3AEEC

Crystal structure of porcine heart mitochondrial complex ii bound with atpenin a5
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with Atpenin A5
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 46
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3aeeC01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3aeeC02
2FBWD 2WU2D 1ZP0C 1ZOYC 3AE6D 3P4RD 4YT0D 3VRAD 3AECD 5C2TD 3AE9D 3P4SC 3VRBC 3AEBD 1KTMA 2WP9C 3AE8C 4YTNC 1E7PC 2WU5D 1L0VD 2WQYD 3S9OA 3AEGD 3AEEC 2WS3D 3AE3D 3P4QC 3VR9C 4YTPC 2H88D 2BS4C 2B76C 1YQ3D 3P4PD 1KF6C 1OW7A 3SFDD 3B71A 1NEKD 3AE5C 3AEAC 4YXDD 1QLBC 2WDVD 2WDRC 2H89D 3SFEC 3CIRC 4YSXD 3P4SD 2ACZC 3ABVC 4YTMC 3AE1C 3AEFC 1YQ4C 3AE2D 3AE7D 5C3JD 3VR8D 4KX6D 4YSYC 3AEDD 1KFYD 2FBWC 1NEND 2WU2C 1K05A 4YSZD 3AE6C 3P4RC 4YT0C 1PV3A 3AE4D 3VRAC 3AECC 5C2TC 2WDQD 3AE9C 2BS3C 3AEBC 1ZP0D 1ZOYD 2WU5C 2WQYC 1L0VC 3VRBD 3AEGC 2WS3C 2G3AA 3AE3C 2H88C 2BS2C 2WP9D 1YQ3C 3AE8D 4YTND 3P4PC 3SFDC 3AEED 1NEKC 3P4QD 3VR9D 4YTPD 4YXDC 2WDVC 2B76D 2H89C 1OW6A 1OW8A 1KF6D 4YSXC 1K04A 3AEAD 3AE5D 3AE2C 3AE7C 2WDRD 5C3JC 3SFED 3VR8C 4KX6C 3CIRD 3AEDC 1KFYC 2ACZD 3ABVD 4YTMD 1NENC 3AE1D 3AEFD 1YQ4D 4YSZC 3AE4C 4YSYD 2WDQC
chains in the Genus database with same CATH superfamily
4H0LC 2DW3A 1SS1A 3T97A 2BASA 1ZOYC 4EYYQ 1QL1A 1YBKA 2W8ZA 2QJYC 3RL0g 2BCCD 3VMZA 2M3BA 3A5TA 4KT0J 2RH0A 2NRGA 2H88D 4C7NA 2M3EA 1KQGB 4OGQB 1GU4A 1L0LG 1SQVE 3HD7C 1BGYD 1KMIZ 3VR8D 1EXIA 3AE9C 1WRGA 3AEBC 3B8EB 4WY4C 2E75C 1VQLP 2FXOA 4K35A 1N73A 2WSSH 4HH2A 1LWUA 3VR9D 2IBZD 3C1LA 1SQQJ 2OYIC 2QIWA 2KB7P 3TDKA 1WMKA 2QVAA 1JCCA 2FYUJ 2FFDA 1P84I 2K88A 2Q3EA 2WDRD 2PGDA 3VP8A 1BE3G 4TLFA 1W2EA 1YTZI 2HFED 1NU1K 1SVFA 3H1KG 1PGOA 2WPQA 4W80A 3L75J 3HE4B 3P4RD 2O1JA 2XV5A 1LP1A 2KSEA 4I7ZB 1KB9H 5B66H 1SQBG 1SQXE 2E5TA 3RK3C 1Y8AA 2JWAA 2WWWA 3A0HE 3VONA 2RMZA 1KILB 3CC2P 1VQKP 1SQPD 1FDIA 2WMMA 4H0LB 1BSHA 3CIRC 3CWBJ 1SFCA 3F5HA 4QMAA 2ITAA 