3AEEC

Crystal structure of porcine heart mitochondrial complex ii bound with atpenin a5
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with Atpenin A5
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 46
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3aeeC01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3aeeC02
3CIRC 4YSYD 4YSXC 4YSYC 2WU2C 3AEFC 3AE3D 3AE9D 5C3JC 3AEBD 3VR8D 3AE9C 3P4QD 2B76D 4YT0D 3P4RD 2WS3D 1YQ3D 3AE4C 4YT0C 3P4RC 1KFYD 3AE6D 1ZP0D 2G3AA 1YQ4D 1KFYC 3VR9D 1ZP0C 1KF6D 3VRAD 2BS2C 3VR9C 2BS3C 3AEED 3AEGD 2H88D 2BS4C 4KX6D 2WDQD 2H89D 3VRAC 3B71A 4YTMD 2H88C 3AE3C 4KX6C 2H89C 2WU5D 3AEBC 4YTMC 2WDVD 2WDRD 3VR8C 3AE1D 3P4SD 3SFDD 4YXDD 3P4QC 2WP9D 3AE7D 2B76C 2WDRC 3P4PD 3AE1C 2WS3C 1E7PC 3AE7C 1K05A 1YQ3C 1NEKD 3P4PC 1NEND 1OW6A 4YTPD 1OW8A 3AE6C 1NENC 1YQ4C 4YTPC 2FBWD 3AEAD 1KF6C 3VRBD 4YTND 3AE8D 3AEAC 3AEEC 3AEGC 1L0VD 1KTMA 2WDQC 3AE8C 1QLBC 3AE5D 3AEDD 1ZOYD 2WQYD 2WU5C 3CIRD 3AEDC 1ZOYC 2WDVC 3P4SC 3SFDC 4YSZD 4YXDC 2WP9C 2WU2D 3AEFD 5C3JD 5C2TD 3AECD 4YSZC 1OW7A 1PV3A 1NEKC 3SFED 5C2TC 3AECC 3AE2D 3SFEC 2FBWC 3AE2C 3ABVD 3AE4D 3S9OA 3VRBC 4YTNC 2ACZD 3ABVC 1L0VC 2ACZC 1K04A 3AE5C 4YSXD 2WQYC
chains in the Genus database with same CATH superfamily
3II6A 3BVHA 3E1IA 3RBZA 3V5BA 1L0LJ 2WT7B 3BCCJ 4YSYC 1HGVA 4W7YA 5CCGD 1SVFA 4K35A 3HD7B 1S5LH 3VN0A 1NU1K 2FFDB 2GUSA 2AEFA 4OVNF 2ZYGA 2P67A 3H32A 2W6AA 4D6TE 4L74A 1RE4A 3MZWB 5AVSB 1EDKA 3VMZA 1IO4A 2FFDC 1DD4A 1AQTA 3H1LG 1GL2A 1G1IA 1L0NJ 2WDRC 3P4PD 2WSCJ 1MUUA 5AW4B 3S1KA 1QL1A 3H6PA 1EZVD 1NJIQ 3Q1MA 3KZIH 2Q3IA 4YTND 2J5UA 3HE5A 1PP9G 1SQVE 2QJPB 2YKPA 4EOTA 1L2PA 1FS0E 1NTMG 1NGMB 4LLHA 1E5WA 1JM0A 1QVGO 2E5TA 3M91A 4H13D 2E75B 3FX0A 2QJPC 4WVZA 1BDCA 1OVVA 2IBZE 3E7KA 3Q5PA 3MUDA 3FGAD 3ABVD 4H13B 4YTNC 2FYUE 3RGUA 1EDIA 1U7MA 3L72E 1NAFA 1KB9H 1AFOA 1S4XA 2OYHA 3L70E 3CPWO 4H13C 1GMJA 2ZAEB 1L4AD 1KFMA 4H0LB 4NPEA 1ZRTD 2OYIB 3H1KE 1AQ5A 1L4AB 1OZHA 2BS3C 3PRJA 1FZGA 1FZCB 3D70A 4H0LC 1G2CB 1PFIA 2OTLP 4YTMD 4YPCA 1IK9A 5CCGA 2CPBA 1FZAA 2O1JA 2OYIC 2I1JA 3P4SD 1LT9C 4YXDD 2XV5A 4DCKA 1L4AC 3L75G 1USEA 1M90Q 1FZCC 4R4MA 2A06G 5BU8B 3V4WA 2JKVA 2PGDA 3H1HE 1TFFA 3L75D 1FBMA 3H1JG 1BSNA 2W6JH 1L0VD 4IOIH 1S1CX 3VONA 2QM7A 2K88A 1KYOD 5B5EE 2P10A 1T3UA 3P4SC 4YXDC 1M56D 1IFDA 5KTBA 1BE3E 1L0LG 3A3YB 5C2TC 3BCCG 2JJLA 1VQ6P 1BCCJ 3HE4A 5CCHD 1L0VC 3P8CD 4WY4B 4IL6H 1K04A 1P84E 2ZFCA 1FDMA 2J58A 2AEJA 1PGOA 1SQPK 2KOGA 1JY3N 1QGKB 5C39A 2H8PD 5CBNA 5CHXA 1LGHB 2BCCD 5KLVK 4IFDK 3TSIA 1URQD 4MN4C 1GW3A 2FKWB 1BGYD 3GHGB 4AUWA 5AW0B 3TGUD 2RN0A 2NPSD 1LTGC 2ZJSE 1ZW0A 1L0NG 2Y0CA 5CCHC 3CCQP 3G71P 3L74D 1CI6B 3VR9D 1ZP0C 1LTSC 2GM4A 1ZV8A 4U7JA 1SQQK 1RQUA 4WWIA 1S9KD 1JY2O 3RBXA 1T2KD 1LT9A 1YHQP 1YYCA 2WSFH 3AE7D 1Z56A 4QMAA 4N78D 2NPSC 2JDIH 1SQXE 1YBKA 2E74D 1PPJG 5TISE 3HRNA 5APWA 2KUBA 3NXSA 2KNCB 3AEAC 3BASA 1YIJP 1P84H 3CCVP 5KLVE 4HYTB 1X8YA 2KI7B 2KLUA 3F5HA 2Z4EA 3W67A 3TNUB 1OXZA 1VQ9P 1KB9D 1HJ0A 1VF5B 1KQLA 1SQQE 2AXTE 5L8RJ 2OARA 1KILE 3CMAP 1HVVA 1JY3P 2IZ0A 2N9BA 3H1IJ 1NTMK 1SQBD 1VF5C 3V2QA 4U3FJ 2PAJA 4DDGA 2OYOA 3RK3B 2NRGA 1SQVD 1LTIC 5TISH 1NKZB 2R3SA 2RMZA 2ZXXA 4I1LA 3U59A 1DD3A 5AW2B 4CPGA 1URQA 3M0DA 3GW6A 2Y0EA 3OAKA 2I1KA 4PD4I 2OTJP 2NPSA 1NEND 2HODA 2FYUD 2JP3A 2YNYA 1PP9E 3TF5A 1JY3O 1BSHA 2ZFYA 1EDJA 5AVYB 5KLIC 2AXTH 3L70D 1BCCG 2WWWA 2E76D 1OWAA 3PHLA 1X79B 1NWQA 3EFGA 5KKZB 4Z1MH 3AEFD 1LWUC 5C3JD 5BU5A 5DJUB 3CCUP 3L73E 1KC8Q 3H1KD 1QVFO 5KKZC 3CCLP 3H1LJ 2V7QJ 3M9QA 4DHIB 2ACZC 4H44D 2M3EA 2RH0A 3CX5I 4YSXC 3PH0A 4RKUJ 3AEFC 5C3JC 4H44B 4C7RA 4DZOA 1HUCA 2M3BA 3P4RD 1L0LK 1NTMJ 2R3CA 5CMZA 3VMAA 1KFYD 2AXCA 1QX8A 3AE6D 1GDTA 4H44C 