQD 1PIXA 2NPSC 4TLFA 3O6QA 2WT7A 3TGUJ 5B66E 5CCHD 3BRVB 1SQQG 3P4RC 1PP9J 2LXBA 3GF7A 4NPEA 1NTME 1KF6C 4W7YA 3D6YA 2WSEJ 3MZWB 2SPZA 3GMAA 3IF4A 5BU8B 1FOSF 1OVUA 3JCUE 2H89D 2ZYAA 2HYNA 1NGMB 4OGQD 1LTSC 1MFTA 4PV1D 2AXCA 2J5UA 3L73E 4L73A 1QLED 1N8RQ 1HGZA 4HB1A 3ABVD 1SFCA 1N7SA 4C46A 3L35A 2FY8A 4ZMDA 5KJ7D 2FXPA 4JF7A 1NEND 3V6IA 3TGUE 1X8YA 3S1KA 2E75D 1PP9E 2Y0CA 1FU1A 2Y0EA 3H6PA 1JO5A 4KJMA 5GTIH 1NTMG 2MKVA 2YKOA 4U3FD 3AEAD 5C39A 3PP5A 1PV3A 1VQ9P 1RQUA 3L70D 1GU4A 1S3JA 1YQ3C 2AEMA 3RL0D 3CIRD 4N6JA 1Q7YQ 1M1JB 1M90Q 3SFEC 2HPCA 1Z56A 3L73G 3D70A 3CX5D 5BVZA 1FC2C 5GTHE 1N73C 2N1TD 2IZ0A 3H25A 4GOEA 3M9HA 4U7JA 1VQ4P 4JYBA 2K9YA 2WDQC 1NTZD 3T97A 3HE5B 3TGUG 3VRAD 1PP9G 1EZVG 3M91A 2NPSB 5CCHC 4UB6H 1X22A 1RF0C 3CMAP 3WUTA 3CPWO 3OW2O 2P10A 3H1JD 4DHIB 4I2LC 1G2CA 1ZN5A 1LTAC 2Z4EA 4OGQC 1SLQA 3USSA 4PV1C 2V7QJ 5APTA 1JUNA 1AQTA 2B76D 2AEFA 3H32B 1LTJA 3P4QC 4YSXC 1BE3D 2YNYA 1R8EA 3ABVC 1K04A 5CMZA 5KJ7C 2ZJSE 1E5WA 3GF3A 1NENC 1KV4A 1LTBC 3BCCJ 2E75C 4M3LA 3Q5RA 3LW5H 3VONA 4PD4E 3AEAC 2P58A 1JMBA 1YHQP 5CCGA 4DJGA 2QG4A 1DD3A 3RL0C 3CIRC 1URQA 1XTGB 4RJTA 3SWKA 5K5GB 1KYOE 5KLVJ 1Q90D 1JY2P 3A5TA 2W90A 3H1KD 2LXCB 1GK6A 4WB4A 1X9VA 1K9MQ 4XFJA 2N1TC 3CXHD 3BCCE 2R44A 1OVRA 1N73B 3C1LA 2R3CA 5KLVK 4DDIA 3VRAC 2V4HA 2RN0A 3Q1MA 2YXQB 4LC1A 2IBZD 1GMJA 3KYQA 2H88D 1P84H 5TISE 2FYUJ 3AEGD 2WSFH 1HF9A 5KLVE 3ITKA 2WQYC 1KD1Q 5APQA 2B76C 2Q9IA 3M0DC 3HTKA 4OGQB 2FYUK 2KB7P 2YMKA 3BCCG 3JCUH 3AE1D 1SQXJ 3TF5A 4PJ0E 5KAIH 2KYVA 3V5BA 2E75B 2FYUE 1K8AQ 4IL6X 1SQPJ 2IDBA 1SQXK 3E1RA 2IZ1A 4YTMC 1FAVA 2C0XA 5KLVG 4H0LD 1S2EA 1X0TA 4HKZH 2WSEH 3EFGA 3RL0B 1M56D 1SQPK 1DH3A 4I6LA 3M06A 1Y9BA 1OX3A 2OYHA 4WVZA 1PZQA 2OYIA 5AVRB 1SQXE 1FJPA 1S5LH 3CLQA 2N1TB 3P8CD 1AVYA 1FDMA 1IO4A 3NXSA 1RE3A 4MN4C 1NTKJ 2ACZD 2A06D 1SQPE 2KOGA 1LWUC 2FYUG 1LT9C 4NPFX 5GTHH 2H88C 3WUVA 1IFMA 5AW5B 2FBWD 1KC8Q 3G9RA 3H1LE 1T2KD 4EYYQ 1IFJA 1KB9I 3H1LD 3P7KA 3RBZA 1YI2P 1BGYD 3Q2YA 5AVSB 4DT0A 1SQXG 1H89A 3VP9A 3IFMA 1NTKE 3L4FA 2Q7CA 3CI9A 3AE1C 3FGAD 3B5ND 3L74J 1SQPG 5AVYB 1RQVA 4GDOA 1YQ4D 2B89A 3HE4A 1FZCA 4D6TD 3N7NA 4A7PA 3CC4P 2RMZA 4OWFA 4H0LC 4Z1MH 2WVRA 4I1LA 2NRGA 3VOPA 1GTWA 2R5BA 3L75J 4O9BA 4PD4H 1BCCJ 1ZXGA 1L0VD 3A3YB 2FYNC 1LT1A 2V7QH 2N9BA 1FZEA 2OARA 4Y28J 1NTKG 4FJVA 3E1IA 3L74E 1T6AA 5APXA 1KYOH 1OW7A 3JC22 2ACZC 1MZ9A 4ASVA 1KILD 1N7SB 2POHA 1CSBA 1HTLC 4IFMA 1ZOYD 1FDIA 1LWUB 1LT9B 2FBWC 3M9BA 3OA7A 1H0TA 1T2KC 5EFWB 4KT0J 4AQRD 1OWAA 3A0BE 3HD7D 1L0LD 3L75E 4EDFA 1GL2D 4N3YB 1KTMA 5AVXB 3V2NA 1BCCE 3H1ID 2E5TA 4ZNCA 2LKMA 3AE7D 5TISH 4YTND 1WRGA 1GU5A 3VTPC 3CX5I 1ZRTD 2BEZF 1L4AA 2Z5HA 4DCKA 1JM0A 3CCRP 1HWTC 3L74G 3AEDD 2M5AA 1J1EC 4GKGA 1H8AA 3B5NC 2N9YB 4WBAA 2KNCB 3GW6A 2FFDA 1YQ4C 3TNUA 1KZUB 4C7NB 2QA4P 4PJ0H 3CCJP 1SQQD 3L75G 4H0LB 3CWBJ 3LIDA 3CCSP 1YITP 1BCCG 1YQ3D 3MTUE 1L0VC 1NU1J 2J58A 3B71A 4H13D 5AVWB 5APWA 1EXIA 3VMZA 2FYNB 3GHGC 5KAFE 2FKWB 1OMIA 1NAYA 5C3JD 5C2TD 1NWQA 1P84D 1KILC 1NU1K 1ZOYC 2ZAEB 3N4XA 3MIWA 3I55P 4HJGH 2KP8A 1T3UA 5AW0B 3CWBE 4KHXA 3HD7C 1GL2C 3HRNA 4WY4D 1NTMD 4EI2A 5AVTB 2B87B 1NJIQ 3AE7C 4B86A 2BASA 3AE2D 4YTNC 1NU1E 5KAIE 3P4QD 4YSXD 2W83C 3CXHI 4U3FJ 3PHLA 4LLHA 1YTZT 2XKMA 3RK2B 3AEDC 3L73D 3VMXA 4BRYB 1JY3N 2J59M 