3AEEC

Crystal structure of porcine heart mitochondrial complex ii bound with atpenin a5
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
138
structure length
138
Chain Sequence
b'TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with Atpenin A5
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 46
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3aeeC01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3aeeC02
2FBWD 1KF6C 3CIRD 2FBWC 1KFYD 3AE1D 2BS3C 3CIRC 1ZP0D 3AE6D 1ZP0C 1QLBC 3AE4D 3AEED 4YSXD 3AE4C 2BS4C 3AEEC 3ABVD 4YSXC 3ABVC 2BS2C 3VRAD 3VRAC 1ZOYD 5C3JC 1ZOYC 3B71A 3S9OA 1L0VD 2WS3D 3AEDD 1L0VC 2WS3C 3P4RD 3AEDC 1KFYC 4YSYD 3AE1C 2H88D 4YSYC 2H88C 3AE6C 3VR9D 3SFED 3VR9C 3SFEC 3VRBD 1KTMA 3VRBC 4YSZD 4YTND 3AEBD 4YT0D 1YQ3D 2B76D 3AE3D 4YTNC 2G3AA 1OW7A 1PV3A 1YQ3C 2WDVD 3AE3C 2B76C 2WU5D 2WDVC 4YT0C 1OW8A 1K04A 4KX6D 3AE7D 3AE5D 3P4SD 3AE7C 4KX6C 3AE2D 3P4SC 3P4RC 3VR8D 3AE2C 2WDQD 3VR8C 2WDQC 3AEGD 1YQ4D 3AEGC 1YQ4C 2ACZD 4YTMD 2ACZC 2WU2D 4YSZC 1E7PC 4YTMC 1K05A 2WU2C 3AEBC 2WU5C 2WDRD 2WDRC 2WP9D 3SFDD 3P4PD 3SFDC 2WP9C 3P4PC 3AE9D 1NEND 3AE8D 3AE9C 3P4QD 1OW6A 1NENC 3AE8C 3P4QC 3AE5C 5C2TD 5C2TC 3AECD 2WQYD 3AEFD 4YXDD 3AECC 2WQYC 3AEFC 4YXDC 2H89D 5C3JD 4YTPD 2H89C 4YTPC 3AEAD 3AEAC 1NEKD 1NEKC 1KF6D
chains in the Genus database with same CATH superfamily
2FBWD 4IL6E 2YXRB 4N6JA 2FBWC 1HF9A 2BS3C 3WUTA 3V6IA 1ZP0D 1KQSO 4JQ0D 3HE4A 1PZQA 1ZP0C 2GM4A 1M1JA 2E5TA 5GTHE 3WUUA 2XDJA 3Q5RA 1LTJB 3TYYA 3KXDA 1HBWA 4KT0J 2IPPA 1M90Q 1GU4A 3ITKA 4D6TJ 3SFED 1GL2D 3SFEC 1GL2C 3N4XA 3AEBD 1BDDA 3MUDA 1YQ3D 1YQ3C 5AVYB 2FFDB 1LTBC 2OYHA 2I8DA 3QH9A 2V7QH 2AXCA 2BEQD 1PGOA 4OH8B 3PLNA 3CD6P 1K8AQ 1N86A 4HJGH 2IBZG 3CCJP 3KPEA 2P1JA 3H25A 1LT9C 4WY4D 3L70G 1JB0J 5AVUB 1GW3A 3E1RA 5KLVE 3SWYA 2WQYD 2WQYC 2HODA 4DDGA 2E76B 3BCCD 3CCMP 2KNCB 2JWAA 1H0TB 2VRSA 1SQPK 3RL0g 4AYCA 3A0BH 3C9IA 2M5AB 4XE5B 1SQXE 3JCUE 1L0NK 3L36A 4YSXD 4YSXC 1T6AA 5AVXB 2UWJE 2ZT9D 3L71G 4PV1D 1RE3C 2ZT9C 4PV1C 1YJNP 2FYUD 1SQXK 2A45H 3H32B 2R3SA 3OA7A 1DX7A 2W6BA 3H1KE 3KZIE 3L71D 3CCUP 3H1LG 1RE4C 3H1IJ 2XNDH 3L72J 2KSJA 1FDIA 1CI6A 2A45I 1DD4A 1SFCD 3L73J 1SFCC 2WPVB 1IO4A 1GK6A 1YIJP 3P8CE 1URQA 4I2LC 3VR8D 1IFJA 3VR8C 3HE5A 1LJ2A 2QG4A 1NTKG 3HE4B 5CMZA 2HG5D 1M1JB 1KQLA 1OMIA 1SQQK 1IFNA 3L74G 2Q7CA 3IN6A 2Z5HA 1TFFA 2Y0EA 3NFQA 3EFGA 5KJ7D 5KJ7C 1EXJA 1JOCA 5APYA 1X79B 2Y9ZA 2QEXP 1U57A 3L75E 2P7JA 1ZW0A 3FX0A 3B8EB 3ABVD 3ABVC 1JY3N 2Q6QA 3TSIA 1DD3A 1DIPA 2FXMA 1EXIA 1BE3D 4GOFA 3U1CA 1GL2A 1PPJE 1L0VD 2WPQA 1NO4A 1L0VC 3E7KA 5CJ0A 5KKZC 4HKZH 3CCLP 2CPBA 1JMBA 4GOEA 5KLVD 5E79H 1RF0C 1RY3A 1S1CX 1EZVD 1X9VA 2YO3A 1BGYG 4C7NA 3OJAB 3L70J 4D6TE 3TF5A 1YHQP 2E5YA 3BCCJ 4EOTA 2HODB 1MKMA 2ZFYA 1AQ5A 2KB7P 1LT9A 1RH5B 1JCDA 2K1AA 2IBZI 5APUA 3SFDD 3H1KD 3SFDC 1YJWP 5KAFH 2MJZA 3OAKA 2ZAEB 2WPRA 1ZLLA 3SWFA 1NTMG 1KFNA 2C0WA 1M7LA 1PFIA 1L0LE 3L71J 3A0BE 5AVVB 1FOSE 2JWDA 2JP3A 3H1LJ 1CSBA 2YIUB 3NTNA 1NEKD 1NEKC 2FYNC 1N7LA 1CI6B 1GK4A 2KZJA 1RE3A 1AFOA 1QLBC 4GIFA 1DEBA 1L0LK 1NTZD 3E1IA 5TISH 3F89A 1RE4A 1SQQG 3CX5H 1L4AB 2QJPB 2W27A 2Q5UA 1GMJA 4RJTA 1PGJA 1URQB 3HE5B 2KXPB 2XNXA 2A06E 1SFCA 2NPSD 2R5DA 3CX5I 2NPSC 3H1HD 3CWBD 1YBKA 4GKGA 4A7PA 1IFIA 2K3RA 2JKVA 2L91A 1USEA 3CXHH 2YNYA 1NTKJ 1LTSC 2AXTH 3H1IE 1IZNB 3L72E 2ZYAA 3L74J 2QJKC 3H1JG 2YXQB 3N7NA 2R32A 1FZBA 1J1DC 2ZYGA 1LTAC 1E7PC 3V2NA 1Q7YQ 5DJUB 5H2FH 5AW7B 4BWNA 3GHGC 1S4XA 2BASA 5APSA 5KJ7A 5CCHC 1BE3J 1KYOH 1QVGO 3AECD 3AECC 1KN7A 1NJIQ 5C3JD 4W80A 2G8YA 3VMAA 3FWNA 1E5WA 1KYOI 2KSEA 4N3YB 4D6TD 3CCQP 1LTTC 4M3LA 1TU3F 3Q5SA 1LWUC 2IFNA 2Q1KA 5BVZA 4C7NB 2WVRA 1BGYJ 4EI2A 1QEXA 3MIWA 4UB6H 3S9OA 1RF0A 2GUSA 