2QJYB 3L71G 3F89A 1FZEA 1RE3C 1KORA 3A5TA 4OH8B 1HBWA 3I55P 1X22A 2ZXEB 2QJYC 1AV1A 4OWFA 4O9BA 3VTPC 1FDIA 5KJ7C 2YIUB 1EXJA 5DJTB 3CWBD 3AE6C 1L0NK 2QSIA 1P84D 3RK2D 3D6YA 2P7JA 4Y28J 2ZT9B 3AE8C 2YIUC 1RHZB 3B8EB 1LWUA 3AECD 1KFNA 3BCCE 2Z5HA 2ZT9C 3TK1A 2KXPB 3CXHI 3RL0B 2C0WA 1K9MQ 4U3FG 4JQ0D 1OVUA 1UIIA 2YMYA 3RK2C 3S9OA 2GUVA 2YO3A 1LT1A 1M1JA 3L75J 1N7SA 2UWJE 3RL0C 4ZMDA 4YSYD 2N1TB 2K1AA 1U7JA 2NZ2A 2AEMA 3PLNA 3E1RA 2HLOA 2JWAA 3JC22 3I56P 2XDJA 3HUSB 1RF1A 1PGQA 2K9YA 3GLMA 1SQXD 2N1TC 1L0NE 3T97B 4XE5B 1R8EA 3HD7D 1A02F 3TDKA 2FXPA 3SSUA 1GD2E 1RQVA 3NFQA 2WZ7A 5KLVD 3A0BE 4I6MC 2W8ZA 3Q5RA 2WDVD 2WDRD 1JCDA 1DEBA 5AW7B 2BCCJ 1IFMA 2DW3A 3P8MC 4DOJA 3W68A 1BGYJ 3HD7C 5AVQB 2FBWD 3FXDA 5APSA 3L74J 4IL6X 4L76A 1EZVG 1LTJB 3B5NB 1NTZD 3RK3E 1KILB 2Q7CA 1ZOYC 1N73A 2WDVC 3JCUE 3BRVB 1T8ZA 1LTJC 1NTKE 3SFEC 1VQLP 1KILC 4EDFA 2FBWC 3IF4A 1DEEG 2E75D 4LC1A 2WSCH 1SFCA 2FY8A 3FWNA 2YXRB 1N8RQ 1NU1E 2J59M 3CCSP 1JY2N 4C7NA 3A0BH 4ZKUA 3KPEA 3R4YA 1JMMA 2B76D 4I7ZB 1D7MA 5AVUB 5K5GB 1M57D 2E75C 2FXOA 1JO5A 1EXIA 4PJ0E 1M7LA 1EZVI 4H0LD 4JYBA 2WDQD 1GW4A 2Q6QA 2XNDH 4N3YB 3LW5H 1SQBJ 2B76C 1MKMA 2WT7A 5AVTB 3L73D 2KZIA 3JCUH 4JPZB 4KHXA 1OW8A 3HD7A 3U1AA 2A45G 3G4SP 1GZLA 5TJHA 2FFDA 1FDOA 1SQVJ 3QWOC 1Y8AA 2WDQC 5AVRB 2JO1A 3OA7A 4EI2A 2O01N 1IFIA 3CIRD 4TLFA 1LNQA 5C2TD 1PV3A 1W2EA 1IJDB 3O8ZA 1ZR4A 1NO4A 1AVYA 1PIXA 3AE4D 1YI2P 2FYUJ 1H89A 4GT1A 3KHUA 1N86A 5AW8B 5APVA 3CIRC 4PJ0H 1JY2P 1NAYA 1LP1B 1AA0A 4WY4D 1VPCA 3CLQA 3AE9C 2JEEA 3KXDA 4HJGH 2A45I 1RY3A 2KLVA 3AE4C 5AVZB 1JTHB 1ZP0D 2BCCG 3A0HE 1T6AA 2IX7C 1BGYG 3CCRP 2WSEJ 3TGUG 2KS1B 2O3JA 4WY4C 2H88C 2H89C 3L74G 2WP9D 4GODA 2IYOA 1KYOI 2FYNB 5AVWB 1OW6A 2D2CD 4YTPC 3C8VA 3GHGC 3AEAD 3M9HA 1JCCA 2FYNC 1DX7A 2OGUA 2OYIA 2D2CB 1IK7A 1T3JA 3AEDC 1L4AA 5B5EH 3O6QB 1FZCA 1Q2NA 2WP9C 3GF3A 1G2CA 4N6JA 3H1IE 3L71J 2D2CC 4U3FE 2YMKA 3AE2C 1SQPE 3CWBJ 3M06A 1Q7YQ 2QEXP 1E79H 3HTKB 5GTHE 1IFJA 3PJSK 1VF5D 3A0HH 3D6ZA 2R5BA 1YITP 1EDLA 1ZMEC 4D6TD 1FC2C 3ZDMA 2QG4A 4Y99B 1SQBG 1WRGA 2XU6A 4DT0A 2K3RA 3RK3D 5B66E 1EC5A 2M5AB 1H0TB 4Y99C 4WY4A 3B71A 1SQVG 1H8AA 1JB0J 1NTKD 2K37A 5CCHA 2B87B 3IN6A 4C46A 1ZR2A 1Q82Q 4ZKPA 2IFMA 3GHGA 3VRBD 2E42A 3RK3C 1EZVE 3H1LE 1NU1D 1KB9I 1KMIZ 2FYUG 2SPZA 1CI6A 5AW5B 5CJ4A 2WQYD 2IBZD 3V2NA 5GTHH 1OVRA 1G1JA 3D71A 2MJZA 1S72P 3C9IA 2M8RA 3L72G 1OW7A 4GIFA 1Q81Q 3V2RA 2O01J 3L70G 3SWYA 5AW9B 5APTA 4ASVA 3L72D 1U57A 3VRBC 2ACZD 1LTBC 1NTME 1LJ2A 1JMBA 5H2FE 4AYCA 4YSXD 2PFXA 2WQYC 1VQKP 2KNCA 3H1KG 1MZ9A 2E5YA 1NTZJ 3EQ2A 2W27A 3BRTB 4PV1B 3AEBD 1S5LX 3L36A 1Q90D 1H88A 3VOPA 3IFMA 1FJPA 2WS3D 5EFWB 4YT0C 1FOSE 2B89A 3V4QA 3CMEP 4JBZA 4W80A 4PV1C 4NPFX 3TNUA 1MV8A 3C1LA 3Q5SA 2LKMA 1HWTC 4BWNA 4DHJA 2WITA 5GTIE 1MFTA 4KX6C 3AEBC 3CCEP 1LTAC 4BRYB 3H1HD 2IFNA 5KJ7D 4OGQB 1VQOP 5AW3B 2WS3C 2E43A 2HPCB 1GTWA 2K9JB 1KQGB 1W5CE 3WUTA 2G8YA 1RF0C 4OGQC 1AJYA 3AE8D 5E79E 5H2FH 3CWBG 1BE3D 2I8DA 3L75E 2A06E 1NVOA 2ZT9D 3EFFK 3M9BA 2WVRA 2KB7P 2PRRA 1KYOE 2YKQA 3H1JE 3H32B 3U1CA 1NYHA 2KP8A 3H25A 4DDIA 3RL0D 3Q3DA 2BEZF 1GL2B 1RE4C 1L0LE 4FJVA 3P8CE 1YTZI 1IFNA 1ZLLA 3VR8D 5GTIH 1JOCA 3LIEA 2N1TD 2ITAA 3QH9A 1GL2C 3HE5B 1FOSF 2BCCE 1KN7A 2P58A 1YQ4D 1BGYE 1FZBA 2BS2C 1SQXG 4I6LA 3MTUE 1IC2A 1P84I 3VRAC 1K8AQ 3L74E 5E79H 5KAIE 3H1ID 4DJGA 3VR8C 3SFDD 1YJNP 3AE1C 1XTCC 5KLVG 4JF7A 2Q5UA 1SQPD 3HUSC 3BATA 3NTNA 4EYYQ 1SQBK 1YQ4C 2O1KA 1KYOH 3MUDC 4L73A 1RE3A 3N7NA 2OYHB 2VRSA 1ZOYD 3CC7P 3L37A 2BEQD 5M1BA 3GMAA 4WB4A 3SFDC 5KJ7A 1SQVK 2WU2D 1N2DC 1MFZA 3P32A 2XKMA 2BASA 4GDOA 4YSZC 2OYHC 1PPJE 3B5ND 1SQQD 3SFED 1JNMA 1KILD 3TGUJ 1NTZG 3P7KA 3IAOA 3MIWA 3A7OA 3V2PA 5APUA 1LTTC 1USDA 4R4LA 1KZUB 