2A45G 3B4SA 4L74A 1J1EB 2IBZI 5KLIC 1EZVE 3B5NB 4UB8H 1T3JA 2KS1B 3OJAB 3AE5D 3TGUD 1FDOA 3S9OA 4GODA 1PP9D 3CWBG 1KQLA 1EDIA 1S5LE 2WZ7A 3MUDA 2KSJA 1GW3A 1T8ZA 2JP3A 1NO4A 1NU1G 3CC7P 2E74B 2WU2D 2HODA 3NFQA 4L76A 4H13C 3BASA 4L75A 2XU6A 1RF1C 3G4SP 2KI7B 3VRBC 2GA1A 1M57D 3L36A 3E7KA 5C3JC 5C2TC 3GHGB 1DIPA 1VL2A 2Q5UA 3U1AA 3CMEP 1ZW0A 3L71J 1SVFA 4XE5B 1KILB 3KHUA 1W5CE 3G6EP 2Q1KA 2CK3H 1ZMEC 4ASWA 1CI6B 4WY4C 3HD7B 2LR2A 4K3AA 2WQYD 3AE2C 1GL2B 2R32A 2WWWA 4U3FG 1NVOA 2ZYGA 1PPJE 3NMDA 1QVGO 2UWJE 1LP1B 1J2JB 3PJSK 1VQMP 2O1KA 3A0BH 2YIUB 3II6A 3L71E 3AECD 1DEBA 2QSIA 4YTPD 4DDGA 1MFZA 4WWIA 4EOTA 3HUSC 1RH5B 1HBWA 3W67A 2P7JA 3AE5C 5KLIB 3G3ZA 2M3BA 1L0NJ 1S9KE 1FE6A 2WDRD 3EWKA 1QVFO 4YTMD 4PD4D 1QLBC 2QM8A 2KLUA 1PPJG 1VQNP 2K37A 2WU2C 1L0NK 1TU3F 3MD0A 1PL5A 3AEBD 3H1HJ 1SQVJ 2QJPC 4RKUJ 2D2CD 1KYOD 3L72J 4H13B 3L71G 3C9IA 1FOSE 2AXTE 1RF1B 2ZVNB 1ZP0D 2Y9YA 2G8YA 2ITAA 3VP8A 2P1JA 2W8ZA 3BCCD 4IL6E 1SFCD 1N7SD 3BVHA 1SQVK 2XDJA 3D6ZA 2K9JB 1JMMA 1IJDB 1L0NE 2IFNA 3BATA 1KB9H 5KAFH 2ZXXA 2KLVA 3RK3E 2BCCJ 2A45H 4XA4A 5APSA 2XNXA 1IFIA 1SQBJ 1M8OB 3QH9A 4WY4B 1NEKD 3H1HE 1SQVE 3L72E 5KLVD 1RE4C 2JWDA 1RY3A 1M1JA 1FZAA 3AECC 1SQBK 3CCMP 3U59A 1Q86Q 4YTPC 1DEEG 1YBKA 4ZKPA 1ZR4A 2XV5A 1EQ7A 1ZV8A 1BSHA 1N86A 3BRTB 3TSIA 1AV1A 3HUSB 2HLOA 1JTHB 1L0NG 2BCCE 3CL3D 3HE5A 4IFDK 1SQBE 2Q3EA 2NPSA 2FYUD 2WDRC 2BS3C 2IBZG 1ZR2A 3IAOA 3AE9C 1KORA 3K5BA 4N78E 5CHXA 3H1HG 1SQVG 2OYOA 1Y47A 3L72G 1FZFA 3GG2A 3AEBC 2D2CC 3LIEA 3H32A 3FX0A 3AE4D 2E43A 1U57A 2QJPB 2WSSH 1ZP0C 1YIJP 1OW8A 1SQXD 2OTJP 4AUWA 1SFCC 1N7SC 2QJKC 3V2PA 2QRXA 2BCCG 2QE7H 1SQBG 1SQPD 1QL2A 1IFPA 3R2PA 3CX5H 5AW4B 1IFDA 4HH2A 3CCQP 1NEKC 2OQQA 3MGNA 3TNUB 1A02F 2PGDA 1Q2NA 1JNMA 5APUA 1VF5D 1VQ7P 5CCGD 1VQ6P 4UB8E 1URQD 3RK2D 4GT1A 1BSNA 1P84I 3O8ZA 2K3RA 1N73A 1NTKD 2KSEA 3SFDD 2Y0DA 2JWAA 2WPVB 3SSUA 1NHLA 1Q82Q 1NOHA 2KIKA 3Q5SA 4OH8B 1DD4A 5CCHA 4YSZD 3O6QB 1FZBA 4GIFA 1RF0A 2WT7B 3RGUA 3SWYA 3CCVP 2E74D 2Q6QA 3AE4C 2GUSA 1MV8A 2BS2C 2D2CB 2I1KA 1PFIA 3PTZA 1LTJC 1S1CX 5AW3B 4I7ZC 4IFFA 1JY3O 1YTZI 2O01J 4YXWH 5KJ7A 2R5DA 3L74D 1SFCB 1NKZB 2QJKB 1JCCA 1LTTC 2WPSA 2E76C 2AXTH 1YJWP 1KFNA 2Q3IA 4IL6H 2QVAA 1AA0A 2IYPA 5BU5A 1VF5C 1L2PA 3L75D 5CCGC 2GUVA 1URQC 1BCCD 1BDDA 3RK2C 1KQGB 2O3JA 2H7HA 1QL1A 5AW2B 2JEEA 4BXLA 2HPCB 4TT3H 1KFYD 2N1TA 2HG5D 3SFDC 3A0HE 2JJLA 1VQPP 3EQ2A 2XZRA 3P32A 2C9LY 3T97B 1IFNA 2PP6A 4YSZC 2YXRB 4ZKUA 2ZVOB 4W80A 3MP7B 5CJ0A 2JDIH 2E74C 1GW4A 3F89A 5E79H 2IPPA 5DJTB 1G2CB 1LTGC 1RHZB 3M0DA 1IC2A 1KB9E 3KZIE 5CJ4A 1HUCA 1OW6A 1WMKA 3WMM0 3VRBD 2YO3A 2AEJA 1LTJB 3GLMA 1GZLA 4I7ZB 1XTCC 4OVNF 3G71P 2WDVC 2WP9D 4IOIH 3AE6D 2C0WA 1S4XA 2E76B 5AW1B 5H2FE 3TK1A 1D7MA 1MKMA 4PD4I 2ZYDA 4JBZA 3NTNA 3CWBD 3D71A 1VF5B 3AEFD 1KYOI 2YIUC 1NU1D 2MJZA 1EDKA 1URQB 3KDPB 1KQFB 3L70J 2OYHC 1KFYC 2OYIC 1PGJA 3C8VA 3OAKA 1IK7A 4YXDD 1RE3C 3TYYA 1E79H 2YMYA 1U7JA 1EZVD 1AJYA 2PAJA 4QMAA 1LWUA 3VR8D 5AVQB 4LDTA 1LT9A 3CC2P 3V2QA 1NTZJ 5KKZC 1NKNA 4DHZA 4CPGA 2KK7A 4U3FE 1OZHA 1PGOA 3P4PD 3AE3D 3FWLA 3L70E 1M1KQ 1NTZK 3H1JJ 3HTKB 1NYHA 1HH0A 2IX7C 1L4AD 2ZT9D 3CX5E 2WSCJ 3VYIA 4EIJA 1G1JA 1VDFA 2WP9C 1KQSO 1CW5A 1BE3J 2O1JA 3AE6C 1NTZE 1QGKB 2KNCA 4JQ0D 2I8DA 5DJUB 4JYCA 1JY2N 4C7NA 1FZCC 4HYTB 5AW9B 1FZGA 1JY3P 3H1JE 3AEFC 2QIWA 2QM7A 2R3SA 5CBNA 3L70G 2HR3A 1NH4A 1PPJD 1PGQA 1BE3E 2H89C 1S5LX 2OYHB 2CPSA 3L71D 2OYIB 3H1KJ 1QX8A 4YXDC 3EFFK 1OIPA 2RH0A 1NTZG 2O01H 2WPQA 1MUUA 3VR8C 2FYZA 1ZLLA 1E7PC 5B5EE 3A0HH 1HJ0A 5KKZB 3KQGA 1S9KD 2BS4C