5APWA 1GDTA 1LT9B 5E79E 4ASVA 3SSUA 2B88A 1YI2P 3AE3D 2WDVD 1X8YA 3AE3C 1M8OB 2WDVC 1NKNA 1KQFB 1PL5A 2FKWB 3USSA 3P7KA 4GDOA 2IBZE 1G2CA 1NTMJ 3KDPB 2Z4EA 1M57D 1USDA 1RQVA 2BEZF 1EDKA 4L73A 2ACZD 2BCCG 2ACZC 4WBAA 3TGUG 3BCCE 3D71A 2QE7H 3CPWO 1IFMA 2BCCD 1NTZJ 1KV4A 1WT6A 4PV1B 3S1KA 5AW4B 1IC2A 2A06D 3L35A 2WPSA 2K37A 2OGUA 2KYVA 2LXBA 1N7SD 2N1TD 1N7SC 2B87B 4U3FG 2N1TC 1N2DC 2PP6A 3HTKA 4TT3H 2HPCA 3L72D 2ZXEB 1VQ9P 3RK3D 1KF6D 1QX8A 3RK3C 1KF6C 2ITAA 1KFYD 3G3ZA 1VQMP 3L71E 3L73D 3AE6D 1FJKA 5TISE 3CX5E 2WSSH 3HD7C 2NPSA 2WT7A 1SQVG 2FYUK 1X22A 2OTKE 3VOPA 5KAIE 1T3UA 4RKUJ 1YJ9P 2MKVA 3B4SA 4YT0D 1LP1A 3CI9A 4YT0C 3Q3DA 4L74A 1SQBG 3P32A 3S4RA 1BSNA 1OW8A 1NTKE 2V7QJ 3GHGA 2WDQD 2WDQC 1AV1A 3HUSC 3M91A 3RL0D 5H2FE 2WSFJ 3L74E 2W83C 1K05A 3HRNA 2LR2A 3RK2D 5CCHA 3AEBC 3RK2C 3PH0A 2WDRD 2FXPA 2GUVA 2WDRC 1YITP 1MUUA 2R5BA 1KYOE 4OGQB 3BRVB 1JY2P 1X0TA 2WSFH 1DEEG 1WRGA 3FXEA 2H89D 4DJGA 2H89C 2Q3IA 2PGDA 3VP9A 1BE3E 1D7MA 1VL2A 1PP9G 1LWUA 2IBZD 1ZR4A 1PP9D 4WY4C 4IFMA 3L70D 4GT1A 3LIDA 1M56D 3U1AA 1EZVE 1G2CB 1QGKB 3GMAA 4I7ZB 1VDFA 2LXCB 4GODA 3P4RD 3Q5PA 4I1LA 1UIIA 4YXWH 1BGYE 2PRRA 2M3BA 2BCCJ 3A0HH 5KLVK 3TGUJ 1H8AA 2E75D 1G1JA 2E75C 3GLMA 5AVTB 1NKZB 1GD2E 1BCCG 1RF1C 2WU5D 1VQ6P 5AVSB 3JC22 4NPDA 2SPZA 1BCCD 2HYNA 4AUWA 4EDFA 1NU1G 1GZLA 1JUNA 4JYBA 4H44D 3P4SD 3M9HA 2FYNB 2WSEJ 4H44C 3P4SC 3A5TA 2XU6A 1J2JB 3RBZA 3CX5D 3H1LD 5APXA 3KHUA 2HPCB 1HUCA 1RHZB 1N73C 1GW4A 1VQOP 2QIWA 2YO2A 4ZMDA 1N7SA 2N1TA 2WSEH 4Y99C 3CMEP 2CK3H 1GTWA 3CXHD 1KZUB 2NPSB 3D6YA 1J1EC 1NTZE 3V2PA 2WT7B 3CMAP 1SQVJ 2KUBA 5CCGD 3WMM0 1HWTC 5CCGC 4KHXA 3F5HA 2KOGA 2ZVOB 3HD7A 4ZKUA 3AE1D 5AW5B 1NTKD 3PJSK 1AQTA 1LP1B 3H1HE 3CWBE 2OYIC 1NTZK 2BS2C 3L74D 3VP8A 3VRAD 1SQBJ 3VRAC 1VQPP 1ZOYD 1SVFA 2O3JA 1ZOYC 2PFXA 4H13D 4OWFA 4H13C 3V2QA 3GHGB 1KYOD 1QL2A 4YSYD 2HFED 2KZIA 5AVZB 4YSYC 3CL3D 3BRTB 3V4WA 3VMYA 5AW1B 4DHJA 4IFDK 3VRBD 3VRBC 1NOHA 3CLQA 2OYHB 4YPCA 2KLUA 3HUSA 5CJ4A 3II6A 2HLOA 3UIAA 2PAJA 1SQPG 1FDMA 4NPFX 1YTZI 2H43A 1W2BO 1SQPD 2Y0CA 1AJYA 1LWUB 1PP9J 4WWIA 1L0NG 3PRJA 1FU1A 1L2PA 1LTGC 1Q86Q 3NMDA 1CZQA 2B89A 4HB1A 1L0ND 1NEND 1NENC 1BGYD 2O01H 4ZKPA 1T3JA 2R44A 4DCKA 1SQXG 2N9YB 3VYIA 3D70A 4WY4A 3M0DC 3NXSA 4IFFA 1M1KQ 2IYOA 1UIXA 3A3YB 1VQNP 1VQ7P 1EDJA 1P84H 1A02F 2W6AA 1Y9BA 2E76D 2E76C 1Y8AA 1BCCJ 1N8RQ 1SS1A 4AQRD 1KQGB 2P58A 1P84I 2Q9IA 3VMZA 3G71P 1FE6A 1NTMD 4DHIB 1VF5D 1VF5C 1RF1A 3B5ND 3A0HE 2ZVNB 3B5NC 1KILE 5AVWB 4YTND 2B76D 1ZXGA 4YTNC 2B76C 1JEKA 1N7SB 2N1TB 2JEEA 2QJYC 1Q2NA 3GF3A 2BCCE 2IYPA 1SQQD 1KB9H 3R4YA 4BXLA 1JNMA 3AE5D 3RK3B 1U7JA 1OWAA 1KB9I 2WU2D 3KQGA 2WU2C 1ZN5A 3HD7B 3O8ZA 3WUVA 1HGZA 2RMZA 2OTJP 1KD1Q 3W68A 3RK3E 3AE9D 3OW2O 3AE9C 1S5LH 3CXHI 4LGDE 5CCGA 3L73E 1DH3A 1HVVA 3H1JD 1GU5A 2W90A 3L75G 4C7RA 4JF7A 5DJTB 1JMMA 2RH0A 2IFMA 2OYIA 1KMIZ 4JPZB 2N9BA 3A2AA 2XV5A 1Y47A 5CHXA 1SQVE 3AE4D 2O01N 3K5BA 3AE4C 1PGPA 5AW2B 3MTUE 1PPJG 3I5CA 1EC5A 3HUSB 1GL2B 2P10A 2WSCJ 5C3JC 1Q90D 3TNUA 1S5LX 4CPGA 2NZ2A 1SQPJ 4XA4A 4N78D 4I6MC 2H88D 2H88C 2Q3EA 2K9JA 1KTMA 1R5SA 1W2EA 2WSCH 1L0NJ 1HJBA 2Y0DA 2E74D 3V2RA 2E74C 1VQ5P 1HJ0A 4HYTB 3AEGD 4WY4B 2FXOA 1YQ4D 3AEGC 1YQ4C 1H88A 1JY2O 5EFWB 3LIEA 1H89A 2KIKA 3MZWB 2KK7A 5CBNA 1L0LG 3M0DA 1NAYA 1PP9E 2OQQA 4PD4D 1KILD 1KILC 3H6PA 3SWKA 1NAFA 3FXDA 3L70E 4YTPD 5AW0B 4YTPC 3D6ZA 1RF1B 1H0TA 3EQ2A 1S9KE 5KAFE 2FY8A 3TGUD 2ZT9B 5L8RJ 2M5AA 2YKQA 2J59M 1VQ4P 1JO5A 4H44B 1FZCC 1SQQJ 1MZ9A 5KLIC 1WMKA 3B5NA 4U3FD 1SFCB 1BCCE 4ZNCA 4DHZA 5AW9B 1KFYC 4Y99B 4EYYQ 1BSHA 2W8ZA 3AE6C 2WZ7A 1YYCA 2ZFCA 1L4AD 3H1IG 1IFDA 1L4AC 4FJVA 4YSZD 3H1LE 4RO0A 4O9BA 3I55P 1URQD 1BDCA 1J1EB 3EWKA 1MV8A 3A7OA 4WVZA 3H1JJ 4UB8H 1JY3P 