5KLVG 5KTBA 2QJYB 3L70J 3M0AA 4UB6H 1J1DC 1VDFA 1HF9A 3AECC 4I1LA 2WPSA 1GL2A 2W90A 2R32A 3G9RA 1KQFB 2LXCB 4IOIH 5C39A 4C46A 1NYHA 2QA4P 4ZKUA 2WS3C 3AE3C 1LTBC 1URQA 3VMAA 1PIXA 3EFFK 1JM0A 1ZR2A 5KLVD 1PL5A 3TSIA 1YITP 5CCHC 2OTLP 1J2JB 1VQMP 3JC22 1OMIA 5DJTB 2RN0A 2CK3H 1SQVG 1IFPA 4KX6C 3SWYA 3N7NA 1KYOD 5AW7B 4WY4B 1BCCE 2E75B 3A3YB 4PD4D 4N6JA 5CCGC 2E76D 4PJ0H 3H1IJ 3WUTA 3VRAD 5C2TD 3P4SC 1P84E 2OYIB 1RF1C 2XZRA 1QX8A 3RBXA 3VTPC 2WU5D 1M1JA 1WT6A 2OGUA 3KDPB 1IO4A 4IL6X 1JY3O 1KF6C 4I2LC 3B71A 2WZ7A 2ZT9D 4JYCA 3TGUE 2H89D 2KSJA 3V2RA 3IF4A 1HVVA 2N1TD 1JNMA 3BRTB 2QJPC 3L36A 1S5LH 3B5NA 3CXHI 1M56D 4UB8E 4YT0C 1KFNA 3RK3B 1FZAA 4ZNCA 3V2QA 2JEEA 1ZP0D 4A7PA 1KD1Q 3M9BA 2WQYC 1L0VC 3VRBD 2KP8A 1L0NE 2RKLA 2BS2C 2MKVA 1W2BO 1SQXG 1EC5A 1AQ5A 3V2NA 1OVVA 1YYCA 1IK9A 1M7LA 4JYBA 2Z4EA 1J1DB 4DCKA 3AE7C 1PP9E 2K1AA 3L74E 1FJKA 1NO4A 3AE1D 1EDLA 2NPSD 2Q5UA 1N8RQ 1R8EA 1ZLLA 3H1HJ 3EQ2A 1L4AD 1JTHB 3N4XA 1OWAA 5L8RJ 4GKGA 2YIUC 4YTNC 1G2CB 1NU1D 1QGKB 1YJ9P 2H7HA 1YQ3D 2JR8A 1NTZE 5B5EH 3L73J 2JKVA 3SFEC 4L76A 2KXPB 5KLIC 3WMM0 2OTJP 1MFZA 2FXMA 4JBZA 1LNQA 2MJZA 1OFCX 4M3LA 1NTMK 5GTIH 1RE4C 3CWBD 3CX5H 2SPZA 1BCCG 2BCCE 1K05A 1RF1B 3HE5B 2WDQD 3RK2D 3E1RA 1VQNP 5AVVB 1X22A 2O3JA 1UIXA 1DD3A 3BRVB 2G3AA 3HE4A 3AEED 3F89A 1NEKC 1CSBA 3P8CD 2QJPB 1JUNA 4N78D 1BGYE 3CMEP 3I5CA 1E79H 1JY2N 4NPFX 3AE5D 4DDGA 1R5SA 4DT0A 2HLOA 1NTKG 4ASVA 1CI6B 1KILA 1JMBA 4DHIB 2KI7B 4FJVA 5KJ7C 1A02J 2AEJA 1KYOI 2HPCB 1U7MA 1AJYA 1L0LJ 2WSEJ 1FZCC 1EDKA 2IBZE 3AE8C 4DZOA 4LGDE 1ZN5A 1L0NG 5KAIH 2QSIA 2IDBA 5DJUB 2JP3A 2E5YA 3I55P 4YSXD 5APSA 1RE3C 1PP9G 3L72J 4YXWH 1K9MQ 1YJNP 2D2CD 4RO0A 3AEDD 5TISE 2FBWC 3TK1A 2Y9YA 2YIUB 2QM7A 1VQ8P 1ZRTE 5CBOA 1N7SD 4WY4A 1VF5C 1VQ6P 1BE3J 1S3JA 2K9JB 1FAVA 1SQPE 5KLIB 4AUWA 1H88A 1S2EA 3JCUE 1PGQA 3U1CA 4LLHA 1FOSF 2OYIA 2XNXA 3WU2E 4GOFA 3IFMA 2E74D 1KC8Q 1SQBJ 3CLQA 3RGUA 1NENC 2OQQA 1TFFA 2K9YA 2BCCG 3IR9A 1NKZB 