chains in the Genus database with same CATH topology
2B76C 3P4PD 4KT0J 3AE9D 3AE3D 1S1CX 3P4QC 4YSXC 3D6ZA 3P4PC 4I7ZC 1R8EA 3AE3C 3ABVD 4OGQB 4YT0D 1OW6A 1WMKA 2QJKC 2QJYC 3VRBD 3ABVC 1ZMEC 4YT0C 1K04A 1KTMA 3GLMA 5M1BA 2O01J 2FXPA 1NEND 3VR9D 4I7ZB 3AE7D 1NYHA 3RK3E 3Q2YA 4YTND 2YMKA 3GF3A 1NENC 3VR9C 3AE7C 2ZT9D 2E75D 3AE2D 4YTNC 2WDVC 2WP9D 2E76C 2WSFJ 2WSCJ 4H44D 2WS3D 2BEZF 2ZT9C 2E75C 3AE2C 3Q5RA 2WQYD 3AE6D 2WP9C 3AE1D 4H44C 2WS3C 2JO1A 3AE6C 3P4QD 4R4LA 4YSXD 3RL0g 3AE1C 1NEKD 3FGAD 2E76B 1NEKC 2OQQA 2ZT9B 2E75B 3AEDD 2MKVA 1MKMA 4H44B 3AEAD 3AEDC 4IL6X 1KMIZ 3AEAC 1VF5D 3AECD 1PV3A 2QSIA 3AECC 1VF5C 2IDBA 4YTPD 1RQUA 1RQVA 2WDVD 1YQ3C 2E76D 4GDOA 1YQ4D 4YTPC 3Q5PA 3CIRD 3SFED 5KLIC 1YQ4C 1DD3A 3AE8D 3CIRC 4YTMC 3SFEC 3D71A 3LW5J 4H0LD 1VF5B 1JB0J 3AE8C 3AE5D 3AEFD 3P4SD 1KQGB 1KILE 4H0LC 1Q90D 3AE5C 2QIWA 1FDOA 2YIUC 3AEFC 4Z1MH 3D70A 3P4SC 3S9OA 4KX6D 4YSYD 3AEED 4KX6C 3H25A 4XFJA 4TT3H 1KFYD 4YSYC 3AEEC 4U7JA 2G3AA 1KQFB 1Y9BA 4H0LB 4R4MA 2WDQD 3SFDD 1KFYC 1UIXA 3SFDC 2K9YA 2WDQC 2WPVB 1YQ3D 3EWKA 2WDRD 3AEGC 2BEQD 1PIXA 2H89C 3C8VA 2WDRC 2JP3A 1L0VD 5L8RJ 2FYNC 2WU5D 2BS3C 1S5LX 4YTMD 3VRAD 1QLBC 3O6QA 1L0VC 3P4RD 2WU5C 3Q5SA 3VRAC 1IK7A 1KF6D 4Y28J 4YXDD 2NZ2A 2E74B 3P4RC 3IAOA 3B71A 3GF7A 4H13D 3T97B 2WU2D 1KF6C 3Q1MA 3AE9C 4YXDC 1DD4A 1KORA 1EXIA 4H13C 2ACZD 2WU2C 4PV1B 3D6YA 4YSZD 1OMIA 2WSEJ 1GMJA 1OW7A 1TU3F 1K05A 1AJYA 2ACZC 4YSZC 1PL5A 1ZRTE 2H88D 3AEBD 1EXJA 3VRBC 3GMAA 5C3JD 3VR8D 2QJPC 5C2TD 4RKUJ 2D2CD 3AEBC 2H88C 2P10A 3VR8C 5C3JC 5C2TC 4H13B 2D2CC 2E74D 5KKZC 2H89D 3AEGD 1DIPA 1VL2A 3AE4D 1E7PC 3IN6A 1FDIA 2E74C 3Q3DA 1NGMB 4OGQD 1ZOYD 2FBWD 1ZP0D 1U57A 3AE4C 3G9RA 4PV1D 1HF9A 1ZOYC 2G8YA 2FBWC 2J5UA 3R4YA 4OGQC 1ZP0C 4PV1C 2V7QJ 2WQYC 2B76D 2BS2C 1HJ0A 2D2CB 1OW8A 2BS4C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B76 C;  3P4P D;  3AE9 D;  3P4Q C;  3AE3 D;  4YSX C;  3P4P C;  3AE3 C;  3ABV D;  4YT0 D;  1OW6 A;  3VRB D;  3ABV C;  4YT0 C;  1K04 A;  1KTM A;  1NEN D;  3VR9 D;  3AE7 D;  4YTN D;  1NEN C;  3VR9 C;  3AE7 C;  3AE2 D;  4YTN C;  2WDV C;  2WP9 D;  2WS3 D;  2WQY D;  3AE6 D;  3AE2 C;  2WP9 C;  3AE1 D;  2WS3 C;  3AE6 C;  3P4Q D;  4YSX D;  3AE1 C;  1NEK D;  1NEK C;  3AED D;  3AEA D;  3AED C;  3AEA C;  3AEC D;  1PV3 A;  3AEC C;  4YTP D;  2WDV D;  1YQ3 C;  1YQ4 D;  4YTP C;  3CIR D;  3SFE D;  1YQ4 C;  3AE8 D;  3CIR C;  4YTM C;  3SFE C;  3AE8 C;  3AE5 D;  3AEF D;  3P4S D;  3AE5 C;  3AEF C;  3P4S C;  3S9O A;  4KX6 D;  4YSY D;  3AEE D;  4KX6 C;  1KFY D;  4YSY C;  3AEE C;  2G3A A;  3SFD D;  2WDQ D;  1KFY C;  3SFD C;  2WDR D;  2WDQ C;  1YQ3 D;  3AEG C;  2H89 C;  2WDR C;  1L0V D;  2WU5 D;  4YTM D;  2BS3 C;  3VRA D;  1QLB C;  1L0V C;  3P4R D;  2WU5 C;  3VRA C;  1KF6 D;  4YXD D;  3P4R C;  3B71 A;  2WU2 D;  1KF6 C;  3AE9 C;  4YXD C;  2WU2 C;  2ACZ D;  4YSZ D;  1OW7 A;  1K05 A;  2ACZ C;  4YSZ C;  3AEB D;  2H88 D;  3VRB C;  5C3J D;  3VR8 D;  5C2T D;  3AEB C;  2H88 C;  3VR8 C;  5C3J C;  5C2T C;  3AEG D;  2H89 D;  3AE4 D;  1E7P C;  1ZOY D;  2FBW D;  1ZP0 D;  3AE4 C;  1ZOY C;  2FBW C;  1ZP0 C;  2WQY C;  2B76 D;  2BS2 C;  1OW8 A;  2BS4 C; 