1NKNA 1DH3A 3N4XA 2Y9YA 2WTYA 3JSVC 1KB9E 4M3LA 3G3ZA 2N9YB 2FYUK 1VQ8P 2H7HA 2WU2C 3AE3D 4PD4E 1CSBA 2Y0DA 3B5NC 5CCGC 3P4QD 5KAIH 1SQBE 1X0TA 2Q3EA 4LDTA 1R5LA 3H1LD 3MD0A 1KF6D 1J1EB 3SWKA 1AVOA 2BS4C 2JR8A 4UB8E 1HTLC 1YJ9P 3PTZA 3AE3C 1PZQA 2R44A 2LR2A 3ITKA 2N1TA 3P4QC 1J1EC 3FXEA 1PP9D 1E7PC 3P4PC 3HE4B 3HUSA 4D6TJ 1NTMD 3PP5A 1JEKA 1FJKA 4I7ZC 1KF6C 1PGPA 3KYQA 3CX5E 3L73G 3T97A 1KTMA 3LW5J 3AE5D 1YJWP 1GU4A 5CBOA 1PGJA 2YO2A 2YXQB 3WU2E 2FYZA 2Y9ZA 5KAFE 4PD4H 4XFJA 3L35A 1NTKJ 1VQNP 2KSJA 1Y47A 2ZVOB 1BCCE 3ABVC 3TYYA 1J2JB 4IL6E 1KQSO 3MP7B 3AE5C 2L91A 2ZVNB 4GOFA 1LT9B 1NU1J 1Y9BA 2C9LY 3AE9D 1LTJA 3B5NA 4UB8H 4XA4A 1KILA 2WPRA 1YQ3D 1HH0A 4BXLA 4W7ZA 1FZFA 1SS1A 3L72J 3GG2A 3L70J 5CJ0A 3AEED 2H88D 2H89D 1PL5A 1J1DB 1EQ7A 1WT6A 2A06D 3CX5H 2WU5D 4YTMC 3VMXA 3CL3D 3S4RA 2W6BA 3CXHE 3IR9A 3H1JD 1KQFB 3A2AA 1OFCX 1K05A 1YQ3C 1OIPA 3L4FA 3H1KJ 4YTPD 1J1DC 3L71E 2ZYDA 3WU2H 5KAFH 1OX3A 1N7LA 3AEEC 4YXWH 2B9BA 3CWBE 1L0LD 3BCCD 3AEDD 1SQXK 2XNXA 1VQ7P 2WU5C 1NOHA 2P1JA 2QRXA 2WSEH 1FU1A 3H1HJ 3AE2D 1XTGB 2IDBA 1YTZT 4KJMA 3VP8A 3K5BA 1NHLA 2WSFJ 1GK6A 1URQB 1GU5A 4GKGA 4UB6E 1BE3J 2HYNA 1L0ND 1QLED 2NPSB 1VQ5P 2JWDA 2HODB 1X9VA 1URQC 2GA1A 2HFED 1NTZK 3CXHH 3M0DC 2Q1KA 5APYA 2KSEA 2L5GB 3SWFA 2HG5D 4D6TG 3KDPB 3VR9C 1SLQA 3AEGD 2YKOA 4ASWA 1ZXGA 2W83C 2QE7H 5APXA 1PPJD 2E74B 2R32A 1LP1A 2KIKA 2CPSA 1T2KC 4B86A 3AE7C 3V6IA 3WMM0 1NEKD 4RJTA 3CI9A 1WMKA 4L75A 2E74C 4WBAA 2LXCB 1NTKG 2OTKE 1S2EA 3AEGC 1JTHA 3R2PA 2QM8A 4PD4D 1R5SA 2Z5IA 2LXBA 2KS1A 4GOEA 1NTZE 4UB6H 1NEKC 1SQXJ 1VQMP 1NU1G 4IFMA 1FE6A 1M1KQ 2IBZG 4AQRD 3G9RA 1SQPJ 4LGDE 1SP4A 3MHVA 1VQPP 5KLVJ 3EWKA 2KYVA 2POHA 1DIPA 4TT3H 3O6QA 4YT0D 1SQQJ 2MKVA 4HB1A 4A7PA 4RO0A 2IZ1A 4HH2A 2QJKB 4PV1D 2IYPA 5KLIB 3I5CA 3CC2P 3CX5D 2C0XA 1M8OB 2PP6A 3Q2YA 1NH4A 2O01H 1UIXA 4KX6D 3OW2O 1LWUB 5B66H 2C9NY 2QJKC 3HTKA 5APQA 1VDFA 1N7SD 1IFPA 1VL2A 1RH5B 2IBZI 1KD1Q 3FWLA 3WUVA 3M0AA 1OMIA 3CD6P 1BCCD 1M1JB 1HGZA 1NENC 2HR3A 1N7SB 2XZRA 2IPPA 2E76B 4OGQD 3LIDA 3H1HG 1CZQA 1GK4A 5AW1B 4HKZH 1ZRTE 1QLBC 2WMMA 3VMYA 3G6EP 2V7QH 1M1JC 1S3JA 1RF1B 1N7SC 2E76C 2Q9IA 1H0TA 2M5AA 1KV4A 1FAVA 3CC4P 5BVZA 1BE3G 1TU3F 1PP9J 2R5DA 2QA4P 1RF1C 2WSSH 2H43A 2B87A 3WUUA 1CW5A 4IFFA 2FXMA 2WPSA 4NPDA 1JUNA 1W2BO 3CCJP 3CCMP 3CXHD 4EIJA 4ZNCA 1ZN5A 3L73J 5AVXB 1GL2D 1IZNB 2OQQA 5AVVB 3L71D 2RKLA 3VP9A 2ZYAA 4K3AA 3P4RC 1Q86Q 3UIAA 2G3AA 1KFYC 3NMDA 2M0BA 1N73B 3VRAD 1HF9A 1K73Q 1S5LE 2WPVB 1SFCD 1QL2A 2B88A 3AE1D 2P2UA 2CK3H 3RL0g 1QEXA 3KQGA 5AW6B 1BDDA 1N73C 3RK2B 2KK7A 1A02J 2W90A 2A45H 3H1IG 1SFCB 3TGUE 3USSA 4I2LC 3GF7A 1VQ4P 1SQPG 4C7NB 3VYIA 4JYCA 1SFCC 4U3FD 2QVAA 4YSZD 1S9KE 2QIWA 3OJAB 4KT0J 2V4HA 4RESB 3AECC 3KZIE 3MGNA 3H1JJ 2WPQA 4BRYA 2KZJA 4N78E 1RF0A 4DHZA 2HPCA 1SQQG 1HJBA 2K9JA 1NTKK 3B4SA
chains in the Genus database with same CATH topology
3CIRC 2BEZF 4YSYD 4YSXC 1VF5D 2NZ2A 3D6ZA 1Y9BA 4RKUJ 4YSYC 1VF5C 3AEFC 4H13C 2WU2C 1GMJA 3AE3D 3AE9D 5C3JC 4PV1B 3AEBD 1S5LX 1DIPA 1Q90D 3VR8D 4H44B 3AE9C 3R4YA 1ZMEC 4TT3H 2K9YA 3P4QD 2B76D 3O6QA 3GLMA 4YT0D 4I7ZB 2OQQA 3P4RD 2WS3D 2MKVA 1YQ3D 4H0LB 3AE4C 4YT0C 3P4RC 4PV1D 2E75C 1KFYD 3T97B 3AE6D 1ZP0D 1R8EA 4PV1C 2G3AA 1YQ4D 1EXIA 1KFYC 4H44C 3Q2YA 3VR9D 2FXPA 1ZP0C 1KF6D 3Q5SA 4U7JA 1UIXA 4H0LD 3VRAD 1RQUA 2BS2C 3VR9C 2WSEJ 2BS3C 3AEED 3AEGD 1RQVA 2H88D 2BS4C 1HF9A 3D70A 2H89D 2WDQD 4KX6D 4H0LC 1PL5A 3VRAC 3B71A 4YTMD 1KORA 2H88C 2QJKC 3AE3C 4KX6C 2H89C 2WPVB 1DD3A 1DD4A 3AEBC 2WU5D 4YTMC 1JB0J 1VL2A 3Q5RA 2WDVD 2WDRD 3VR8C 3AE1D 2E74B 3P4SD 3SFDD 3RL0g 4YXDD 3P4QC 2QJYC 2WP9D 3AE7D 4OGQB 1MKMA 2B76C 2WDRC 3P4PD 2WSCJ 3AE1C 1KQFB 2WS3C 1E7PC 1FDIA 1K05A 3AE7C 1YQ3C 1NEKD 1EXJA 3P4PC 4R4MA 1NEND 1OW6A 1OMIA 2D2CD 3IN6A 4YTPD 1WMKA 1OW8A 2JP3A 2E74D 3AE6C 3Q1MA 1NENC 1YQ4C 4YTPC 2E76B 4OGQD 3C8VA 1KQGB 2FBWD 2QSIA 4I7ZC 3AEAD 2E74C 1KF6C 3D6YA 3VRBD 2G8YA 4YTND 2J5UA 1FDOA 4OGQC 1AJYA 3AE8D 1ZRTE 3AEAC 3AEEC 3AEGC 1L0VD 1KTMA 4Y28J 2FYNC 3GF7A 2WDQC 4IL6X 2ZT9B 3AE8C 2YIUC 5KLIC 3LW5J 2JO1A 2D2CB 1QLBC 3AE5D 1S1CX 3AEDD 1ZOYD 1KMIZ 2WQYD 2E76D 1NGMB 2WU5C 2BEQD 3RK3E 3CIRD 5M1BA 3GMAA 1IK7A 3AEDC 1ZOYC 2WDVC 2P10A 2E76C 3D71A 3P4SC 3SFDC 4YSZD 4YXDC 4Z1MH 2WP9C 4H13D 3GF3A 2WU2D 3AEFD 5C3JD 2ZT9D 5C2TD 2QIWA 4GDOA 3AECD 4YSZC 1OW7A 2E75B 2QJPC 1PV3A 4KT0J 1NEKC 3SFED 2O01J 2ZT9C 3AECC 5C2TC 3Q5PA 2D2CC 4XFJA 1TU3F 3AE2D 3SFEC 3IAOA 2YMKA 3FGAD 1PIXA 3G9RA 2IDBA 2FBWC 3AE2C 3ABVD 1NYHA 3AE4D 3S9OA 1U57A 1HJ0A 1VF5B 2E75D 4H13B 5KKZC 5L8RJ 2ACZD 4YTNC 3VRBC 3ABVC 3H25A 1KILE 2V7QJ 1L0VC 4R4LA 2ACZC 2WSFJ 1K04A 4H44D 3AE5C 4YSXD 3EWKA 3Q3DA 2WQYC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CIR C;  4YSY D;  4YSX C;  4YSY C;  2WU2 C;  3AEF C;  3AE3 D;  3AE9 D;  5C3J C;  3AEB D;  3VR8 D;  3AE9 C;  3P4Q D;  2B76 D;  4YT0 D;  3P4R D;  2WS3 D;  1YQ3 D;  3AE4 C;  4YT0 C;  3P4R C;  1KFY D;  3AE6 D;  1ZP0 D;  2G3A A;  1YQ4 D;  1KFY C;  3VR9 D;  1ZP0 C;  1KF6 D;  3VRA D;  2BS2 C;  3VR9 C;  2BS3 C;  3AEE D;  3AEG D;  2H88 D;  2BS4 C;  4KX6 D;  2WDQ D;  2H89 D;  3VRA C;  3B71 A;  4YTM D;  2H88 C;  3AE3 C;  4KX6 C;  2H89 C;  2WU5 D;  3AEB C;  4YTM C;  2WDV D;  2WDR D;  3VR8 C;  3AE1 D;  3P4S D;  3SFD D;  4YXD D;  3P4Q C;  2WP9 D;  3AE7 D;  2B76 C;  2WDR C;  3P4P D;  3AE1 C;  2WS3 C;  1E7P C;  3AE7 C;  1K05 A;  1YQ3 C;  1NEK D;  3P4P C;  1NEN D;  1OW6 A;  4YTP D;  1OW8 A;  3AE6 C;  1NEN C;  1YQ4 C;  4YTP C;  2FBW D;  3AEA D;  1KF6 C;  3VRB D;  4YTN D;  3AE8 D;  3AEA C;  3AEE C;  3AEG C;  1L0V D;  1KTM A;  2WDQ C;  3AE8 C;  1QLB C;  3AE5 D;  3AED D;  1ZOY D;  2WQY D;  2WU5 C;  3CIR D;  3AED C;  1ZOY C;  2WDV C;  3P4S C;  3SFD C;  4YSZ D;  4YXD C;  2WP9 C;  2WU2 D;  3AEF D;  5C3J D;  5C2T D;  3AEC D;  4YSZ C;  1OW7 A;  1PV3 A;  1NEK C;  3SFE D;  5C2T C;  3AEC C;  3AE2 D;  3SFE C;  2FBW C;  3AE2 C;  3ABV D;  3AE4 D;  3S9O A;  3VRB C;  4YTN C;  2ACZ D;  3ABV C;  1L0V C;  2ACZ C;  1K04 A;  3AE5 C;  4YSX D;  2WQY C; 
#chains in the Genus database with same CATH topology
 3II6 A;  3BVH A;  3E1I A;  3RBZ A;  3V5B A;  1L0L J;  2WT7 B;  3BCC J;  4YSY C;  1HGV A;  4W7Y A;  5CCG D;  1SVF A;  4K35 A;  3HD7 B;  1S5L H;  3VN0 A;  1NU1 K;  2FFD B;  2GUS A;  2AEF A;  4OVN F;  2ZYG A;  2P67 A;  3H32 A;  2W6A A;  4D6T E;  4L74 A;  1RE4 A;  3MZW B;  5AVS B;  1EDK A;  3VMZ A;  1IO4 A;  2FFD C;  1DD4 A;  1AQT A;  3H1L G;  1GL2 A;  1G1I A;  1L0N J;  2WDR C;  3P4P D;  2WSC J;  1MUU A;  5AW4 B;  3S1K A;  1QL1 A;  3H6P A;  1EZV D;  1NJI Q;  3Q1M A;  3KZI H;  2Q3I A;  4YTN D;  2J5U A;  3HE5 A;  1PP9 G;  1SQV E;  2QJP B;  2YKP A;  4EOT A;  1L2P A;  1FS0 E;  1NTM G;  1NGM B;  4LLH A;  1E5W A;  1JM0 A;  1QVG O;  2E5T A;  3M91 A;  4H13 D;  2E75 B;  3FX0 A;  2QJP C;  4WVZ A;  1BDC A;  1OVV A;  2IBZ E;  3E7K A;  3Q5P A;  3MUD A;  3FGA D;  3ABV D;  4H13 B;  4YTN C;  2FYU E;  3RGU A;  1EDI A;  1U7M A;  3L72 E;  1NAF A;  1KB9 H;  1AFO A;  1S4X A;  2OYH A;  3L70 E;  3CPW O;  4H13 C;  1GMJ A;  2ZAE B;  1L4A D;  1KFM A;  4H0L B;  4NPE A;  1ZRT D;  2OYI B;  3H1K E;  1AQ5 A;  1L4A B;  1OZH A;  2BS3 C;  3PRJ A;  1FZG A;  1FZC B;  3D70 A;  4H0L C;  1G2C B;  1PFI A;  2OTL P;  4YTM D;  4YPC A;  1IK9 A;  5CCG A;  2CPB A;  1FZA A;  2O1J A;  2OYI C;  2I1J A;  3P4S D;  1LT9 C;  4YXD D;  2XV5 A;  4DCK A;  1L4A C;  3L75 G;  1USE A;  1M90 Q;  1FZC C;  4R4M A;  2A06 G;  5BU8 B;  3V4W A;  2JKV