1FZFA 3BASA 4JPZB 3H1HD 1GW4A 2Y0EA 3CCEP 3H1LD 4U7JA 5KLVE 1QL2A 3CPWO 3S9OA 2ZYAA 1X79B 3CI9A 2KZIA 2BS4C 1OX3A 1BDDA 1NH4A 4BXLA 1VL2A 1IFNA 1KYOE 1BGYG 1G1IA 3C8VA 3LIEA 4ASWA 1EQ7A 2R3SA 4YTMC 3BCCD 4PD4E 3AEFC 1GU5A 1CW5A 5C3JD 4U3FD 1LTJC 1FZCB 1IJDB 3A0HH 2G8YA 1FC2C 3CCMP 2JJLA 2VRSA 2KUBA 2KZJA 3R4YA 4O9BA 3CXHD 2ZYDA 1SQVJ 2YMKA 1NTMD 3PJSK 3V4WA 2IBZG 1TU3F 2H88C 1M1KQ 2K37A 4R4MA 1NKNA 2UWJE 1JTHA 3V5BA 3P32A 3PHLA 5CCHA 1S5LX 3CCSP 1G2CA 3AEAD 3Q2YA 5BU8B 3VR8C 1K8AQ 1SQQK 1UIIA 1T6AA 3WUUA 1YQ4D 1LJ2A 2FYUK 2KK7A 1OVUA 2CPBA 1VF5B 4I6LA 1JMMA 2NZ2A 5CCGA 1S4XA 1PPJD 1IC2A 2YO3A 2KIKA 2B87B 3FXDA 1E7PC 3CL3D 1RF1A 1SQPG 3VR9C 3HE5A 4RESB 1MV8A 1M90Q 2KS1B 2WDRC 1P84H 2V7QH 2OYOA 2YKOA 4CPGA 1SQXJ 4GDOA 3CCVP 2Q9IA 1KFYD 2YKQA 1Q86Q 3PP5A 3WUVA 3P4RC 3AE4D 1IFDA 2B9BA 3VN0A 4GODA 2BS3C 2YMYA 1RF0C 3MP7B 2IYOA 1NU1E 1CI6A 4AYCA 1ZW0A 1GDTA 2M5AB 5APYA 4UB8H 2HPCA 3PH0A 2A06D 1NAFA 5CBNA 1LTJB 4HJGH 5APVA 1LT9C 4LC1A 3M9HA 3L71D 2HYNA 1JB0J 1EDJA 4WB4A 3MD0A 3HD7B 4D6TD 3USSA 2OTKE 1NGMB 1H8AA 2ZVOB 5AW5B 3M0DA 3P8CE 2WTYA 2KLVA 4N78E 3D6YA 1BCCJ 2C9NY 3M9QA 1JO5A 3EFGA 1IFMA 5M1BA 2K9JA 3P4SD 3MUDC 2FXPA 2V7QJ 2YXQB 1AV1A 4WVZA 1H0TB 1RE4A 1VQ4P 2E76C 5AW3B 4YSZD 3KXDA 2KLUA 4KJMA 2HG5D 3VRAC 1FOSE 3FXEA 5C2TC 1JCDA 1FZBA 3TGUJ 2QEXP 2WU5C 2W6AA 1NTKE 1KQSO 4H13D 1DIPA 2XU6A 2B89A 3H1JJ 2ZT9C 1FZGA 3OAKA 1JY3N 2B76D 4H44D 2H89C 1LGHB 2N1TC 2HODB 1K04A 3CCRP 2C0XA 2R5DA 2P7JA 5AVUB 3A0BE 2JDIH 1SFCD 1VQPP 1QVGO 1L0NJ 3GF3A 4BWNA 1G1JA 3L75G 5KJ7A 1ZP0C 3Q1MA 3GLMA 3VMYA 1GL2D 5CJ0A 3VRBC 1ZR4A 2J58A 1SQQD 1NU1G 1FZCA 1PP9J 4OH8B 3L74J 4Y99C 2IX7C 2FYUD 1EZVD 1LT9B 1URQD 3AEGD 2QJKC 3A2AA 1GK6A 3D70A 4DJGA 1RQUA 2WVRA 4TT3H 3SFDD 1CZQA 3UIAA 2WDVD 2ZYGA 5AVYB 3CWBG 5AW4B 1DH3A 3GF7A 1HBWA 3VOPA 4OWFA 3AE1C 3L75D 1ZXGA 1E5WA 1RE3A 2NPSC 5APUA 1S72P 4L73A 3H1HE 1HJBA 1L4AC 2IFNA 1MZ9A 3H1LE 1PV3A 1IFIA 1S9KD 1NTZJ 2Y9ZA 1LTGC 