#chains in the Genus database with same CATH topology
 3AE9 D;  3I5C A;  3P4P C;  3H1J G;  3AE3 C;  2OTL P;  1JCD A;  3CD6 P;  2B87 A;  1WT6 A;  2DW3 A;  2ZFY A;  3P8M C;  2W6J H;  3H1K E;  1BE3 G;  1JOC A;  4H44 D;  2WS3 D;  1L4A C;  2ZT9 C;  4I6M C;  3FWN A;  1SP4 A;  4YPC A;  3CXH E;  1OFC X;  4BRY A;  1YJ9 P;  1J1D C;  1VQO P;  3KZI H;  1KMI Z;  3WU2 H;  1EC5 A;  2QEX P;  3B5N A;  2KS1 A;  3FXD A;  1L0N D;  1N7L A;  2IBZ E;  2FFD C;  3W68 A;  3RK3 D;  3HE4 B;  1FZC B;  3AEE D;  3CCL P;  5AVZ B;  1VPC A;  5H2F H;  2M8R A;  4R4M A;  1W2B O;  2KZI A;  3H1H D;  1SQV D;  3RBX A;  5KTB A;  1M7L A;  3UIA A;  3L72 D;  2YKP A;  5L8R J;  1TFF A;  3H1K G;  2WIT A;  2NZ2 A;  4RES B;  5B66 H;  5TJH A;  3GHG A;  4PV1 B;  4NPD A;  4Y99 C;  1BDC A;  1EDL A;  2YO2 A;  1AFO A;  3PH0 A;  1H88 A;  1YJN P;  1KIL A;  5E79 E;  3IN6 A;  3I56 P;  3Q3D A;  2H43 A;  2Z5I A;  2BCC D;  2IYO A;  3ZDM A;  1SQB D;  3CCU P;  3IR9 A;  2Y9Z A;  1USD A;  1CI6 A;  1H0T B;  2HFE D;  2QJY C;  2YKQ A;  3HD7 A;  2P2U A;  1GL2 A;  3VR9 D;  4N78 D;  1W2E A;  3S4R A;  1LP1 A;  1PGP A;  1VQL P;  1EDJ A;  4GOF A;  4H44 C;  2WS3 C;  3RL0 g;  1FJK A;  2B88 A;  3H1L J;  2K1A A;  4LGD E;  1L4A B;  1BGY J;  2ZT9 B;  3P8C E;  5AW8 B;  2M5A B;  1J1D B;  1LJ2 A;  2E76 D;  3Q5P A;  3WUU A;  2C9N Y;  2A06 E;  1AQ5 A;  3AE8 D;  2L5G B;  1R5S A;  1GDT A;  1JB0 J;  3U1C A;  3RK3 C;  2FFD B;  3QWO C;  2P67 A;  4YSY D;  2CPB A;  2JR8 A;  3AEE C;  2B9B A;  2M3E A;  3MUD C;  1AVO A;  3AEG C;  4D6T J;  2WU5 D;  1NTK K;  1BGY E;  3M9Q A;  3FXE A;  1NAF A;  3CCE P;  5AW6 B;  1RF1 A;  1EXJ A;  1OVV A;  1JEK A;  1G1I A;  2A45 I;  2FXM A;  3V2R A;  4Y99 B;  2WSC H;  1KN7 A;  3VMA A;  2K9J A;  3V4W A;  2A06 G;  1LGH B;  2IFM A;  5GTI E;  3KXD A;  3SWF A;  1DX7 A;  4YT0 D;  2ZXE B;  1VQ8 P;  4D6T E;  4K35 A;  1LNQ A;  1R5L A;  1LTI C;  4WY4 A;  3VR9 C;  2QJY B;  1S72 P;  1GK4 A;  3H1L G;  2JO1 A;  4R4L A;  2XND H;  1L0L J;  5B5E H;  1BGY G;  4BWN A;  2RKL A;  2W27 A;  3H1I J;  4H44 B;  3VN0 A;  2GM4 A;  4JPZ B;  2JKV A;  4RO0 A;  2WDV D;  1L0L K;  3HUS A;  2E5Y A;  1EZV I;  2PRR A;  2L91 A;  4UB6 E;  3LW5 J;  3V4Q A;  1JTH A;  1KFM A;  3AE8 C;  3P4S D;  1KIL E;  3TDK A;  5APY A;  4KX6 D;  3CXH H;  1VQK P;  2FXO A;  4YSY C;  2PFX A;  2WMM A;  2G3A A;  4D6T G;  5AVV B;  3RK3 B;  1UIX A;  2NPS D;  2M0B A;  1YYC A;  3VMY A;  1L0L E;  3P4R D;  2WU5 C;  5APV A;  2K88 A;  1KF6 D;  3H1I E;  1Y8A A;  4DOJ A;  3MHV A;  1SQQ J;  2ZFC A;  1K05 A;  1ZRT E;  2HOD B;  3JSV C;  2WTY A;  1A02 J;  1FS0 E;  2OTK E;  2KUB A;  1IK9 A;  3B8E B;  3A7O A;  5AVU B;  2KZJ A;  3R4Y A;  1HVV A;  1SQQ K;  4DHJ A;  2H8P D;  2KXP B;  3A2A A;  1VQ5 P;  3PRJ A;  1FBM A;  3L37 A;  3F5H A;  2OGU A;  1HGV A;  4YT0 C;  5M1B A;  1JY2 O;  1X79 B;  4C7R A;  2VRS A;  1N2D C;  2E42 A;  2WSF J;  5AW7 B;  1L0L G;  1SQQ E;  2W6B A;  1QEX A;  4AYC A;  1UII A;  3H1I G;  1Q81 Q;  3WU2 E;  5CBO A;  1RE4 A;  1NTM J;  1OXZ A;  1IZN B;  4DZO A;  1M1J C;  1GD2 E;  1K73 Q;  2I1J A;  1KB9 D;  1SS1 A;  3SFE D;  1USE A;  1HJB A;  1CZQ A;  3PLN A;  