3M0AA 1SQVD 1FZAA 1OIPA 3CXHE 2OYIB 2AXTE 4BRYA 1LT1A 2RN0A 1S5LE 1R8EA 4H13B 3P4QD 1SQBD 2IZ1A 3P4QC 1A02J 4I6LA 2NRGA 4DDIA 2ZXXA 3TNUB 5B66H 3RL0C 2J58A 1LGHB 4PJ0H 5M1BA 2O1KA 2KS1A 3G9RA 3CIRD 2K9JB 3CIRC 2AEJA 1YTZT 1NTKK 3CC4P 1JTHA 5KKZB 3TK1A 3RBXA 1IFPA 2Z5IA 4LLHA 4ASWA 2IZ0A 3GW6A 4R4MA 2D2CD 2D2CC 4LC1A 5KTBA 4Y28J 4UB6E 1OW7A 1SQPE 3VMXA 5TJHA 1P84D 1S9KD 1L0LJ 1NWQA 1FZGA 4L76A 2I1JA 2KLVA 1L0NE 3BCCG 3P4RC 1SLQA 1OVRA 5GTIH 2ZJSE 4XFJA 1OX3A 4PD4H 1S2EA 1SP4A 4DZOA 2WU5C 1KILA 1JM0A 2AEFA 3C8VA 1R5LA 3BASA 5APTA 3TDKA 2OARA 3WU2H 4PD4I 1VF5B 1VQ8P 2M3EA 4U3FJ 3B5NB 3HTKB 1FC2C 1NU1D 1U7MA 3IF4A 3L37A 1G1IA 2FYUG 1OZHA 3MHVA 1NTME 3IAOA 3AEAD 1KB9D 3AEAC 2P67A 1FAVA 1FZCA 1AA0A 1T8ZA 2QJYB 5AW3B 4H0LD 1E79H 4H0LC 1IK9A 3BVHA 1MFTA 4L75A 4W7YA 1FS0E 3L4FA 1NTMK 3MD0A 3B71A 2OYOA 1L4AA 3CC2P 1SQQE 3M9QA 2ZYDA 1MFZA 3AE1C 2QJKB 1ZRTE 1J1DB 4BRYB 1AVYA 5CBOA 2YMYA 3VTPC 3M9BA 1NYHA 4UB8E 1PIXA 5APVA 3AE7D 3AE7C 2K9YA 2Y9YA 1VQKP 3W67A 1LTJC 1VQLP 5AW6B 3H1JE 1FZEA 2KS1B 3V5BA 5C39A 1T2KD 3LW5J 1T2KC 3P4PD 4HH2A 3P4PC 1JTHB 4B86A 1BE3G 5B66E 2JR8A 2O01J 3VONA 4WB4A 2FFDC 2QSIA 3LW5H 4PJ0E 3CCRP 4QMAA 3VN0A 4OGQD 4KJMA 3CCVP 3PTZA 4K35A 2M0BA 1FDOA 4OGQC 5KLVG 1IK7A 2E74B 3ZDMA 3Q1MA 4N78E 2H8PD 5K5GB 3GG2A 4DOJA 1EZVG 3M06A 2IX7C 1OVVA 1NHLA 2C9NY 1SQXD 2L5GB 2C0XA 2WS3D 3PP5A 2WS3C 2J5UA 4JBZA 1Z56A 3QWOC 1NGMB 1JY2N 3H1KG 2CPSA 1KILB 3P8MC 1QL1A 4I7ZC 3I56P 4TLFA 2POHA 1NU1J 2O1JA 1K04A 4KX6D 4DT0A 4KX6C 1KORA 3AE2D 2FYZA 3RGUA 3AE2C 1K73Q 5GTIE 2FYUJ 3JSVC 1EDLA 4PD4E 4YTMD 1FZCB 4YTMC 2C9LY 4OVNF 1EQ7A 5KLIB 1PGQA 3P8CD 3WU2E 4Z1MH 1NTZG 3TGUE 3T97A 1KFMA 1ZRTD 2P2UA 3AE5C 5AVQB 2YMKA 1N73A 1ZR2A 2KP8A 4RESB 3MGNA 2HR3A 4MN4C 1LNQA 3Q2YA 2XZRA 4JYCA 2B87A 2YKOA 3H1HG 3CWBG 4U3FE 1FOSF 5B5EH 2V4HA 5KAIH 4IL6H 3O6QA 3AEED 2BS4C 3AEEC 5AW8B 4IOIH 5GTHH 2AEMA 1W5CE 1M1JC 3CCSP 2KI7B 2LKMA 3L75D 1FJPA 1HH0A 1JY3O 1EDIA 1VPCA 4W7ZA 3V4QA 5BU8B 2G3AA 1PV3A 4EIJA 1LTJA 5AVRB 1ZMEC 3RL0B 1PPJD 3RK2B 4IL6X 5CCHD 4NPEA 3MUDC 4C46A 2OTLP 3U59A 1SQBE 1SQVK 1ZV8A 2QVAA 2OYHC 1OVUA 4D6TG 2QA4P 5KLVJ 5APQA 2FFDA 1NVOA 3AE8D 1SQBK 3AE8C 4U7JA 2D2CB 4R4LA 5C2TD 1SQXJ 3CC7P 5C2TC 3AEFD 4YXDD 1OXZA 3G4SP 3AEFC 4YXDC 1QLED 1HTLC 2RKLA 2GA1A 3KYQA 1RQUA 2QRXA 4K3AA 2W6JH 2WITA 2M8RA 1HGVA 2XKMA 2I1KA 3G6EP 1QVFO 3JCUH 1L0LD 3H1KJ 2IDBA 1EZVI 2WWWA 3CCEP 1Q81Q 2B9BA 1CW5A 3IFMA 2E75B 2K88A 2KNCA 2YKPA 1P84E 2JO1A 3AEDD 2R3CA 3AEDC 3KZIH 3MP7B 3FGAD 2A45G 3VR9D 3VR9C 3IR9A 2WMMA 2YIUC 2A06G 3T97B 1LTIC 1S3JA 1XTGB 1N73B 3C1LA 3H32A 2QM7A 2JDIH 1FZFA 2E43A 4H0LB 1S72P 2QJPC 1NU1E 3L72G 5BU5A 3PHLA 2WTYA 4YSZC 2JJLA 2E42A 3H1HJ 3CWBJ 3H1ID 1URQC 3L73G 1K9MQ 3FWLA 1KB9E 2FYUE 2WP9D 3O6QB 2WP9C 2DW3A 1FBMA 1OW6A 2QM8A 1XTCC 1NH4A 4LDTA 1NU1K 1OFCX 3HD7D 1KC8Q 3R2PA 3L75J 1AVOA 3GF7A 3EFFK 2H7HA 1IJDB 1Q82Q 5B5EE 3BATA 1JCCA
chains in the Genus database with same CATH topology
2FYNC 2ZT9B 2FBWD 5L8RJ 1KF6C 1U57A 2FBWC 3G9RA 1KFYD 3AE1D 1HF9A 3CIRD 2BS3C 1IK7A 1Y9BA 3CIRC 1ZP0D 2E74B 3AE6D 4H0LD 3Q1MA 1ZP0C 2E76D 3O6QA 1QLBC 4H0LC 3AE4D 2E76C 3AEED 4YSXD 3AE4C 2BS4C 1TU3F 3AEEC 3ABVD 4YSXC 2IDBA 4H44B 3ABVC 3Q5SA 3Q5RA 2BS2C 1KQGB 1DD3A 3VRAD 5KLIC 1WMKA 3VRAC 1DIPA 1EXIA 2ZT9D 2P10A 1ZOYD 2WSCJ 4PV1D 2E75B 5C3JC 2ZT9C 1ZOYC 4YT0C 4PV1C 1Q90D 1GMJA 4KT0J 3B71A 4H13D 3GMAA 4I7ZB 1S5LX 3S9OA 4H13C 1VF5D 4R4MA 1L0VD 2WS3D 1VF5C 2D2CD 2JO1A 2NZ2A 3AEDD 1L0VC 2WS3C 2D2CC 5KKZC 3P4RD 3AEDC 3Q5PA 4YTNC 1KFYC 4YSYD 3AE1C 2H88D 4YSYC 1ZRTE 2H88C 3AE6C 2J5UA 3FGAD 4RKUJ 3VR9D 3SFED 1FDIA 2MKVA 1KILE 3SFEC 3VR9C 3VRBD 1KTMA 2E75D 4Y28J 3VRBC 4YSZD 2E75C 3GLMA 1NGMB 3AEBD 1YQ3D 4YT0D 4YTND 2B76D 3AE3D 