5APQA 1IZNB 3OJAB 2WP9D 5TISH 4PV1D 1YQ3C 3CX5I 5APTA 2Y0CA 5KAFE 2BCCJ 2A45I 3QWOC 4YTPD 2W27A 1NWQA 3BCCE 2W83C 2LKMA 3L70D 2BEQD 4U3FE 2B87A 2E76B 5KKZC 2WITA 3RL0D 1U57A 3QH9A 1S1CX 2ACZD 3ABVD 4KHXA 3B5ND 3JCUH 3CXHE 2KS1A 2WDQC 3RK2C 3C9IA 1NTME 2WT7B 2AXCA 3NFQA 3WU2H 1Q90D 4HYTB 2ZT9B 4XA4A 1EXJA 1KFMA 1NOHA 3W68A 3ITKA 2N1TB 3AEEC 1L0LK 1M57D 1RHZB 1M8OB 1LTAC 1NVOA 3CC7P 3P4PD 1N7LA 3S4RA 3AE5C 4YXDD 1DX7A 1AQTA 2W6JH 3O6QA 2M5AA 5AW6B 3AE2D 3H1ID 1T2KD 1BDCA 2L5GB 2CPSA 1PPJE 2AXTE 2Z5IA 4DDIA 4DHJA 4OGQD 1LTJA 1KB9D 1YJWP 1KYOH 3V4QA 4GT1A 2QJKB 2YKPA 2BEZF 2M8RA 4PD4H 3GHGC 2B88A 2WSFH 3MGNA 3TGUD 1FZEA 3HD7A 3CD6P 3P4QD 2XKMA 2NPSB 3S1KA 3NTNA 3TF5A 3H1JD 4IFDK 4YSXC 1L4AB 5BU5A 3E7KA 3Q5SA 2D2CC 3JSVC 4GIFA 3AEDC 1SQPJ 4YSYD 5H2FE 3H1HG 1SQBK 2WU2D 2Y0DA 3H1LG 3H1KJ 1XTGB 1N7SC 3AE6D 1GTWA 1H0TA 3LW5H 2A06E 1N2DC 1PGPA 2IFMA 5KKZB 3M06A 4EIJA 5AW2B 4OVNF 5KLVK 3BCCG 1KORA 3L71E 1EZVI 2E74C 4U3FG 1VQ7P 3RK2B 2C0WA 3MZWB 1HJ0A 3KYQA 4D6TE 5KLVJ 4L74A 1EDIA 1GD2E 1KILD 4C7RA 4XE5B 2HODA 1NTMG 4H0LD 1IFJA 1Q7YQ 4AQRD 5APWA 1ZOYD 1LTSC 1RF0A 2QM8A 1RQVA 4IL6E 2J5UA 3L73D 2WSFJ 5AVRB 1X0TA 1PGJA 1SQVK 2M0BA 5AVTB 3G71P 1FJPA 1OXZA 1OW6A 2AEMA 1GZLA 3FGAD 1GMJA 3O8ZA 5EFWB 1T8ZA 3B4SA 2R3CA 1LT9A 1VQOP 5C3JC 1USDA 2FY8A 3CCLP 3E1IA 5AVSB 2W6BA 3CCQP 3HD7D 3GHGB 1PPJG 3PRJA 3KHUA 1GW3A 2C9LY 2GUSA 1SP4A 4B86A 3AE9D 3ZDMA 3VMXA 3AEBD 4LDTA 3SSUA 2FYNC 4WY4D 1MKMA 1GK4A 2E75D 3LW5J 3H25A 4JQ0D 2D2CB 4DHZA 3VYIA 3P7KA 1OW7A 3L37A 3AEAC 1J1EC 3OW2O 2J59M 3H32B 1N7SB 3L72G 1YI2P 1YQ4C 5GTHE 1AVOA 3MUDA 1L0LD 3G4SP 1VPCA 3PLNA 1SQQE 2A45G 2QG4A 1SQXK 1YHQP 2QE7H 4I6MC 2FYUE 1EZVE 1HWTC 5CMZA 5AVZB 2ZJSE 3GG2A 5APXA 1KB9I 5AW9B 1N86A 3KZIE 2A06G 2E74B 2WT7A 1MFTA 3HUSC 5E79E 1R5LA 3RK3D 3L72D 1BSNA 3L75E 4BRYB 3V2PA 3L71G 3CX5D 2OYHC 1ZRTD 2N1TA 4WWIA 1NU1J 1OVRA 3CIRD 1KFYC 4D6TG 1S9KE 3NMDA 2ZXEB 3O6QB 1RH5B 2FYZA 2GUVA 3AE4C 3HTKB 3M91A 