4W7Z A;  2WPR A;  1NTM K;  1P84 E;  3P4S C;  3KPE A;  3L73 J;  1U7M A;  3M0A A;  4KX6 C;  2WDQ D;  2W6A A;  2O01 N;  2BEQ D;  1PIX A;  2NPS C;  4TLF A;  3O6Q A;  2WT7 A;  3TGU J;  5B66 E;  5CCH D;  3BRV B;  1SQQ G;  3P4R C;  1PP9 J;  2LXB A;  3GF7 A;  4NPE A;  1NTM E;  1KF6 C;  4W7Y A;  3D6Y A;  2WSE J;  3MZW B;  2SPZ A;  3GMA A;  3IF4 A;  5BU8 B;  1FOS F;  1OVU A;  3JCU E;  2H89 D;  2ZYA A;  2HYN A;  1NGM B;  4OGQ D;  1LTS C;  1MFT A;  4PV1 D;  2AXC A;  2J5U A;  3L73 E;  4L73 A;  1QLE D;  1N8R Q;  1HGZ A;  4HB1 A;  3ABV D;  1SFC A;  1N7S A;  4C46 A;  3L35 A;  2FY8 A;  4ZMD A;  5KJ7 D;  2FXP A;  4JF7 A;  1NEN D;  3V6I A;  3TGU E;  1X8Y A;  3S1K A;  2E75 D;  1PP9 E;  2Y0C A;  1FU1 A;  2Y0E A;  3H6P A;  1JO5 A;  4KJM A;  5GTI H;  1NTM G;  2MKV A;  2YKO A;  4U3F D;  3AEA D;  5C39 A;  3PP5 A;  1PV3 A;  1VQ9 P;  1RQU A;  3L70 D;  1GU4 A;  1S3J A;  1YQ3 C;  2AEM A;  3RL0 D;  3CIR D;  4N6J A;  1Q7Y Q;  1M1J B;  1M90 Q;  3SFE C;  2HPC A;  1Z56 A;  3L73 G;  3D70 A;  3CX5 D;  5BVZ A;  1FC2 C;  5GTH E;  1N73 C;  2N1T D;  2IZ0 A;  3H25 A;  4GOE A;  3M9H A;  4U7J A;  1VQ4 P;  4JYB A;  2K9Y A;  2WDQ C;  1NTZ D;  3T97 A;  3HE5 B;  3TGU G;  3VRA D;  1PP9 G;  1EZV G;  3M91 A;  2NPS B;  5CCH C;  4UB6 H;  1X22 A;  1RF0 C;  3CMA P;  3WUT A;  3CPW O;  3OW2 O;  2P10 A;  3H1J D;  4DHI B;  4I2L C;  1G2C A;  1ZN5 A;  1LTA C;  2Z4E A;  4OGQ C;  1SLQ A;  3USS A;  4PV1 C;  2V7Q J;  5APT A;  1JUN A;  1AQT A;  2B76 D;  2AEF A;  3H32 B;  1LTJ A;  3P4Q C;  4YSX C;  1BE3 D;  2YNY A;  1R8E A;  3ABV C;  1K04 A;  5CMZ A;  5KJ7 C;  2ZJS E;  1E5W A;  3GF3 A;  1NEN C;  1KV4 A;  1LTB C;  3BCC J;  2E75 C;  4M3L A;  3Q5R A;  3LW5 H;  3VON A;  4PD4 E;  3AEA C;  2P58 A;  1JMB A;  1YHQ P;  5CCG A;  4DJG A;  2QG4 A;  1DD3 A;  3RL0 C;  3CIR C;  1URQ A;  1XTG B;  4RJT A;  3SWK A;  5K5G B;  1KYO E;  5KLV J;  1Q90 D;  1JY2 P;  3A5T A;  2W90 A;  3H1K D;  2LXC B;  1GK6 A;  4WB4 A;  1X9V A;  1K9M Q;  4XFJ A;  2N1T C;  3CXH D;  3BCC E;  2R44 A;  1OVR A;  1N73 B;  3C1L A;  2R3C A;  5KLV K;  4DDI A;  3VRA C;  2V4H A;  2RN0 A;  3Q1M A;  2YXQ B;  4LC1 A;  2IBZ D;  1GMJ A;  3KYQ A;  2H88 D;  1P84 H;  5TIS E;  2FYU J;  3AEG D;  2WSF H;  1HF9 A;  5KLV E;  3ITK A;  2WQY C;  1KD1 Q;  5APQ A;  2B76 C;  2Q9I A;  3M0D C;  3HTK A;  4OGQ B;  2FYU K;  2KB7 P;  2YMK A;  3BCC G;  3JCU H;  3AE1 D;  1SQX J;  3TF5 A;  4PJ0 E;  5KAI H;  2KYV A;  3V5B A;  2E75 B;  2FYU E;  1K8A Q;  4IL6 X;  1SQP J;  2IDB A;  1SQX K;  3E1R A;  2IZ1 A;  4YTM C;  1FAV A;  2C0X A;  5KLV G;  4H0L D;  1S2E A;  1X0T A;  4HKZ H;  2WSE H;  3EFG A;  3RL0 B;  1M56 D;  1SQP K;  1DH3 A;  4I6L A;  3M06 A;  1Y9B A;  1OX3 A;  2OYH A;  4WVZ A;  1PZQ A;  2OYI A;  5AVR B;  1SQX E;  1FJP A;  1S5L H;  3CLQ A;  2N1T B;  3P8C D;  1AVY A;  1FDM A;  1IO4 A;  3NXS A;  1RE3 A;  4MN4 C;  1NTK J;  2ACZ D;  2A06 D;  1SQP E;  2KOG A;  1LWU C;  2FYU G;  1LT9 C;  4NPF X;  5GTH H;  2H88 C;  3WUV A;  1IFM A;  5AW5 B;  2FBW D;  1KC8 Q;  3G9R A;  3H1L E;  1T2K D;  4EYY Q;  1IFJ A;  1KB9 I;  3H1L D;  3P7K A;  3RBZ A;  1YI2 P;  1BGY D;  3Q2Y A;  5AVS B;  4DT0 A;  1SQX G;  1H89 A;  3VP9 A;  3IFM A;  1NTK E;  3L4F A;  2Q7C A;  3CI9 A;  3AE1 C;  3FGA D;  3B5N D;  3L74 J;  1SQP G;  5AVY B;  1RQV A;  