1DD4A 2G3AA 1OW7A 1PV3A 1S1CX 1YQ3C 3AE3C 4I7ZC 2B76C 2WPVB 1KQFB 2WDVC 2YIUC 2WU5D 3Q3DA 3EWKA 1PL5A 1ZMEC 2QJYC 3T97B 1NYHA 1PIXA 2E74D 3GF3A 4IL6X 2E74C 1OW8A 1K04A 2QJKC 2BEQD 4GDOA 3R4YA 3AE7D 4KX6D 3AE5D 4H44D 3AE7C 3P4SD 1KORA 4KX6C 2K9YA 2WSEJ 4H44C 3AE2D 3P4SC 1HJ0A 3P4RC 1MKMA 2V7QJ 3AE2C 3VR8D 2WDQD 3VR8C 2WDQC 3AEGD 1RQVA 1YQ4D 2BEZF 3AEGC 4H0LB 1YQ4C 2QJPC 2ACZD 4YTMD 2WSFJ 4XFJA 2ACZC 2WU2D 1AJYA 1E7PC 3D71A 1K05A 4YSZC 4YTMC 2WU2C 3AEBC 2WDVD 2WU5C 2QIWA 2WDRD 3H25A 2FXPA 2WDRC 2WP9D 3LW5J 3SFDD 3P4PD 3C8VA 4PV1B 3SFDC 2WP9C 1R8EA 3P4PC 1OMIA 4Z1MH 3RK3E 3AE9D 1NEND 4H13B 3AE9C 3AE8D 1OW6A 3P4QD 4OGQB 1NENC 3AE8C 3P4QC 1VF5B 4U7JA 2D2CB 1JB0J 2YMKA 3AE5C 4R4LA 5C2TD 2OQQA 3IN6A 5C2TC 3AECD 2WQYD 3AEFD 4YXDD 3AECC 3D6YA 2O01J 2WQYC 3AEFC 4YXDC 2E76B 3D70A 2QSIA 3Q2YA 2H89D 5C3JD 4YTPD 3GF7A 1RQUA 2G8YA 4TT3H 3RL0g 2H89C 4YTPC 1UIXA 3D6ZA 3IAOA 3AEAD 4OGQD 1KMIZ 1VL2A 2JP3A 3AEAC 1EXJA 1NEKD 4OGQC 1FDOA 1NEKC 5M1BA 1KF6D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FBW D;  1KF6 C;  3CIR D;  2FBW C;  1KFY D;  3AE1 D;  2BS3 C;  3CIR C;  1ZP0 D;  3AE6 D;  1ZP0 C;  1QLB C;  3AE4 D;  3AEE D;  4YSX D;  3AE4 C;  2BS4 C;  3AEE C;  3ABV D;  4YSX C;  3ABV C;  2BS2 C;  3VRA D;  3VRA C;  1ZOY D;  5C3J C;  1ZOY C;  3B71 A;  3S9O A;  1L0V D;  2WS3 D;  3AED D;  1L0V C;  2WS3 C;  3P4R D;  3AED C;  1KFY C;  4YSY D;  3AE1 C;  2H88 D;  4YSY C;  2H88 C;  3AE6 C;  3VR9 D;  3SFE D;  3VR9 C;  3SFE C;  3VRB D;  1KTM A;  3VRB C;  4YSZ D;  4YTN D;  3AEB D;  4YT0 D;  1YQ3 D;  2B76 D;  3AE3 D;  4YTN C;  2G3A A;  1OW7 A;  1PV3 A;  1YQ3 C;  2WDV D;  3AE3 C;  2B76 C;  2WU5 D;  2WDV C;  4YT0 C;  1OW8 A;  1K04 A;  4KX6 D;  3AE7 D;  3AE5 D;  3P4S D;  3AE7 C;  4KX6 C;  3AE2 D;  3P4S C;  3P4R C;  3VR8 D;  3AE2 C;  2WDQ D;  3VR8 C;  2WDQ C;  3AEG D;  1YQ4 D;  3AEG C;  1YQ4 C;  2ACZ D;  4YTM D;  2ACZ C;  2WU2 D;  4YSZ C;  1E7P C;  4YTM C;  1K05 A;  2WU2 C;  3AEB C;  2WU5 C;  2WDR D;  2WDR C;  2WP9 D;  3SFD D;  3P4P D;  3SFD C;  2WP9 C;  3P4P C;  3AE9 D;  1NEN D;  3AE8 D;  3AE9 C;  3P4Q D;  1OW6 A;  1NEN C;  3AE8 C;  3P4Q C;  3AE5 C;  5C2T D;  5C2T C;  3AEC D;  2WQY D;  3AEF D;  4YXD D;  3AEC C;  2WQY C;  3AEF C;  4YXD C;  2H89 D;  5C3J D;  4YTP D;  2H89 C;  4YTP C;  3AEA D;  3AEA C;  1NEK D;  1NEK C;  1KF6 D; 
#chains in the Genus database with same CATH topology
 2FBW D;  4IL6 E;  2YXR B;  4N6J A;  2FBW C;  1HF9 A;  2BS3 C;  3WUT A;  3V6I A;  1ZP0 D;  1KQS O;  4JQ0 D;  3HE4 A;  1PZQ A;  1ZP0 C;  2GM4 A;  1M1J A;  2E5T A;  5GTH E;  3WUU A;  2XDJ A;  3Q5R A;  1LTJ B;  3TYY A;  3KXD A;  1HBW A;  4KT0 J;  2IPP A;  1M90 Q;  1GU4 A;  3ITK A;  4D6T J;  3SFE D;  1GL2 D;  3SFE C;  1GL2 C;  3N4X A;  3AEB D;  1BDD A;  3MUD A;  1YQ3 D;  1YQ3 C;  5AVY B;  2FFD B;  1LTB C;  2OYH A;  2I8D A;  3QH9 A;  2V7Q H;  2AXC A;  2BEQ D;  1PGO A;  4OH8 B;  3PLN A;  3CD6 P;  1K8A Q;  1N86 A;  4HJG H;  2IBZ G;  3CCJ P;  3KPE A;  2P1J A;  3H25 A;  1LT9 C;  4WY4 D;  3L70 G;  1JB0 J;  5AVU B;  1GW3 A;  3E1R A;  5KLV E;  3SWY A;  2WQY D;  2WQY C;  2HOD A;  4DDG A;  2E76 B;  3BCC D;  3CCM P;  2KNC B;  2JWA A;  1H0T B;  2VRS A;  1SQP K;  3RL0 g;  4AYC A;  3A0B H;  3C9I A;  2M5A B;  4XE5 B;  1SQX E;  3JCU E;  1L0N K;  3L36 A;  4YSX D;  4YSX C;  1T6A A;  5AVX B;  2UWJ E;  2ZT9 D;  3L71 G;  4PV1 D;  1RE3 C;  2ZT9 C;  4PV1 C;  1YJN P;  2FYU D;  1SQX K;  2A45 H;  3H32 B;  2R3S A;  3OA7 A;  1DX7 A;  2W6B A;  3H1K E;  3KZI E;  3L71 D;  3CCU P;  3H1L G;  1RE4 C;  3H1I J;  2XND H;  3L72 J;  2KSJ A;  1FDI A;  1CI6 A;  2A45 I;  1DD4 A;  1SFC D;  3L73 J;  1SFC C;  2WPV B;  1IO4 A;  1GK6 A;  1YIJ P;  3P8C E;  1URQ A;  4I2L C;  3VR8 D;  