2ZFCA 1BE3D 4NPEA 1A02F 2R5BA 2KNCB 3AECD 1Q82Q 4W7YA 5AW1B 2R44A 3CWBE 3A0BH 3H1KD 2H43A 1U7JA 1KTMA 3LIDA 4EI2A 1DD4A 2HR3A 1FBMA 2WSCH 2WS3D 3AE3D 3L70E 2O01H 1SQBD 1AA0A 3R2PA 1PZQA 2IZ1A 1IK7A 4JF7A 5CCHD 4IFMA 2OARA 4KX6D 2NPSA 1FU1A 2ZXXA 2FYNB 3IAOA 1L4AA 5CCGD 2ZVNB 4K3AA 2P2UA 4R4LA 3NXSA 3VP9A 3CCUP 3I56P 3P8MC 1J1EB 1N73C 4HKZH 1HTLC 1LWUC 1L2PA 4IFFA 1NTKK 1YIJP 3FX0A 1OW8A 1KF6D 3H1IE 1AFOA 5AW8B 2FFDC 3PTZA 1KV4A 4L75A 2Q1KA 2KOGA 1KB9E 5B66E 1NTKJ 4YSZC 5KAFH 2K3RA 1SQVD 1HUCA 1LTIC 3TNUB 1SQQG 1L0NK 1Y47A 4HB1A 2E42A 4YT0D 2O1KA 3HUSB 2FYUG 1EZVG 1ZMEC 1QLED 4H13C 1JEKA 2I1KA 2QRXA 1L0VD 2WQYD 3CXHH 1JY3P 2OYHB 3H1JE 2WSCJ 2B76C 5CJ4A 4H44C 2I1JA 1K73Q 2O01J 2PFXA 4UB6E 1NAYA 5AVQB 1QLBC 1W5CE 1X8YA 1SFCC 3T97B 1USEA 3SWFA 1OIPA 2POHA 3AE7D 3KQGA 1NHLA 1DEEG 3CC4P 3D6ZA 2P58A 1LTTC 1GL2C 2ZFYA 1YTZT 4C7NB 3A7OA 2LR2A 1FDMA 2IBZI 3BVHA 3GHGA 1FS0E 3AEGC 1URQC 3G3ZA 3L35A 2AXTH 1NTZK 2YNYA 4YTND 3L70G 3SFDC 1KZUB 2P1JA 1NJIQ 3H1LJ 2WDVC 4Y28J 1SQXD 1HH0A 2WSEH 4PJ0E 4WBAA 2XNDH 3M0DC 2YO2A 1KILE 2JWDA 3SFED 3L4FA 5K5GB 1ZV8A 2AEFA 3CMAP 1FDOA 3TYYA 5AVWB 1N73B 3BCCJ 3H32A 3CCJP 3L73E 1LWUB 1N7SA 4U3FJ 2L91A 2GA1A 2WP9C 4PV1C 1M1JC 3MHVA 3D71A 1KN7A 2FFDB 3KPEA 3Q5RA 5H2FH 1S5LE 1Y9BA 4YTPC 1VQ9P 2A45H 2IZ0A 3MIWA 4MN4C 1NEKD 4Z1MH 1NTMJ 4DOJA 1JY2O 3RL0C 3H1IG 3Q5PA 1BGYJ 2Q3IA 1LT1A 5TJHA 3G6EP 2N9YB 2ACZC 3ABVC 2Z5HA 1LP1B 4RKUJ 1HGZA 3B5NC 1VQ5P 1T3JA 3MTUE 4H13B 4BRYA 1JY2P 2YXRB 5KJ7D 2P67A 1BCCD 3TGUG 4H44B 3H6PA 3FWNA 4XFJA 1QEXA 3K5BA 3HTKA 2KYVA 1SFCB 2PRRA 3AE8D 3P4PC 3H1JG 1P84D 1HGVA 2KNCA 4EOTA 4YXDC 2WPVB 4Y99B 1XTCC 1L0LE 4W7ZA 1OZHA 4IL6H 4NPDA 2ZAEB 4PD4I 3AE2C 1GL2B 1T2KC 2H8PD 4GOEA 1Q2NA 4OGQC 1AVYA 4YPCA 2E43A 1RY3A 4N3YB 1JOCA 2XDJA 1URQB 2WPRA 1NTKD 2FBWD 3U1AA 3OA7A 1FE6A 1X9VA 3GMAA 2N9BA 1SQPK 5AW0B 5B5EE 1MUUA 3EWKA 3W67A 3HRNA 4RJTA 3RK3E 1Z56A 3L72E 3L74G 1KQLA 4EDFA 1VF5D 5GTIE 5BVZA 2IPPA 