4GDO A;  1YQ4 D;  2B89 A;  3HE4 A;  1FZC A;  4D6T D;  3N7N A;  4A7P A;  3CC4 P;  2RMZ A;  4OWF A;  4H0L C;  4Z1M H;  2WVR A;  4I1L A;  2NRG A;  3VOP A;  1GTW A;  2R5B A;  3L75 J;  4O9B A;  4PD4 H;  1BCC J;  1ZXG A;  1L0V D;  3A3Y B;  2FYN C;  1LT1 A;  2V7Q H;  2N9B A;  1FZE A;  2OAR A;  4Y28 J;  1NTK G;  4FJV A;  3E1I A;  3L74 E;  1T6A A;  5APX A;  1KYO H;  1OW7 A;  3JC2 2;  2ACZ C;  1MZ9 A;  4ASV A;  1KIL D;  1N7S B;  2POH A;  1CSB A;  1HTL C;  4IFM A;  1ZOY D;  1FDI A;  1LWU B;  1LT9 B;  2FBW C;  3M9B A;  3OA7 A;  1H0T A;  1T2K C;  5EFW B;  4KT0 J;  4AQR D;  1OWA A;  3A0B E;  3HD7 D;  1L0L D;  3L75 E;  4EDF A;  1GL2 D;  4N3Y B;  1KTM A;  5AVX B;  3V2N A;  1BCC E;  3H1I D;  2E5T A;  4ZNC A;  2LKM A;  3AE7 D;  5TIS H;  4YTN D;  1WRG A;  1GU5 A;  3VTP C;  3CX5 I;  1ZRT D;  2BEZ F;  1L4A A;  2Z5H A;  4DCK A;  1JM0 A;  3CCR P;  1HWT C;  3L74 G;  3AED D;  2M5A A;  1J1E C;  4GKG A;  1H8A A;  3B5N C;  2N9Y B;  4WBA A;  2KNC B;  3GW6 A;  2FFD A;  1YQ4 C;  3TNU A;  1KZU B;  4C7N B;  2QA4 P;  4PJ0 H;  3CCJ P;  1SQQ D;  3L75 G;  4H0L B;  3CWB J;  3LID A;  3CCS P;  1YIT P;  1BCC G;  1YQ3 D;  3MTU E;  1L0V C;  1NU1 J;  2J58 A;  3B71 A;  4H13 D;  5AVW B;  5APW A;  1EXI A;  3VMZ A;  2FYN B;  3GHG C;  5KAF E;  2FKW B;  1OMI A;  1NAY A;  5C3J D;  5C2T D;  1NWQ A;  1P84 D;  1KIL C;  1NU1 K;  1ZOY C;  2ZAE B;  3N4X A;  3MIW A;  3I55 P;  4HJG H;  2KP8 A;  1T3U A;  5AW0 B;  3CWB E;  4KHX A;  3HD7 C;  1GL2 C;  3HRN A;  4WY4 D;  1NTM D;  4EI2 A;  5AVT B;  2B87 B;  1NJI Q;  3AE7 C;  4B86 A;  2BAS A;  3AE2 D;  4YTN C;  1NU1 E;  5KAI E;  3P4Q D;  4YSX D;  2W83 C;  3CXH I;  4U3F J;  3PHL A;  4LLH A;  1YTZ T;  2XKM A;  3RK2 B;  3AED C;  3L73 D;  3VMX A;  4BRY B;  1JY3 N;  2J59 M;  2A45 G;  3B4S A;  4L74 A;  1J1E B;  2IBZ I;  5KLI C;  1EZV E;  3B5N B;  4UB8 H;  1T3J A;  2KS1 B;  3OJA B;  3AE5 D;  3TGU D;  1FDO A;  3S9O A;  4GOD A;  1PP9 D;  3CWB G;  1KQL A;  1EDI A;  1S5L E;  2WZ7 A;  3MUD A;  2KSJ A;  1GW3 A;  1T8Z A;  2JP3 A;  1NO4 A;  1NU1 G;  3CC7 P;  2E74 B;  2WU2 D;  2HOD A;  3NFQ A;  4L76 A;  4H13 C;  3BAS A;  4L75 A;  2XU6 A;  1RF1 C;  3G4S P;  2KI7 B;  3VRB C;  2GA1 A;  1M57 D;  3L36 A;  3E7K A;  5C3J C;  5C2T C;  3GHG B;  1DIP A;  1VL2 A;  2Q5U A;  3U1A A;  3CME P;  1ZW0 A;  3L71 J;  1SVF A;  4XE5 B;  1KIL B;  3KHU A;  1W5C E;  3G6E P;  2Q1K A;  2CK3 H;  1ZME C;  4ASW A;  1CI6 B;  4WY4 C;  3HD7 B;  2LR2 A;  4K3A A;  2WQY D;  3AE2 C;  1GL2 B;  2R32 A;  2WWW A;  4U3F G;  1NVO A;  2ZYG A;  1PPJ E;  3NMD A;  1QVG O;  2UWJ E;  1LP1 B;  1J2J B;  3PJS K;  1VQM P;  2O1K A;  3A0B H;  2YIU B;  3II6 A;  3L71 E;  3AEC D;  1DEB A;  2QSI A;  4YTP D;  4DDG A;  1MFZ A;  4WWI A;  4EOT A;  3HUS C;  1RH5 B;  1HBW A;  3W67 A;  2P7J A;  3AE5 C;  5KLI B;  3G3Z A;  2M3B A;  1L0N J;  1S9K E;  1FE6 A;  2WDR D;  3EWK A;  1QVF O;  4YTM D;  4PD4 D;  1QLB C;  2QM8 A;  2KLU A;  1PPJ G;  1VQN P;  2K37 A;  2WU2 C;  1L0N K;  1TU3 F;  3MD0 A;  1PL5 A;  3AEB D;  3H1H J;  1SQV J;  2QJP C;  4RKU J;  2D2C D;  1KYO D;  3L72 J;  4H13 B;  3L71 G;  3C9I A;  1FOS E;  2AXT E;  1RF1 B;  2ZVN B;  1ZP0 D;  2Y9Y A;  2G8Y A;  2ITA A;  3VP8 A;  2P1J A;  2W8Z A;  3BCC D;  4IL6 E;  1SFC D;  1N7S D;  3BVH A;  1SQV K;  2XDJ A;  3D6Z A;  