1IFJ A;  3VR8 C;  3HE5 A;  1LJ2 A;  2QG4 A;  1NTK G;  3HE4 B;  5CMZ A;  2HG5 D;  1M1J B;  1KQL A;  1OMI A;  1SQQ K;  1IFN A;  3L74 G;  2Q7C A;  3IN6 A;  2Z5H A;  1TFF A;  2Y0E A;  3NFQ A;  3EFG A;  5KJ7 D;  5KJ7 C;  1EXJ A;  1JOC A;  5APY A;  1X79 B;  2Y9Z A;  2QEX P;  1U57 A;  3L75 E;  2P7J A;  1ZW0 A;  3FX0 A;  3B8E B;  3ABV D;  3ABV C;  1JY3 N;  2Q6Q A;  3TSI A;  1DD3 A;  1DIP A;  2FXM A;  1EXI A;  1BE3 D;  4GOF A;  3U1C A;  1GL2 A;  1PPJ E;  1L0V D;  2WPQ A;  1NO4 A;  1L0V C;  3E7K A;  5CJ0 A;  5KKZ C;  4HKZ H;  3CCL P;  2CPB A;  1JMB A;  4GOE A;  5KLV D;  5E79 H;  1RF0 C;  1RY3 A;  1S1C X;  1EZV D;  1X9V A;  2YO3 A;  1BGY G;  4C7N A;  3OJA B;  3L70 J;  4D6T E;  3TF5 A;  1YHQ P;  2E5Y A;  3BCC J;  4EOT A;  2HOD B;  1MKM A;  2ZFY A;  1AQ5 A;  2KB7 P;  1LT9 A;  1RH5 B;  1JCD A;  2K1A A;  2IBZ I;  5APU A;  3SFD D;  3H1K D;  3SFD C;  1YJW P;  5KAF H;  2MJZ A;  3OAK A;  2ZAE B;  2WPR A;  1ZLL A;  3SWF A;  1NTM G;  1KFN A;  2C0W A;  1M7L A;  1PFI A;  1L0L E;  3L71 J;  3A0B E;  5AVV B;  1FOS E;  2JWD A;  2JP3 A;  3H1L J;  1CSB A;  2YIU B;  3NTN A;  1NEK D;  1NEK C;  2FYN C;  1N7L A;  1CI6 B;  1GK4 A;  2KZJ A;  1RE3 A;  1AFO A;  1QLB C;  4GIF A;  1DEB A;  1L0L K;  1NTZ D;  3E1I A;  5TIS H;  3F89 A;  1RE4 A;  1SQQ G;  3CX5 H;  1L4A B;  2QJP B;  2W27 A;  2Q5U A;  1GMJ A;  4RJT A;  1PGJ A;  1URQ B;  3HE5 B;  2KXP B;  2XNX A;  2A06 E;  1SFC A;  2NPS D;  2R5D A;  3CX5 I;  2NPS C;  3H1H D;  3CWB D;  1YBK A;  4GKG A;  4A7P A;  1IFI A;  2K3R A;  2JKV A;  2L91 A;  1USE A;  3CXH H;  2YNY A;  1NTK J;  1LTS C;  2AXT H;  3H1I E;  1IZN B;  3L72 E;  2ZYA A;  3L74 J;  2QJK C;  3H1J G;  2YXQ B;  3N7N A;  2R32 A;  1FZB A;  1J1D C;  2ZYG A;  1LTA C;  1E7P C;  3V2N A;  1Q7Y Q;  5DJU B;  5H2F H;  5AW7 B;  4BWN A;  3GHG C;  1S4X A;  2BAS A;  5APS A;  5KJ7 A;  5CCH C;  1BE3 J;  1KYO H;  1QVG O;  3AEC D;  3AEC C;  1KN7 A;  1NJI Q;  5C3J D;  4W80 A;  2G8Y A;  3VMA A;  3FWN A;  1E5W A;  1KYO I;  2KSE A;  4N3Y B;  4D6T D;  3CCQ P;  1LTT C;  4M3L A;  1TU3 F;  3Q5S A;  1LWU C;  2IFN A;  2Q1K A;  5BVZ A;  4C7N B;  2WVR A;  1BGY J;  4EI2 A;  1QEX A;  3MIW A;  4UB6 H;  3S9O A;  1RF0 A;  2GUS A;  5APW A;  1GDT A;  1LT9 B;  5E79 E;  4ASV A;  3SSU A;  2B88 A;  1YI2 P;  3AE3 D;  2WDV D;  1X8Y A;  3AE3 C;  1M8O B;  2WDV C;  1NKN A;  1KQF B;  1PL5 A;  2FKW B;  3USS A;  3P7K A;  4GDO A;  2IBZ E;  1G2C A;  1NTM J;  3KDP B;  2Z4E A;  1M57 D;  1USD A;  1RQV A;  2BEZ F;  1EDK A;  4L73 A;  2ACZ D;  2BCC G;  2ACZ C;  4WBA A;  3TGU G;  3BCC E;  3D71 A;  2QE7 H;  3CPW O;  1IFM A;  2BCC D;  1NTZ J;  1KV4 A;  1WT6 A;  4PV1 B;  3S1K A;  5AW4 B;  1IC2 A;  2A06 D;  3L35 A;  2WPS A;  2K37 A;  2OGU A;  2KYV A;  2LXB A;  1N7S D;  2N1T D;  1N7S C;  2B87 B;  4U3F G;  2N1T C;  1N2D C;  2PP6 A;  3HTK A;  4TT3 H;  2HPC A;  3L72 D;  2ZXE B;  1VQ9 P;  3RK3 D;  1KF6 D;  1QX8 A;  3RK3 C;  1KF6 C;  2ITA A;  1KFY D;  3G3Z A;  1VQM P;  3L71 E;  3L73 D;  3AE6 D;  1FJK A;  5TIS E;  3CX5 E;  2WSS H;  3HD7 C;  2NPS A;  2WT7 A;  1SQV G;  2FYU K;  1X22 A;  2OTK E;  3VOP A;  5KAI E;  1T3U A;  4RKU J;  1YJ9 P;  2MKV A;  3B4S A;  4YT0 D;  1LP1 A;  3CI9 A;  4YT0 C;  3Q3D A;  4L74 A;  1SQB G;  3P32 A;  3S4R A;  1BSN A;  1OW8 A;  1NTK E;  2V7Q J;  3GHG A;  2WDQ D;  2WDQ C;  1AV1 A;  3HUS C;  3M91 A;  3RL0 D;  5H2F E;  2WSF J;  3L74 E;  2W83 C;  1K05 A;  3HRN A;  2LR2 A;  3RK2 D;  5CCH A;  3AEB C;  3RK2 C;  3PH0 A;  2WDR D;  2FXP A;  2GUV A;  2WDR C;  1YIT P;  1MUU A;  2R5B A;  1KYO E;  4OGQ B;  3BRV B;  1JY2 P;  1X0T A;  2WSF H;  1DEE G;  1WRG A;  3FXE A;  2H89 D;  4DJG A;  2H89 C;  2Q3I A;  2PGD A;  3VP9 A;  1BE3 E;  1D7M A;  1VL2 A;  1PP9 G;  1LWU A;  2IBZ D;  1ZR4 A;  1PP9 D;  4WY4 C;  4IFM A;  3L70 D;  4GT1 A;  3LID A;  1M56 D;  3U1A A;  1EZV E;  1G2C B;  1QGK B;  3GMA A;  4I7Z B;  1VDF A;  2LXC B;  4GOD A;  3P4R D;  3Q5P A;  4I1L A;  1UII A;  4YXW H;  1BGY E;  2PRR A;  2M3B A;  2BCC J;  3A0H H;  5KLV K;  3TGU J;  1H8A A;  2E75 D;  1G1J A;  2E75 C;  3GLM A;  5AVT B;  1NKZ B;  1GD2 E;  1BCC G;  1RF1 C;  2WU5 D;  1VQ6 P;  5AVS B;  3JC2 2;  4NPD A;  2SPZ A;  1BCC D;  2HYN A;  4AUW A;  4EDF A;  1NU1 G;  1GZL A;  1JUN A;  4JYB A;  4H44 D;  3P4S D;  3M9H A;  2FYN B;  2WSE J;  4H44 C;  3P4S C;  3A5T A;  2XU6 A;  1J2J B;  3RBZ A;  3CX5 D;  3H1L D;  5APX A;  3KHU A;  2HPC B;  1HUC A;  1RHZ B;  1N73 C;  1GW4 A;  1VQO P;  2QIW A;  2YO2 A;  4ZMD A;  1N7S A;  2N1T A;  2WSE H;  4Y99 C;  3CME P;  2CK3 H;  1GTW A;  3CXH D;  1KZU B;  2NPS B;  3D6Y A;  1J1E C;  1NTZ E;  3V2P A;  2WT7 B;  3CMA P;  1SQV J;  2KUB A;  5CCG D;  3WMM 0;  1HWT C;  5CCG C;  4KHX A;  3F5H A;  2KOG A;  2ZVO B;  3HD7 A;  4ZKU A;  3AE1 D;  5AW5 B;  1NTK D;  3PJS K;  1AQT A;  1LP1 B;  3H1H E;  3CWB E;  2OYI C;  1NTZ K;  2BS2 C;  3L74 D;  3VP8 A;  3VRA D;  1SQB J;  3VRA C;  1VQP P;  1ZOY D;  1SVF A;  2O3J A;  1ZOY C;  2PFX A;  4H13 D;  4OWF A;  4H13 C;  3V2Q A;  3GHG B;  1KYO D;  1QL2 A;  4YSY D;  2HFE D;  2KZI A;  5AVZ B;  4YSY C;  3CL3 D;  3BRT B;  3V4W A;  3VMY A;  5AW1 B;  4DHJ A;  4IFD K;  3VRB D;  3VRB C;  1NOH A;  3CLQ A;  2OYH B;  4YPC A;  2KLU A;  3HUS A;  5CJ4 A;  3II6 A;  2HLO A;  3UIA A;  2PAJ A;  1SQP G;  1FDM A;  4NPF X;  1YTZ I;  2H43 A;  1W2B O;  1SQP D;  2Y0C A;  1AJY A;  1LWU B;  1PP9 J;  4WWI A;  1L0N G;  3PRJ A;  1FU1 A;  1L2P A;  1LTG C;  1Q86 Q;  3NMD A;  1CZQ A;  2B89 A;  4HB1 A;  1L0N D;  1NEN D;  1NEN C;  1BGY D;  2O01 H;  4ZKP A;  1T3J A;  2R44 A;  4DCK A;  1SQX G;  2N9Y B;  3VYI A;  3D70 A;  4WY4 A;  3M0D C;  3NXS A;  4IFF A;  1M1K Q;  2IYO A;  1UIX A;  3A3Y B;  1VQN P;  1VQ7 P;  1EDJ A;  1P84 H;  1A02 F;  2W6A A;  1Y9B A;  2E76 D;  2E76 C;  1Y8A A;  1BCC J;  1N8R Q;  1SS1 A;  4AQR D;  1KQG B;  2P58 A;  1P84 I;  2Q9I A;  3VMZ A;  3G71 P;  1FE6 A;  1NTM D;  4DHI B;  1VF5 D;  1VF5 C;  1RF1 A;  3B5N D;  3A0H E;  2ZVN B;  3B5N C;  1KIL E;  5AVW B;  4YTN D;  2B76 D;  1ZXG A;  4YTN C;  2B76 C;  1JEK A;  1N7S B;  2N1T B;  2JEE A;  2QJY C;  1Q2N A;  3GF3 A;  2BCC E;  2IYP A;  1SQQ D;  1KB9 H;  3R4Y A;  4BXL A;  1JNM A;  3AE5 D;  3RK3 B;  1U7J A;  1OWA A;  1KB9 I;  2WU2 D;  3KQG A;  2WU2 C;  1ZN5 A;  3HD7 B;  3O8Z A;  3WUV A;  1HGZ A;  2RMZ A;  2OTJ P;  1KD1 Q;  3W68 A;  3RK3 E;  3AE9 D;  3OW2 O;  3AE9 C;  1S5L H;  3CXH I;  4LGD E;  5CCG A;  3L73 E;  1DH3 A;  1HVV A;  3H1J D;  1GU5 A;  2W90 A;  3L75 G;  4C7R A;  4JF7 A;  5DJT B;  1JMM A;  2RH0 A;  2IFM A;  2OYI A;  1KMI Z;  4JPZ B;  2N9B A;  3A2A A;  2XV5 A;  1Y47 A;  5CHX A;  1SQV E;  3AE4 D;  2O01 N;  3K5B A;  3AE4 C;  1PGP A;  5AW2 B;  3MTU E;  1PPJ G;  3I5C A;  1EC5 A;  3HUS B;  1GL2 B;  2P10 A;  2WSC J;  5C3J C;  1Q90 D;  3TNU A;  1S5L X;  4CPG A;  2NZ2 A;  1SQP J;  4XA4 A;  4N78 D;  4I6M C;  2H88 D;  2H88 C;  2Q3E A;  2K9J A;  1KTM A;  1R5S A;  1W2E A;  2WSC H;  1L0N J;  1HJB A;  2Y0D A;  2E74 D;  3V2R A;  2E74 C;  1VQ5 P;  1HJ0 A;  4HYT B;  3AEG D;  4WY4 B;  2FXO A;  1YQ4 D;  3AEG C;  1YQ4 C;  1H88 A;  1JY2 O;  5EFW B;  3LIE A;  1H89 A;  2KIK A;  3MZW B;  2KK7 A;  5CBN A;  1L0L G;  3M0D A;  1NAY A;  1PP9 E;  2OQQ A;  4PD4 D;  1KIL D;  1KIL C;  3H6P A;  3SWK A;  1NAF A;  3FXD A;  3L70 E;  4YTP D;  5AW0 B;  4YTP C;  3D6Z A;  1RF1 B;  1H0T A;  3EQ2 A;  1S9K E;  5KAF E;  2FY8 A;  3TGU D;  2ZT9 B;  5L8R J;  2M5A A;  2YKQ A;  2J59 M;  1VQ4 P;  1JO5 A;  4H44 B;  1FZC C;  1SQQ J;  1MZ9 A;  5KLI C;  1WMK A;  