A;  2PGD A;  3H1H E;  1TFF A;  3L75 D;  1FBM A;  3H1J G;  1BSN A;  2W6J H;  1L0V D;  4IOI H;  1S1C X;  3VON A;  2QM7 A;  2K88 A;  1KYO D;  5B5E E;  2P10 A;  1T3U A;  3P4S C;  4YXD C;  1M56 D;  1IFD A;  5KTB A;  1BE3 E;  1L0L G;  3A3Y B;  5C2T C;  3BCC G;  2JJL A;  1VQ6 P;  1BCC J;  3HE4 A;  5CCH D;  1L0V C;  3P8C D;  4WY4 B;  4IL6 H;  1K04 A;  1P84 E;  2ZFC A;  1FDM A;  2J58 A;  2AEJ A;  1PGO A;  1SQP K;  2KOG A;  1JY3 N;  1QGK B;  5C39 A;  2H8P D;  5CBN A;  5CHX A;  1LGH B;  2BCC D;  5KLV K;  4IFD K;  3TSI A;  1URQ D;  4MN4 C;  1GW3 A;  2FKW B;  1BGY D;  3GHG B;  4AUW A;  5AW0 B;  3TGU D;  2RN0 A;  2NPS D;  1LTG C;  2ZJS E;  1ZW0 A;  1L0N G;  2Y0C A;  5CCH C;  3CCQ P;  3G71 P;  3L74 D;  1CI6 B;  3VR9 D;  1ZP0 C;  1LTS C;  2GM4 A;  1ZV8 A;  4U7J A;  1SQQ K;  1RQU A;  4WWI A;  1S9K D;  1JY2 O;  3RBX A;  1T2K D;  1LT9 A;  1YHQ P;  1YYC A;  2WSF H;  3AE7 D;  1Z56 A;  4QMA A;  4N78 D;  2NPS C;  2JDI H;  1SQX E;  1YBK A;  2E74 D;  1PPJ G;  5TIS E;  3HRN A;  5APW A;  2KUB A;  3NXS A;  2KNC B;  3AEA C;  3BAS A;  1YIJ P;  1P84 H;  3CCV P;  5KLV E;  4HYT B;  1X8Y A;  2KI7 B;  2KLU A;  3F5H A;  2Z4E A;  3W67 A;  3TNU B;  1OXZ A;  1VQ9 P;  1KB9 D;  1HJ0 A;  1VF5 B;  1KQL A;  1SQQ E;  2AXT E;  5L8R J;  2OAR A;  1KIL E;  3CMA P;  1HVV A;  1JY3 P;  2IZ0 A;  2N9B A;  3H1I J;  1NTM K;  1SQB D;  1VF5 C;  3V2Q A;  4U3F J;  2PAJ A;  4DDG A;  2OYO A;  3RK3 B;  2NRG A;  1SQV D;  1LTI C;  5TIS H;  1NKZ B;  2R3S A;  2RMZ A;  2ZXX A;  4I1L A;  3U59 A;  1DD3 A;  5AW2 B;  4CPG A;  1URQ A;  3M0D A;  3GW6 A;  2Y0E A;  3OAK A;  2I1K A;  4PD4 I;  2OTJ P;  2NPS A;  1NEN D;  2HOD A;  2FYU D;  2JP3 A;  2YNY A;  1PP9 E;  3TF5 A;  1JY3 O;  1BSH A;  2ZFY A;  1EDJ A;  5AVY B;  5KLI C;  2AXT H;  3L70 D;  1BCC G;  2WWW A;  2E76 D;  1OWA A;  3PHL A;  1X79 B;  1NWQ A;  3EFG A;  5KKZ B;  4Z1M H;  3AEF D;  1LWU C;  5C3J D;  5BU5 A;  5DJU B;  3CCU P;  3L73 E;  1KC8 Q;  3H1K D;  1QVF O;  5KKZ C;  3CCL P;  3H1L J;  2V7Q J;  3M9Q A;  4DHI B;  2ACZ C;  4H44 D;  2M3E A;  2RH0 A;  3CX5 I;  4YSX C;  3PH0 A;  4RKU J;  3AEF C;  5C3J C;  4H44 B;  4C7R A;  4DZO A;  1HUC A;  2M3B A;  3P4R D;  1L0L K;  1NTM J;  2R3C A;  5CMZ A;  3VMA A;  1KFY D;  2AXC A;  1QX8 A;  3AE6 D;  1GDT A;  4H44 C;  2QJY B;  3L71 G;  3F89 A;  1FZE A;  1RE3 C;  1KOR A;  3A5T A;  4OH8 B;  1HBW A;  3I55 P;  1X22 A;  2ZXE B;  2QJY C;  1AV1 A;  4OWF A;  4O9B A;  3VTP C;  1FDI A;  5KJ7 C;  2YIU B;  1EXJ A;  5DJT B;  3CWB D;  3AE6 C;  1L0N K;  2QSI A;  1P84 D;  3RK2 D;  3D6Y A;  2P7J A;  4Y28 J;  2ZT9 B;  3AE8 C;  2YIU C;  1RHZ B;  3B8E B;  1LWU A;  3AEC D;  1KFN A;  3BCC E;  2Z5H A;  2ZT9 C;  3TK1 A;  2KXP B;  3CXH I;  3RL0 B;  2C0W A;  1K9M Q;  4U3F G;  4JQ0 D;  1OVU A;  1UII A;  2YMY A;  3RK2 C;  3S9O A;  2GUV A;  2YO3 A;  1LT1 A;  1M1J A;  3L75 J;  1N7S A;  2UWJ E;  3RL0 C;  4ZMD A;  4YSY D;  2N1T B;  2K1A A;  1U7J A;  2NZ2 A;  2AEM A;  3PLN A;  3E1R A;  2HLO A;  2JWA A;  3JC2 2;  3I56 P;  2XDJ A;  3HUS B;  1RF1 A;  1PGQ A;  2K9Y A;  3GLM A;  1SQX D;  2N1T C;  1L0N E;  3T97 B;  4XE5 B;  1R8E A;  3HD7 D;  1A02 F;  3TDK A;  2FXP A;  3SSU A;  1GD2 E;  1RQV A;  3NFQ A;  2WZ7 A;  5KLV D;  3A0B E;  4I6M C;  2W8Z A;  3Q5R A;  2WDV D;  2WDR D;  1JCD A;  1DEB A;  5AW7 B;  2BCC J;  1IFM A;  2DW3 A;  3P8M C;  4DOJ A;  3W68 A;  1BGY J;  3HD7 C;  5AVQ B;  2FBW D;  3FXD A;  5APS A;  3L74 J;  4IL6 X;  4L76 A;  1EZV G;  1LTJ B;  3B5N B;  1NTZ D;  3RK3 E;  1KIL B;  2Q7C A;  1ZOY C;  1N73 A;  2WDV C;  3JCU E;  3BRV B;  1T8Z A;  1LTJ C;  1NTK E;  3SFE C;  1VQL P;  1KIL C;  4EDF A;  2FBW C;  3IF4 A;  1DEE G;  2E75 D;  4LC1 A;  2WSC H;  1SFC A;  2FY8 A;  3FWN A;  2YXR B;  