2K9J B;  1JMM A;  1IJD B;  1L0N E;  2IFN A;  3BAT A;  1KB9 H;  5KAF H;  2ZXX A;  2KLV A;  3RK3 E;  2BCC J;  2A45 H;  4XA4 A;  5APS A;  2XNX A;  1IFI A;  1SQB J;  1M8O B;  3QH9 A;  4WY4 B;  1NEK D;  3H1H E;  1SQV E;  3L72 E;  5KLV D;  1RE4 C;  2JWD A;  1RY3 A;  1M1J A;  1FZA A;  3AEC C;  1SQB K;  3CCM P;  3U59 A;  1Q86 Q;  4YTP C;  1DEE G;  1YBK A;  4ZKP A;  1ZR4 A;  2XV5 A;  1EQ7 A;  1ZV8 A;  1BSH A;  1N86 A;  3BRT B;  3TSI A;  1AV1 A;  3HUS B;  2HLO A;  1JTH B;  1L0N G;  2BCC E;  3CL3 D;  3HE5 A;  4IFD K;  1SQB E;  2Q3E A;  2NPS A;  2FYU D;  2WDR C;  2BS3 C;  2IBZ G;  1ZR2 A;  3IAO A;  3AE9 C;  1KOR A;  3K5B A;  4N78 E;  5CHX A;  3H1H G;  1SQV G;  2OYO A;  1Y47 A;  3L72 G;  1FZF A;  3GG2 A;  3AEB C;  2D2C C;  3LIE A;  3H32 A;  3FX0 A;  3AE4 D;  2E43 A;  1U57 A;  2QJP B;  2WSS H;  1ZP0 C;  1YIJ P;  1OW8 A;  1SQX D;  2OTJ P;  4AUW A;  1SFC C;  1N7S C;  2QJK C;  3V2P A;  2QRX A;  2BCC G;  2QE7 H;  1SQB G;  1SQP D;  1QL2 A;  1IFP A;  3R2P A;  3CX5 H;  5AW4 B;  1IFD A;  4HH2 A;  3CCQ P;  1NEK C;  2OQQ A;  3MGN A;  3TNU B;  1A02 F;  2PGD A;  1Q2N A;  1JNM A;  5APU A;  1VF5 D;  1VQ7 P;  5CCG D;  1VQ6 P;  4UB8 E;  1URQ D;  3RK2 D;  4GT1 A;  1BSN A;  1P84 I;  3O8Z A;  2K3R A;  1N73 A;  1NTK D;  2KSE A;  3SFD D;  2Y0D A;  2JWA A;  2WPV B;  3SSU A;  1NHL A;  1Q82 Q;  1NOH A;  2KIK A;  3Q5S A;  4OH8 B;  1DD4 A;  5CCH A;  4YSZ D;  3O6Q B;  1FZB A;  4GIF A;  1RF0 A;  2WT7 B;  3RGU A;  3SWY A;  3CCV P;  2E74 D;  2Q6Q A;  3AE4 C;  2GUS A;  1MV8 A;  2BS2 C;  2D2C B;  2I1K A;  1PFI A;  3PTZ A;  1LTJ C;  1S1C X;  5AW3 B;  4I7Z C;  4IFF A;  1JY3 O;  1YTZ I;  2O01 J;  4YXW H;  5KJ7 A;  2R5D A;  3L74 D;  1SFC B;  1NKZ B;  2QJK B;  1JCC A;  1LTT C;  2WPS A;  2E76 C;  2AXT H;  1YJW P;  1KFN A;  2Q3I A;  4IL6 H;  2QVA A;  1AA0 A;  2IYP A;  5BU5 A;  1VF5 C;  1L2P A;  3L75 D;  5CCG C;  2GUV A;  1URQ C;  1BCC D;  1BDD A;  3RK2 C;  1KQG B;  2O3J A;  2H7H A;  1QL1 A;  5AW2 B;  2JEE A;  4BXL A;  2HPC B;  4TT3 H;  1KFY D;  2N1T A;  2HG5 D;  3SFD C;  3A0H E;  2JJL A;  1VQP P;  3EQ2 A;  2XZR A;  3P32 A;  2C9L Y;  3T97 B;  1IFN A;  2PP6 A;  4YSZ C;  2YXR B;  4ZKU A;  2ZVO B;  4W80 A;  3MP7 B;  5CJ0 A;  2JDI H;  2E74 C;  1GW4 A;  3F89 A;  5E79 H;  2IPP A;  5DJT B;  1G2C B;  1LTG C;  1RHZ B;  3M0D A;  1IC2 A;  1KB9 E;  3KZI E;  5CJ4 A;  1HUC A;  1OW6 A;  1WMK A;  3WMM 0;  3VRB D;  2YO3 A;  2AEJ A;  1LTJ B;  3GLM A;  1GZL A;  4I7Z B;  1XTC C;  4OVN F;  3G71 P;  2WDV C;  2WP9 D;  4IOI H;  3AE6 D;  2C0W A;  1S4X A;  2E76 B;  5AW1 B;  5H2F E;  3TK1 A;  1D7M A;  1MKM A;  4PD4 I;  2ZYD A;  4JBZ A;  3NTN A;  3CWB D;  3D71 A;  1VF5 B;  3AEF D;  1KYO I;  2YIU C;  1NU1 D;  2MJZ A;  1EDK A;  1URQ B;  3KDP B;  1KQF B;  3L70 J;  2OYH C;  1KFY C;  2OYI C;  1PGJ A;  3C8V A;  3OAK A;  1IK7 A;  4YXD D;  1RE3 C;  3TYY A;  1E79 H;  2YMY A;  1U7J A;  1EZV D;  1AJY A;  2PAJ A;  4QMA A;  1LWU A;  3VR8 D;  5AVQ B;  4LDT A;  1LT9 A;  3CC2 P;  3V2Q A;  1NTZ J;  5KKZ C;  1NKN A;  4DHZ A;  4CPG A;  2KK7 A;  4U3F E;  1OZH A;  1PGO A;  3P4P D;  3AE3 D;  3FWL A;  3L70 E;  1M1K Q;  1NTZ K;  3H1J J;  3HTK B;  1NYH A;  1HH0 A;  2IX7 C;  1L4A D;  2ZT9 D;  3CX5 E;  2WSC J;  3VYI A;  4EIJ A;  1G1J A;  1VDF A;  2WP9 C;  1KQS O;  1CW5 A;  