3P4QC 3CX5E 1D7MA 1L0ND 2PP6A 3FWLA 3BATA 3GW6A 5AVXB 5CHXA 1BE3E 2PAJA 4ZMDA 2O01N 2I8DA 4YSYC 1NEND 2WU2C 1M1JB 1PP9D 4PV1B 3AE6C 3IN6A 3H1KE 3L74D 1NTZG 3L73G 3L71J 2GM4A 3SWKA 5GTHH 1SQBE 1SLQA 1T3UA 3RL0B 2P10A 4D6TJ 2FKWB 3Q3DA 1PFIA 3TNUA 1Q81Q 4I7ZC 3HUSA 3II6A 3B5NB 2Q6QA 3RBZA 2JO1A 2IYPA 1DEBA 2Q7CA 2OYHA 3KZIH 1QVFO 3U59A 2V4HA 1NTZD 4YTMD 1KILC 3AEFD 2LXBA 5E79H 5KAIE 3V6IA 4ZKPA 1H89A
chains in the Genus database with same CATH topology
4H0LC 2FBWD 2WU2D 2NZ2A 1NGMB 2E76D 1ZP0C 1ZOYC 3Q1MA 3AE6D 1Q90D 3P4RD 3GLMA 4YT0D 3GMAA 2QJYC 3RL0g 3VRAD 3AECD 5C2TD 2ZT9B 1AJYA 3AE9D 4I7ZB 1EXJA 3P4SC 3VRBC 2WSEJ 1ZMEC 5L8RJ 3AEBD 3EWKA 4H13C 1KTMA 2WP9C 2FYNC 2YIUC 4PV1C 4U7JA 3RK3E 3AE8C 3D71A 1E7PC 4YTNC 1DD4A 2WU5D 1MKMA 1L0VD 4KT0J 2WQYD 3D6YA 2E75D 3LW5J 3S9OA 3Q5RA 1VF5D 3AEEC 2WS3D 3AEGD 2QJKC 3AE3D 3H25A 1Y9BA 3P4QC 3VR9C 4YTPC 2QSIA 3D70A 2H88D 2D2CB 1RQUA 2WSCJ 2BS4C 2B76C 1YQ3D 4H44C 4IL6X 3P4PD 2IDBA 1KF6C 1OW7A 4TT3H 1KQGB 2JP3A 3SFDD 2O01J 3B71A 4OGQB 2ZT9D 1NEKD 4Z1MH 1KORA 1VL2A 3AE5C 3AEAC 4YXDD 1QLBC 3C8VA 1FDIA 5M1BA 1IK7A 2E74C 3Q5PA 2WDVD 2WDRC 2H89D 3SFEC 4H0LB 3T97B 3CIRC 3GF7A 3O6QA 5KLIC 3P4SD 4YSXD 2ACZC 3ABVC 4YTMC 1HJ0A 3AE1C 3AEFC 2FXPA 2V7QJ 1YQ4C 4RKUJ 3AE2D 2QJPC 1KMIZ 3AE7D 5C3JD 2D2CD 3VR8D 4KX6D 1EXIA 4YSYC 3AEDD 4GDOA 1KFYD 2FBWC 4OGQD 1NEND 2WU2C 4H13B 1K05A 2G8YA 2E76C 4PV1B 3D6ZA 4YSZD 3AE6C 3IAOA 3IN6A 3P4RC 4YT0C 1ZRTE 1PV3A 3AE4D 1HF9A 3VRAC 3AECC 5C2TC 2WDQD 3AE9C 4H0LD 2BEZF 2BS3C 3R4YA 3AEBC 1ZP0D 1ZOYD 3G9RA 1KQFB 1UIXA 4H44B 4R4LA 4XFJA 1RQVA 2WU5C 2WQYC 1L0VC 2YMKA 1DD3A 2E75C 2J5UA 1NYHA 3VRBD 3AEGC 1VF5C 2WS3C 2G3AA 3AE3C 2P10A 2E74B 1TU3F 4H13D 2H88C 2BS2C 2MKVA 3Q3DA 2WSFJ 4PV1D 1DIPA 2WP9D 1YQ3C 3AE8D 4YTND 4R4MA 1PIXA 3P4PC 3SFDC 2ZT9C 1NEKC 3AEED 4I7ZC 3P4QD 3VR9D 4YTPD 4YXDC 2WPVB 2WDVC 1PL5A 2B76D 4H44D 4Y28J 2QIWA 2H89C 1OW6A 1OW8A 1KF6D 3FGAD 1WMKA 2BEQD 1S5LX 1GMJA 4YSXC 2E76B 