3B5N A;  4U3F D;  1SFC B;  1BCC E;  4ZNC A;  4DHZ A;  5AW9 B;  1KFY C;  4Y99 B;  4EYY Q;  1BSH A;  2W8Z A;  3AE6 C;  2WZ7 A;  1YYC A;  2ZFC A;  1L4A D;  3H1I G;  1IFD A;  1L4A C;  4FJV A;  4YSZ D;  3H1L E;  4RO0 A;  4O9B A;  3I55 P;  1URQ D;  1BDC A;  1J1E B;  3EWK A;  1MV8 A;  3A7O A;  4WVZ A;  3H1J J;  4UB8 H;  1JY3 P;  3M0A A;  1SQV D;  1FZA A;  1OIP A;  3CXH E;  2OYI B;  2AXT E;  4BRY A;  1LT1 A;  2RN0 A;  1S5L E;  1R8E A;  4H13 B;  3P4Q D;  1SQB D;  2IZ1 A;  3P4Q C;  1A02 J;  4I6L A;  2NRG A;  4DDI A;  2ZXX A;  3TNU B;  5B66 H;  3RL0 C;  2J58 A;  1LGH B;  4PJ0 H;  5M1B A;  2O1K A;  2KS1 A;  3G9R A;  3CIR D;  2K9J B;  3CIR C;  2AEJ A;  1YTZ T;  1NTK K;  3CC4 P;  1JTH A;  5KKZ B;  3TK1 A;  3RBX A;  1IFP A;  2Z5I A;  4LLH A;  4ASW A;  2IZ0 A;  3GW6 A;  4R4M A;  2D2C D;  2D2C C;  4LC1 A;  5KTB A;  4Y28 J;  4UB6 E;  1OW7 A;  1SQP E;  3VMX A;  5TJH A;  1P84 D;  1S9K D;  1L0L J;  1NWQ A;  1FZG A;  4L76 A;  2I1J A;  2KLV A;  1L0N E;  3BCC G;  3P4R C;  1SLQ A;  1OVR A;  5GTI H;  2ZJS E;  4XFJ A;  1OX3 A;  4PD4 H;  1S2E A;  1SP4 A;  4DZO A;  2WU5 C;  1KIL A;  1JM0 A;  2AEF A;  3C8V A;  1R5L A;  3BAS A;  5APT A;  3TDK A;  2OAR A;  3WU2 H;  4PD4 I;  1VF5 B;  1VQ8 P;  2M3E A;  4U3F J;  3B5N B;  3HTK B;  1FC2 C;  1NU1 D;  1U7M A;  3IF4 A;  3L37 A;  1G1I A;  2FYU G;  1OZH A;  3MHV A;  1NTM E;  3IAO A;  3AEA D;  1KB9 D;  3AEA C;  2P67 A;  1FAV A;  1FZC A;  1AA0 A;  1T8Z A;  2QJY B;  5AW3 B;  4H0L D;  1E79 H;  4H0L C;  1IK9 A;  3BVH A;  1MFT A;  4L75 A;  4W7Y A;  1FS0 E;  3L4F A;  1NTM K;  3MD0 A;  3B71 A;  2OYO A;  1L4A A;  3CC2 P;  1SQQ E;  3M9Q A;  2ZYD A;  1MFZ A;  3AE1 C;  2QJK B;  1ZRT E;  1J1D B;  4BRY B;  1AVY A;  5CBO A;  2YMY A;  3VTP C;  3M9B A;  1NYH A;  4UB8 E;  1PIX A;  5APV A;  3AE7 D;  3AE7 C;  2K9Y A;  2Y9Y A;  1VQK P;  3W67 A;  1LTJ C;  1VQL P;  5AW6 B;  3H1J E;  1FZE A;  2KS1 B;  3V5B A;  5C39 A;  1T2K D;  3LW5 J;  1T2K C;  3P4P D;  4HH2 A;  3P4P C;  1JTH B;  4B86 A;  1BE3 G;  5B66 E;  2JR8 A;  2O01 J;  3VON A;  4WB4 A;  2FFD C;  2QSI A;  3LW5 H;  4PJ0 E;  3CCR P;  4QMA A;  3VN0 A;  4OGQ D;  4KJM A;  3CCV P;  3PTZ A;  4K35 A;  2M0B A;  1FDO A;  4OGQ C;  5KLV G;  1IK7 A;  2E74 B;  3ZDM A;  3Q1M A;  4N78 E;  2H8P D;  5K5G B;  3GG2 A;  4DOJ A;  1EZV G;  3M06 A;  2IX7 C;  1OVV A;  1NHL A;  2C9N Y;  1SQX D;  2L5G B;  2C0X A;  2WS3 D;  3PP5 A;  2WS3 C;  2J5U A;  4JBZ A;  1Z56 A;  3QWO C;  1NGM B;  1JY2 N;  3H1K G;  2CPS A;  1KIL B;  3P8M C;  1QL1 A;  4I7Z C;  3I56 P;  4TLF A;  2POH A;  1NU1 J;  2O1J A;  1K04 A;  4KX6 D;  4DT0 A;  4KX6 C;  1KOR A;  3AE2 D;  2FYZ A;  3RGU A;  3AE2 C;  1K73 Q;  5GTI E;  2FYU J;  3JSV C;  1EDL A;  4PD4 E;  4YTM D;  1FZC B;  4YTM C;  2C9L Y;  4OVN F;  1EQ7 A;  5KLI B;  1PGQ A;  3P8C D;  3WU2 E;  4Z1M H;  1NTZ G;  3TGU E;  3T97 A;  1KFM A;  1ZRT D;  2P2U A;  3AE5 C;  5AVQ B;  2YMK A;  1N73 A;  1ZR2 A;  2KP8 A;  4RES B;  3MGN A;  2HR3 A;  4MN4 C;  1LNQ A;  3Q2Y A;  2XZR A;  4JYC A;  2B87 A;  2YKO A;  3H1H G;  3CWB G;  4U3F E;  1FOS F;  5B5E H;  2V4H A;  5KAI H;  4IL6 H;  3O6Q A;  3AEE D;  2BS4 C;  3AEE C;  5AW8 B;  4IOI H;  5GTH H;  2AEM A;  1W5C E;  1M1J C;  3CCS P;  2KI7 B;  2LKM A;  3L75 D;  1FJP A;  1HH0 A;  1JY3 O;  1EDI A;  1VPC A;  4W7Z A;  3V4Q A;  5BU8 B;  2G3A A;  1PV3 A;  4EIJ A;  1LTJ A;  5AVR B;  1ZME C;  3RL0 B;  1PPJ D;  3RK2 B;  4IL6 X;  5CCH D;  4NPE A;  3MUD C;  4C46 A;  2OTL P;  3U59 A;  1SQB E;  1SQV K;  1ZV8 A;  2QVA A;  2OYH C;  1OVU A;  4D6T G;  2QA4 P;  5KLV J;  5APQ A;  2FFD A;  1NVO A;  3AE8 D;  1SQB K;  3AE8 C;  4U7J A;  2D2C B;  4R4L A;  5C2T D;  1SQX J;  3CC7 P;  5C2T C;  3AEF D;  4YXD D;  1OXZ A;  3G4S P;  3AEF C;  4YXD