1N8R Q;  1NU1 E;  2J59 M;  3CCS P;  1JY2 N;  4C7N A;  3A0B H;  4ZKU A;  3KPE A;  3R4Y A;  1JMM A;  2B76 D;  4I7Z B;  1D7M A;  5AVU B;  5K5G B;  1M57 D;  2E75 C;  2FXO A;  1JO5 A;  1EXI A;  4PJ0 E;  1M7L A;  1EZV I;  4H0L D;  4JYB A;  2WDQ D;  1GW4 A;  2Q6Q A;  2XND H;  4N3Y B;  3LW5 H;  1SQB J;  2B76 C;  1MKM A;  2WT7 A;  5AVT B;  3L73 D;  2KZI A;  3JCU H;  4JPZ B;  4KHX A;  1OW8 A;  3HD7 A;  3U1A A;  2A45 G;  3G4S P;  1GZL A;  5TJH A;  2FFD A;  1FDO A;  1SQV J;  3QWO C;  1Y8A A;  2WDQ C;  5AVR B;  2JO1 A;  3OA7 A;  4EI2 A;  2O01 N;  1IFI A;  3CIR D;  4TLF A;  1LNQ A;  5C2T D;  1PV3 A;  1W2E A;  1IJD B;  3O8Z A;  1ZR4 A;  1NO4 A;  1AVY A;  1PIX A;  3AE4 D;  1YI2 P;  2FYU J;  1H89 A;  4GT1 A;  3KHU A;  1N86 A;  5AW8 B;  5APV A;  3CIR C;  4PJ0 H;  1JY2 P;  1NAY A;  1LP1 B;  1AA0 A;  4WY4 D;  1VPC A;  3CLQ A;  3AE9 C;  2JEE A;  3KXD A;  4HJG H;  2A45 I;  1RY3 A;  2KLV A;  3AE4 C;  5AVZ B;  1JTH B;  1ZP0 D;  2BCC G;  3A0H E;  1T6A A;  2IX7 C;  1BGY G;  3CCR P;  2WSE J;  3TGU G;  2KS1 B;  2O3J A;  4WY4 C;  2H88 C;  2H89 C;  3L74 G;  2WP9 D;  4GOD A;  2IYO A;  1KYO I;  2FYN B;  5AVW B;  1OW6 A;  2D2C D;  4YTP C;  3C8V A;  3GHG C;  3AEA D;  3M9H A;  1JCC A;  2FYN C;  1DX7 A;  2OGU A;  2OYI A;  2D2C B;  1IK7 A;  1T3J A;  3AED C;  1L4A A;  5B5E H;  3O6Q B;  1FZC A;  1Q2N A;  2WP9 C;  3GF3 A;  1G2C A;  4N6J A;  3H1I E;  3L71 J;  2D2C C;  4U3F E;  2YMK A;  3AE2 C;  1SQP E;  3CWB J;  3M06 A;  1Q7Y Q;  2QEX P;  1E79 H;  3HTK B;  5GTH E;  1IFJ A;  3PJS K;  1VF5 D;  3A0H H;  3D6Z A;  2R5B A;  1YIT P;  1EDL A;  1ZME C;  4D6T D;  1FC2 C;  3ZDM A;  2QG4 A;  4Y99 B;  1SQB G;  1WRG A;  2XU6 A;  4DT0 A;  2K3R A;  3RK3 D;  5B66 E;  1EC5 A;  2M5A B;  1H0T B;  4Y99 C;  4WY4 A;  3B71 A;  1SQV G;  1H8A A;  1JB0 J;  1NTK D;  2K37 A;  5CCH A;  2B87 B;  3IN6 A;  4C46 A;  1ZR2 A;  1Q82 Q;  4ZKP A;  2IFM A;  3GHG A;  3VRB D;  2E42 A;  3RK3 C;  1EZV E;  3H1L E;  1NU1 D;  1KB9 I;  1KMI Z;  2FYU G;  2SPZ A;  1CI6 A;  5AW5 B;  5CJ4 A;  2WQY D;  2IBZ D;  3V2N A;  5GTH H;  1OVR A;  1G1J A;  3D71 A;  2MJZ A;  1S72 P;  3C9I A;  2M8R A;  3L72 G;  1OW7 A;  4GIF A;  1Q81 Q;  3V2R A;  2O01 J;  3L70 G;  3SWY A;  5AW9 B;  5APT A;  4ASV A;  3L72 D;  1U57 A;  3VRB C;  2ACZ D;  1LTB C;  1NTM E;  1LJ2 A;  1JMB A;  5H2F E;  4AYC A;  4YSX D;  2PFX A;  2WQY C;  1VQK P;  2KNC A;  3H1K G;  1MZ9 A;  2E5Y A;  1NTZ J;  3EQ2 A;  2W27 A;  3BRT B;  4PV1 B;  3AEB D;  1S5L X;  3L36 A;  1Q90 D;  1H88 A;  3VOP A;  3IFM A;  1FJP A;  2WS3 D;  5EFW B;  4YT0 C;  1FOS E;  2B89 A;  3V4Q A;  3CME P;  4JBZ A;  4W80 A;  4PV1 C;  4NPF X;  3TNU A;  1MV8 A;  3C1L A;  3Q5S A;  2LKM A;  1HWT C;  4BWN A;  4DHJ A;  2WIT A;  5GTI E;  1MFT A;  4KX6 C;  3AEB C;  3CCE P;  1LTA C;  4BRY B;  3H1H D;  2IFN A;  5KJ7 D;  4OGQ B;  1VQO P;  5AW3 B;  2WS3 C;  2E43 A;  2HPC B;  1GTW A;  2K9J B;  1KQG B;  1W5C E;  3WUT A;  2G8Y A;  1RF0 C;  4OGQ C;  1AJY A;  3AE8 D;  5E79 E;  5H2F H;  3CWB G;  1BE3 D;  2I8D A;  3L75 E;  2A06 E;  1NVO A;  2ZT9 D;  3EFF K;  3M9B A;  2WVR A;  2KB7 P;  2PRR A;  1KYO E;  2YKQ A;  3H1J E;  3H32 B;  3U1C A;  1NYH A;  2KP8 A;  3H25 A;  4DDI A;  3RL0 D;  3Q3D A;  2BEZ F;  1GL2 B;  1RE4 C;  1L0L E;  4FJV A;  3P8C E;  1YTZ I;  1IFN A;  1ZLL A;  3VR8 D;  5GTI H;  1JOC A;  3LIE A;  2N1T D;  2ITA A;  3QH9 A;  1GL2 C;  3HE5 B;  1FOS F;  2BCC E;  1KN7 A;  2P58 A;  1YQ4 D;  1BGY E;  1FZB A;  2BS2 C;  1SQX G;  4I6L A;  3MTU E;  1IC2 A;  1P84 I;  3VRA C;  1K8A Q;  3L74 E;  5E79 H;  5KAI E;  3H1I D;  4DJG A;  3VR8 C;  3SFD D;  1YJN P;  3AE1 C;  1XTC C;  5KLV G;  4JF7 A;  2Q5U A;  1SQP D;  3HUS C;  3BAT A;  3NTN A;  4EYY Q;  1SQB K;  1YQ4 C;  