1OMIA 2JO1A 5KKZC 1K04A 3AEAD 3Q5SA 3AE5D 3Q2YA 3AE2C 2E74D 1U57A 1KILE 3AE7C 2WDRD 5C3JC 2D2CC 3SFED 3VR8C 4KX6C 1S1CX 3CIRD 3AEDC 1KFYC 2ACZD 3ABVD 4YTMD 4OGQC 1NENC 3AE1D 1JB0J 1FDOA 2OQQA 3AEFD 1YQ4D 4YSZC 3GF3A 2K9YA 3AE4C 4YSYD 2E75B 1R8EA 2WDQC 1VF5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FBW D;  2WU2 D;  1ZP0 C;  1ZOY C;  3AE6 D;  3P4R D;  4YT0 D;  3VRA D;  3AEC D;  5C2T D;  3AE9 D;  3P4S C;  3VRB C;  3AEB D;  1KTM A;  2WP9 C;  3AE8 C;  4YTN C;  1E7P C;  2WU5 D;  1L0V D;  2WQY D;  3S9O A;  3AEG D;  3AEE C;  2WS3 D;  3AE3 D;  3P4Q C;  3VR9 C;  4YTP C;  2H88 D;  2BS4 C;  2B76 C;  1YQ3 D;  3P4P D;  1KF6 C;  1OW7 A;  3SFD D;  3B71 A;  1NEK D;  3AE5 C;  3AEA C;  4YXD D;  1QLB C;  2WDV D;  2WDR C;  2H89 D;  3SFE C;  3CIR C;  4YSX D;  3P4S D;  2ACZ C;  3ABV C;  4YTM C;  3AE1 C;  3AEF C;  1YQ4 C;  3AE2 D;  3AE7 D;  5C3J D;  3VR8 D;  4KX6 D;  4YSY C;  3AED D;  1KFY D;  2FBW C;  1NEN D;  2WU2 C;  1K05 A;  4YSZ D;  3AE6 C;  3P4R C;  4YT0 C;  1PV3 A;  3AE4 D;  3VRA C;  3AEC C;  5C2T C;  2WDQ D;  3AE9 C;  2BS3 C;  3AEB C;  1ZP0 D;  1ZOY D;  2WU5 C;  2WQY C;  1L0V C;  3VRB D;  3AEG C;  2WS3 C;  2G3A A;  3AE3 C;  2H88 C;  2BS2 C;  2WP9 D;  1YQ3 C;  3AE8 D;  4YTN D;  3P4P C;  3SFD C;  3AEE D;  1NEK C;  3P4Q D;  3VR9 D;  4YTP D;  4YXD C;  2WDV C;  2B76 D;  2H89 C;  1OW6 A;  1OW8 A;  1KF6 D;  4YSX C;  1K04 A;  3AEA D;  3AE5 D;  3AE2 C;  3AE7 C;  2WDR D;  5C3J C;  3SFE D;  3VR8 C;  4KX6 C;  3CIR D;  3AED C;  1KFY C;  2ACZ D;  3ABV D;  4YTM D;  1NEN C;  3AE1 D;  3AEF D;  1YQ4 D;  4YSZ C;  3AE4 C;  4YSY D;  2WDQ C; 
#chains in the Genus database with same CATH topology