1BE3 J;  2O1J A;  3AE6 C;  1NTZ E;  1QGK B;  2KNC A;  4JQ0 D;  2I8D A;  5DJU B;  4JYC A;  1JY2 N;  4C7N A;  1FZC C;  4HYT B;  5AW9 B;  1FZG A;  1JY3 P;  3H1J E;  3AEF C;  2QIW A;  2QM7 A;  2R3S A;  5CBN A;  3L70 G;  2HR3 A;  1NH4 A;  1PPJ D;  1PGQ A;  1BE3 E;  2H89 C;  1S5L X;  2OYH B;  2CPS A;  3L71 D;  2OYI B;  3H1K J;  1QX8 A;  4YXD C;  3EFF K;  1OIP A;  2RH0 A;  1NTZ G;  2O01 H;  2WPQ A;  1MUU A;  3VR8 C;  2FYZ A;  1ZLL A;  1E7P C;  5B5E E;  3A0H H;  1HJ0 A;  5KKZ B;  3KQG A;  1S9K D;  2BS4 C; 
#chains in the Genus database with same CATH homology
 2B76 C;  3P4P D;  4KT0 J;  3AE9 D;  3AE3 D;  1S1C X;  3P4Q C;  4YSX C;  3D6Z A;  3P4P C;  4I7Z C;  1R8E A;  3AE3 C;  3ABV D;  4OGQ B;  4YT0 D;  1OW6 A;  1WMK A;  2QJK C;  2QJY C;  3VRB D;  3ABV C;  1ZME C;  4YT0 C;  1K04 A;  1KTM A;  3GLM A;  5M1B A;  2O01 J;  2FXP A;  1NEN D;  3VR9 D;  4I7Z B;  3AE7 D;  1NYH A;  3RK3 E;  3Q2Y A;  4YTN D;  2YMK A;  3GF3 A;  1NEN C;  3VR9 C;  3AE7 C;  2ZT9 D;  2E75 D;  3AE2 D;  4YTN C;  2WDV C;  2WP9 D;  2E76 C;  2WSF J;  2WSC J;  4H44 D;  2WS3 D;  2BEZ F;  2ZT9 C;  2E75 C;  3AE2 C;  3Q5R A;  2WQY D;  3AE6 D;  2WP9 C;  3AE1 D;  4H44 C;  2WS3 C;  2JO1 A;  3AE6 C;  3P4Q D;  4R4L A;  4YSX D;  3RL0 g;  3AE1 C;  1NEK D;  3FGA D;  2E76 B;  1NEK C;  2OQQ A;  2ZT9 B;  2E75 B;  3AED D;  2MKV A;  1MKM A;  4H44 B;  3AEA D;  3AED C;  4IL6 X;  1KMI Z;  3AEA C;  1VF5 D;  3AEC D;  1PV3 A;  2QSI A;  3AEC C;  1VF5 C;  2IDB A;  4YTP D;  1RQU A;  1RQV A;  2WDV D;  1YQ3 C;  2E76 D;  4GDO A;  1YQ4 D;  4YTP C;  3Q5P A;  3CIR D;  3SFE D;  5KLI C;  1YQ4 C;  1DD3 A;  3AE8 D;  3CIR C;  4YTM C;  3SFE C;  3D71 A;  3LW5 J;  4H0L D;  1VF5 B;  1JB0 J;  3AE8 C;  3AE5 D;  3AEF D;  3P4S D;  1KQG B;  1KIL E;  4H0L C;  1Q90 D;  3AE5 C;  2QIW A;  1FDO A;  2YIU C;  3AEF C;  4Z1M H;  3D70 A;  3P4S C;  3S9O A;  4KX6 D;  4YSY D;  3AEE D;  4KX6 C;  3H25 A;  4XFJ A;  4TT3 H;  1KFY D;  4YSY C;  3AEE C;  4U7J A;  2G3A A;  1KQF B;  1Y9B A;  4H0L B;  4R4M A;  2WDQ D;  3SFD D;  1KFY C;  1UIX A;  3SFD C;  2K9Y A;  2WDQ C;  2WPV B;  1YQ3 D;  3EWK A;  2WDR D;  3AEG C;  2BEQ D;  1PIX A;  2H89 C;  3C8V A;  2WDR C;  2JP3 A;  1L0V D;  5L8R J;  2FYN C;  2WU5 D;  2BS3 C;  1S5L X;  4YTM D;  3VRA D;  1QLB C;  3O6Q A;  1L0V C;  3P4R D;  2WU5 C;  3Q5S A;  3VRA C;  1IK7 A;  1KF6 D;  4Y28 J;  4YXD D;  2NZ2 A;  2E74 B;  3P4R C;  3IAO A;  3B71 A;  3GF7 A;  4H13 D;  3T97 B;  2WU2 D;  1KF6 C;  3Q1M A;  3AE9 C;  4YXD C;  1DD4 A;  1KOR A;  1EXI A;  4H13 C;  2ACZ D;  2WU2 C;  4PV1 B;  3D6Y A;  4YSZ D;  1OMI A;  2WSE J;  1GMJ A;  1OW7 A;  1TU3 F;  1K05 A;  1AJY A;  2ACZ C;  4YSZ C;  1PL5 A;  1ZRT E;  2H88 D;  3AEB D;  1EXJ A;  3VRB C;  3GMA A;  5C3J D;  3VR8 D;  2QJP C;  5C2T D;  4RKU J;  2D2C D;  3AEB C;  2H88 C;  2P10 A;  3VR8 C;  5C3J C;  5C2T C;  4H13 B;  2D2C C;  2E74 D;  5KKZ C;  2H89 D;  3AEG D;  1DIP A;  1VL2 A;  3AE4 D;  1E7P C;  3IN6 A;  1FDI A;  2E74 C;  3Q3D A;  1NGM B;  4OGQ D;  1ZOY D;  2FBW D;  1ZP0 D;  1U57 A;  3AE4 C;  3G9R A;  4PV1 D;  1HF9 A;  1ZOY C;  2G8Y A;  2FBW C;  2J5U A;  3R4Y A;  4OGQ C;  1ZP0 C;  4PV1 C;  2V7Q J;  2WQY C;  2B76 D;  2BS2 C;  1HJ0 A;  2D2C B;  1OW8 A;  2BS4 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...