2O1K A;  1KYO H;  3MUD C;  4L73 A;  1RE3 A;  3N7N A;  2OYH B;  2VRS A;  1ZOY D;  3CC7 P;  3L37 A;  2BEQ D;  5M1B A;  3GMA A;  4WB4 A;  3SFD C;  5KJ7 A;  1SQV K;  2WU2 D;  1N2D C;  1MFZ A;  3P32 A;  2XKM A;  2BAS A;  4GDO A;  4YSZ C;  2OYH C;  1PPJ E;  3B5N D;  1SQQ D;  3SFE D;  1JNM A;  1KIL D;  3TGU J;  1NTZ G;  3P7K A;  3IAO A;  3MIW A;  3A7O A;  3V2P A;  5APU A;  1LTT C;  1USD A;  4R4L A;  1KZU B;  1NKN A;  1DH3 A;  3N4X A;  2Y9Y A;  2WTY A;  3JSV C;  1KB9 E;  4M3L A;  3G3Z A;  2N9Y B;  2FYU K;  1VQ8 P;  2H7H A;  2WU2 C;  3AE3 D;  4PD4 E;  1CSB A;  2Y0D A;  3B5N C;  5CCG C;  3P4Q D;  5KAI H;  1SQB E;  1X0T A;  2Q3E A;  4LDT A;  1R5L A;  3H1L D;  3MD0 A;  1KF6 D;  1J1E B;  3SWK A;  1AVO A;  2BS4 C;  2JR8 A;  4UB8 E;  1HTL C;  1YJ9 P;  3PTZ A;  3AE3 C;  1PZQ A;  2R44 A;  2LR2 A;  3ITK A;  2N1T A;  3P4Q C;  1J1E C;  3FXE A;  1PP9 D;  1E7P C;  3P4P C;  3HE4 B;  3HUS A;  4D6T J;  1NTM D;  3PP5 A;  1JEK A;  1FJK A;  4I7Z C;  1KF6 C;  1PGP A;  3KYQ A;  3CX5 E;  3L73 G;  3T97 A;  1KTM A;  3LW5 J;  3AE5 D;  1YJW P;  1GU4 A;  5CBO A;  1PGJ A;  2YO2 A;  2YXQ B;  3WU2 E;  2FYZ A;  2Y9Z A;  5KAF E;  4PD4 H;  4XFJ A;  3L35 A;  1NTK J;  1VQN P;  2KSJ A;  1Y47 A;  2ZVO B;  1BCC E;  3ABV C;  3TYY A;  1J2J B;  4IL6 E;  1KQS O;  3MP7 B;  3AE5 C;  2L91 A;  2ZVN B;  4GOF A;  1LT9 B;  1NU1 J;  1Y9B A;  2C9L Y;  3AE9 D;  1LTJ A;  3B5N A;  4UB8 H;  4XA4 A;  1KIL A;  2WPR A;  1YQ3 D;  1HH0 A;  4BXL A;  4W7Z A;  1FZF A;  1SS1 A;  3L72 J;  3GG2 A;  3L70 J;  5CJ0 A;  3AEE D;  2H88 D;  2H89 D;  1PL5 A;  1J1D B;  1EQ7 A;  1WT6 A;  2A06 D;  3CX5 H;  2WU5 D;  4YTM C;  3VMX A;  3CL3 D;  3S4R A;  2W6B A;  3CXH E;  3IR9 A;  3H1J D;  1KQF B;  3A2A A;  1OFC X;  1K05 A;  1YQ3 C;  1OIP A;  3L4F A;  3H1K J;  4YTP D;  1J1D C;  3L71 E;  2ZYD A;  3WU2 H;  5KAF H;  1OX3 A;  1N7L A;  3AEE C;  4YXW H;  2B9B A;  3CWB E;  1L0L D;  3BCC D;  3AED D;  1SQX K;  2XNX A;  1VQ7 P;  2WU5 C;  1NOH A;  2P1J A;  2QRX A;  2WSE H;  1FU1 A;  3H1H J;  3AE2 D;  1XTG B;  2IDB A;  1YTZ T;  4KJM A;  3VP8 A;  3K5B A;  1NHL A;  2WSF J;  1GK6 A;  1URQ B;  1GU5 A;  4GKG A;  4UB6 E;  1BE3 J;  2HYN A;  1L0N D;  1QLE D;  2NPS B;  1VQ5 P;  2JWD A;  2HOD B;  1X9V A;  1URQ C;  2GA1 A;  2HFE D;  1NTZ K;  3CXH H;  3M0D C;  2Q1K A;  5APY A;  2KSE A;  2L5G B;  3SWF A;  2HG5 D;  4D6T G;  3KDP B;  3VR9 C;  1SLQ A;  3AEG D;  2YKO A;  4ASW A;  1ZXG A;  2W83 C;  2QE7 H;  5APX A;  1PPJ D;  2E74 B;  2R32 A;  1LP1 A;  2KIK A;  2CPS A;  1T2K C;  4B86 A;  3AE7 C;  3V6I A;  3WMM 0;  1NEK D;  4RJT A;  3CI9 A;  1WMK A;  4L75 A;  2E74 C;  4WBA A;  2LXC B;  1NTK G;  2OTK E;  1S2E A;  3AEG C;  1JTH A;  3R2P A;  2QM8 A;  4PD4 D;  1R5S A;  2Z5I A;  2LXB A;  2KS1 A;  4GOE A;  1NTZ E;  4UB6 H;  1NEK C;  1SQX J;  1VQM P;  1NU1 G;  4IFM A;  1FE6 A;  1M1K Q;  2IBZ G;  4AQR D;  3G9R A;  1SQP J;  4LGD E;  1SP4 A;  3MHV A;  1VQP P;  5KLV J;  3EWK A;  2KYV A;  2POH A;  1DIP A;  4TT3 H;  3O6Q A;  4YT0 D;  1SQQ J;  2MKV A;  4HB1 A;  4A7P A;  4RO0 A;  2IZ1 A;  4HH2 A;  2QJK B;  4PV1 D;  2IYP A;  5KLI B;  3I5C A;  3CC2 P;  3CX5 D;  2C0X A;  1M8O B;  2PP6 A;  3Q2Y A;  1NH4 A;  2O01 H;  1UIX A;  4KX6 D;  3OW2 O;  1LWU B;  5B66 H;  2C9N Y;  2QJK C;  3HTK A;  5APQ A;  1VDF A;  1N7S D;  1IFP A;  1VL2 A;  1RH5 B;  2IBZ I;  1KD1 Q;  3FWL A;  3WUV A;  3M0A A;  1OMI A;  3CD6 P;  1BCC D;  1M1J B;  1HGZ A;  1NEN C;  2HR3 A;  1N7S B;  2XZR A;  2IPP A;  2E76 B;  4OGQ D;  3LID A;  3H1H G;  1CZQ A;  1GK4 A;  5AW1 B;  4HKZ H;  1ZRT E;  1QLB C;  2WMM A;  3VMY A;  3G6E P;  2V7Q H;  1M1J C;  1S3J A;  1RF1 B;  1N7S C;  2E76 C;  2Q9I A;  1H0T A;  2M5A A;  1KV4 A;  1FAV A;  3CC4 P;  5BVZ A;  