C;  1QLE D;  1HTL C;  2RKL A;  2GA1 A;  3KYQ A;  1RQU A;  2QRX A;  4K3A A;  2W6J H;  2WIT A;  2M8R A;  1HGV A;  2XKM A;  2I1K A;  3G6E P;  1QVF O;  3JCU H;  1L0L D;  3H1K J;  2IDB A;  1EZV I;  2WWW A;  3CCE P;  1Q81 Q;  2B9B A;  1CW5 A;  3IFM A;  2E75 B;  2K88 A;  2KNC A;  2YKP A;  1P84 E;  2JO1 A;  3AED D;  2R3C A;  3AED C;  3KZI H;  3MP7 B;  3FGA D;  2A45 G;  3VR9 D;  3VR9 C;  3IR9 A;  2WMM A;  2YIU C;  2A06 G;  3T97 B;  1LTI C;  1S3J A;  1XTG B;  1N73 B;  3C1L A;  3H32 A;  2QM7 A;  2JDI H;  1FZF A;  2E43 A;  4H0L B;  1S72 P;  2QJP C;  1NU1 E;  3L72 G;  5BU5 A;  3PHL A;  2WTY A;  4YSZ C;  2JJL A;  2E42 A;  3H1H J;  3CWB J;  3H1I D;  1URQ C;  3L73 G;  1K9M Q;  3FWL A;  1KB9 E;  2FYU E;  2WP9 D;  3O6Q B;  2WP9 C;  2DW3 A;  1FBM A;  1OW6 A;  2QM8 A;  1XTC C;  1NH4 A;  4LDT A;  1NU1 K;  1OFC X;  3HD7 D;  1KC8 Q;  3R2P A;  3L75 J;  1AVO A;  3GF7 A;  3EFF K;  2H7H A;  1IJD B;  1Q82 Q;  5B5E E;  3BAT A;  1JCC A; 
#chains in the Genus database with same CATH homology
 2FYN C;  2ZT9 B;  2FBW D;  5L8R J;  1KF6 C;  1U57 A;  2FBW C;  3G9R A;  1KFY D;  3AE1 D;  1HF9 A;  3CIR D;  2BS3 C;  1IK7 A;  1Y9B A;  3CIR C;  1ZP0 D;  2E74 B;  3AE6 D;  4H0L D;  3Q1M A;  1ZP0 C;  2E76 D;  3O6Q A;  1QLB C;  4H0L C;  3AE4 D;  2E76 C;  3AEE D;  4YSX D;  3AE4 C;  2BS4 C;  1TU3 F;  3AEE C;  3ABV D;  4YSX C;  2IDB A;  4H44 B;  3ABV C;  3Q5S A;  3Q5R A;  2BS2 C;  1KQG B;  1DD3 A;  3VRA D;  5KLI C;  1WMK A;  3VRA C;  1DIP A;  1EXI A;  2ZT9 D;  2P10 A;  1ZOY D;  2WSC J;  4PV1 D;  2E75 B;  5C3J C;  2ZT9 C;  1ZOY C;  4YT0 C;  4PV1 C;  1Q90 D;  1GMJ A;  4KT0 J;  3B71 A;  4H13 D;  3GMA A;  4I7Z B;  1S5L X;  3S9O A;  4H13 C;  1VF5 D;  4R4M A;  1L0V D;  2WS3 D;  1VF5 C;  2D2C D;  2JO1 A;  2NZ2 A;  3AED D;  1L0V C;  2WS3 C;  2D2C C;  5KKZ C;  3P4R D;  3AED C;  3Q5P A;  4YTN C;  1KFY C;  4YSY D;  3AE1 C;  2H88 D;  4YSY C;  1ZRT E;  2H88 C;  3AE6 C;  2J5U A;  3FGA D;  4RKU J;  3VR9 D;  3SFE D;  1FDI A;  2MKV A;  1KIL E;  3SFE C;  3VR9 C;  3VRB D;  1KTM A;  2E75 D;  4Y28 J;  3VRB C;  4YSZ D;  2E75 C;  3GLM A;  1NGM B;  3AEB D;  1YQ3 D;  4YT0 D;  4YTN D;  2B76 D;  3AE3 D;  1DD4 A;  2G3A A;  1OW7 A;  1PV3 A;  1S1C X;  1YQ3 C;  3AE3 C;  4I7Z C;  2B76 C;  2WPV B;  1KQF B;  2WDV C;  2YIU C;  2WU5 D;  3Q3D A;  3EWK A;  1PL5 A;  1ZME C;  2QJY C;  3T97 B;  1NYH A;  1PIX A;  2E74 D;  3GF3 A;  4IL6 X;  2E74 C;  1OW8 A;  1K04 A;  2QJK C;  2BEQ D;  4GDO A;  3R4Y A;  3AE7 D;  4KX6 D;  3AE5 D;  4H44 D;  3AE7 C;  3P4S D;  1KOR A;  4KX6 C;  2K9Y A;  2WSE J;  4H44 C;  3AE2 D;  3P4S C;  1HJ0 A;  3P4R C;  1MKM A;  2V7Q J;  3AE2 C;  3VR8 D;  2WDQ D;  3VR8 C;  2WDQ C;  3AEG D;  1RQV A;  1YQ4 D;  2BEZ F;  3AEG C;  4H0L B;  1YQ4 C;  2QJP C;  2ACZ D;  4YTM D;  2WSF J;  4XFJ A;  2ACZ C;  2WU2 D;  1AJY A;  1E7P C;  3D71 A;  1K05 A;  4YSZ C;  4YTM C;  2WU2 C;  3AEB C;  2WDV D;  2WU5 C;  2QIW A;  2WDR D;  3H25 A;  2FXP A;  2WDR C;  2WP9 D;  3LW5 J;  3SFD D;  3P4P D;  3C8V A;  4PV1 B;  3SFD C;  2WP9 C;  1R8E A;  3P4P C;  1OMI A;  4Z1M H;  3RK3 E;  3AE9 D;  1NEN D;  4H13 B;  3AE9 C;  3AE8 D;  1OW6 A;  3P4Q D;  4OGQ B;  1NEN C;  3AE8 C;  3P4Q C;  1VF5 B;  4U7J A;  2D2C B;  1JB0 J;  2YMK A;  3AE5 C;  4R4L A;  5C2T D;  2OQQ A;  3IN6 A;  5C2T C;  3AEC D;  2WQY D;  3AEF D;  4YXD D;  3AEC C;  3D6Y A;  2O01 J;  2WQY C;  3AEF C;  4YXD C;  2E76 B;  3D70 A;  2QSI A;  3Q2Y A;  2H89 D;  5C3J D;  4YTP D;  3GF7 A;  1RQU A;  2G8Y A;  4TT3 H;  3RL0 g;  2H89 C;  4YTP C;  1UIX A;  3D6Z A;  3IAO A;  3AEA D;  4OGQ D;  1KMI Z;  1VL2 A;  2JP3 A;  3AEA C;  1EXJ A;  1NEK D;  4OGQ C;  1FDO A;  1NEK C;  5M1B A;  1KF6 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...