1BE3 G;  1TU3 F;  1PP9 J;  2R5D A;  2QA4 P;  1RF1 C;  2WSS H;  2H43 A;  2B87 A;  3WUU A;  1CW5 A;  4IFF A;  2FXM A;  2WPS A;  4NPD A;  1JUN A;  1W2B O;  3CCJ P;  3CCM P;  3CXH D;  4EIJ A;  4ZNC A;  1ZN5 A;  3L73 J;  5AVX B;  1GL2 D;  1IZN B;  2OQQ A;  5AVV B;  3L71 D;  2RKL A;  3VP9 A;  2ZYA A;  4K3A A;  3P4R C;  1Q86 Q;  3UIA A;  2G3A A;  1KFY C;  3NMD A;  2M0B A;  1N73 B;  3VRA D;  1HF9 A;  1K73 Q;  1S5L E;  2WPV B;  1SFC D;  1QL2 A;  2B88 A;  3AE1 D;  2P2U A;  2CK3 H;  3RL0 g;  1QEX A;  3KQG A;  5AW6 B;  1BDD A;  1N73 C;  3RK2 B;  2KK7 A;  1A02 J;  2W90 A;  2A45 H;  3H1I G;  1SFC B;  3TGU E;  3USS A;  4I2L C;  3GF7 A;  1VQ4 P;  1SQP G;  4C7N B;  3VYI A;  4JYC A;  1SFC C;  4U3F D;  2QVA A;  4YSZ D;  1S9K E;  2QIW A;  3OJA B;  4KT0 J;  2V4H A;  4RES B;  3AEC C;  3KZI E;  3MGN A;  3H1J J;  2WPQ A;  4BRY A;  2KZJ A;  4N78 E;  1RF0 A;  4DHZ A;  2HPC A;  1SQQ G;  1HJB A;  2K9J A;  1NTK K;  3B4S A; 
#chains in the Genus database with same CATH homology
 3CIR C;  2BEZ F;  4YSY D;  4YSX C;  1VF5 D;  2NZ2 A;  3D6Z A;  1Y9B A;  4RKU J;  4YSY C;  1VF5 C;  3AEF C;  4H13 C;  2WU2 C;  1GMJ A;  3AE3 D;  3AE9 D;  5C3J C;  4PV1 B;  3AEB D;  1S5L X;  1DIP A;  1Q90 D;  3VR8 D;  4H44 B;  3AE9 C;  3R4Y A;  1ZME C;  4TT3 H;  2K9Y A;  3P4Q D;  2B76 D;  3O6Q A;  3GLM A;  4YT0 D;  4I7Z B;  2OQQ A;  3P4R D;  2WS3 D;  2MKV A;  1YQ3 D;  4H0L B;  3AE4 C;  4YT0 C;  3P4R C;  4PV1 D;  2E75 C;  1KFY D;  3T97 B;  3AE6 D;  1ZP0 D;  1R8E A;  4PV1 C;  2G3A A;  1YQ4 D;  1EXI A;  1KFY C;  4H44 C;  3Q2Y A;  3VR9 D;  2FXP A;  1ZP0 C;  1KF6 D;  3Q5S A;  4U7J A;  1UIX A;  4H0L D;  3VRA D;  1RQU A;  2BS2 C;  3VR9 C;  2WSE J;  2BS3 C;  3AEE D;  3AEG D;  1RQV A;  2H88 D;  2BS4 C;  1HF9 A;  3D70 A;  2H89 D;  2WDQ D;  4KX6 D;  4H0L C;  1PL5 A;  3VRA C;  3B71 A;  4YTM D;  1KOR A;  2H88 C;  2QJK C;  3AE3 C;  4KX6 C;  2H89 C;  2WPV B;  1DD3 A;  1DD4 A;  3AEB C;  2WU5 D;  4YTM C;  1JB0 J;  1VL2 A;  3Q5R A;  2WDV D;  2WDR D;  3VR8 C;  3AE1 D;  2E74 B;  3P4S D;  3SFD D;  3RL0 g;  4YXD D;  3P4Q C;  2QJY C;  2WP9 D;  3AE7 D;  4OGQ B;  1MKM A;  2B76 C;  2WDR C;  3P4P D;  2WSC J;  3AE1 C;  1KQF B;  2WS3 C;  1E7P C;  1FDI A;  1K05 A;  3AE7 C;  1YQ3 C;  1NEK D;  1EXJ A;  3P4P C;  4R4M A;  1NEN D;  1OW6 A;  1OMI A;  2D2C D;  3IN6 A;  4YTP D;  1WMK A;  1OW8 A;  2JP3 A;  2E74 D;  3AE6 C;  3Q1M A;  1NEN C;  1YQ4 C;  4YTP C;  2E76 B;  4OGQ D;  3C8V A;  1KQG B;  2FBW D;  2QSI A;  4I7Z C;  3AEA D;  2E74 C;  1KF6 C;  3D6Y A;  3VRB D;  2G8Y A;  4YTN D;  2J5U A;  1FDO A;  4OGQ C;  1AJY A;  3AE8 D;  1ZRT E;  3AEA C;  3AEE C;  3AEG C;  1L0V D;  1KTM A;  4Y28 J;  2FYN C;  3GF7 A;  2WDQ C;  4IL6 X;  2ZT9 B;  3AE8 C;  2YIU C;  5KLI C;  3LW5 J;  2JO1 A;  2D2C B;  1QLB C;  3AE5 D;  1S1C X;  3AED D;  1ZOY D;  1KMI Z;  2WQY D;  2E76 D;  1NGM B;  2WU5 C;  2BEQ D;  3RK3 E;  3CIR D;  5M1B A;  3GMA A;  1IK7 A;  3AED C;  1ZOY C;  2WDV C;  2P10 A;  2E76 C;  3D71 A;  3P4S C;  3SFD C;  4YSZ D;  4YXD C;  4Z1M H;  2WP9 C;  4H13 D;  3GF3 A;  2WU2 D;  3AEF D;  5C3J D;  2ZT9 D;  5C2T D;  2QIW A;  4GDO A;  3AEC D;  4YSZ C;  1OW7 A;  2E75 B;  2QJP C;  1PV3 A;  4KT0 J;  1NEK C;  3SFE D;  2O01 J;  2ZT9 C;  3AEC C;  5C2T C;  3Q5P A;  2D2C C;  4XFJ A;  1TU3 F;  3AE2 D;  3SFE C;  3IAO A;  2YMK A;  3FGA D;  1PIX A;  3G9R A;  2IDB A;  2FBW C;  3AE2 C;  3ABV D;  1NYH A;  3AE4 D;  3S9O A;  1U57 A;  1HJ0 A;  1VF5 B;  2E75 D;  4H13 B;  5KKZ C;  5L8R J;  2ACZ D;  4YTN C;  3VRB C;  3ABV C;  3H25 A;  1KIL E;  2V7Q J;  1L0V C;  4R4L A;  2ACZ C;  2WSF J;  1K04 A;  4H44 D;  3AE5 C;  4YSX D;  3EWK A;  3Q3D A;  2WQY C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...