 4H0L C;  2DW3 A;  1SS1 A;  3T97 A;  2BAS A;  1ZOY C;  4EYY Q;  1QL1 A;  1YBK A;  2W8Z A;  2QJY C;  3RL0 g;  2BCC D;  3VMZ A;  2M3B A;  3A5T A;  4KT0 J;  2RH0 A;  2NRG A;  2H88 D;  4C7N A;  2M3E A;  1KQG B;  4OGQ B;  1GU4 A;  1L0L G;  1SQV E;  3HD7 C;  1BGY D;  1KMI Z;  3VR8 D;  1EXI A;  3AE9 C;  1WRG A;  3AEB C;  3B8E B;  4WY4 C;  2E75 C;  1VQL P;  2FXO A;  4K35 A;  1N73 A;  2WSS H;  4HH2 A;  1LWU A;  3VR9 D;  2IBZ D;  3C1L A;  1SQQ J;  2OYI C;  2QIW A;  2KB7 P;  3TDK A;  1WMK A;  2QVA A;  1JCC A;  2FYU J;  2FFD A;  1P84 I;  2K88 A;  2Q3E A;  2WDR D;  2PGD A;  3VP8 A;  1BE3 G;  4TLF A;  1W2E A;  1YTZ I;  2HFE D;  1NU1 K;  1SVF A;  3H1K G;  1PGO A;  2WPQ A;  4W80 A;  3L75 J;  3HE4 B;  3P4R D;  2O1J A;  2XV5 A;  1LP1 A;  2KSE A;  4I7Z B;  1KB9 H;  5B66 H;  1SQB G;  1SQX E;  2E5T A;  3RK3 C;  1Y8A A;  2JWA A;  2WWW A;  3A0H E;  3VON A;  2RMZ A;  1KIL B;  3CC2 P;  1VQK P;  1SQP D;  1FDI A;  2WMM A;  4H0L B;  1BSH A;  3CIR C;  3CWB J;  1SFC A;  3F5H A;  4QMA A;  2ITA A;  5KLV G;  5KTB A;  2QJY B;  3L70 J;  3M0A A;  4UB6 H;  1J1D C;  1VDF A;  1HF9 A;  3AEC C;  4I1L A;  2WPS A;  1GL2 A;  2W90 A;  2R32 A;  3G9R A;  1KQF B;  2LXC B;  4IOI H;  5C39 A;  4C46 A;  1NYH A;  2QA4 P;  4ZKU A;  2WS3 C;  3AE3 C;  1LTB C;  1URQ A;  3VMA A;  1PIX A;  3EFF K;  1JM0 A;  1ZR2 A;  5KLV D;  1PL5 A;  3TSI A;  1YIT P;  5CCH C;  2OTL P;  1J2J B;  1VQM P;  3JC2 2;  1OMI A;  5DJT B;  2RN0 A;  2CK3 H;  1SQV G;  1IFP A;  4KX6 C;  3SWY A;  3N7N A;  1KYO D;  5AW7 B;  4WY4 B;  1BCC E;  2E75 B;  3A3Y B;  4PD4 D;  4N6J A;  5CCG C;  2E76 D;  4PJ0 H;  3H1I J;  3WUT A;  3VRA D;  5C2T D;  3P4S C;  1P84 E;  2OYI B;  1RF1 C;  2XZR A;  1QX8 A;  3RBX A;  3VTP C;  2WU5 D;  1M1J A;  1WT6 A;  2OGU A;  3KDP B;  1IO4 A;  4IL6 X;  1JY3 O;  1KF6 C;  4I2L C;  3B71 A;  2WZ7 A;  2ZT9 D;  4JYC A;  3TGU E;  2H89 D;  2KSJ A;  3V2R A;  3IF4 A;  1HVV A;  2N1T D;  1JNM A;  3BRT B;  2QJP C;  3L36 A;  1S5L H;  3B5N A;  3CXH I;  1M56 D;  4UB8 E;  4YT0 C;  1KFN A;  3RK3 B;  1FZA A;  4ZNC A;  3V2Q A;  2JEE A;  1ZP0 D;  4A7P A;  1KD1 Q;  3M9B A;  2WQY C;  1L0V C;  3VRB D;  2KP8 A;  1L0N E;  2RKL A;  2BS2 C;  2MKV A;  1W2B O;  1SQX G;  1EC5 A;  1AQ5 A;  3V2N A;  1OVV A;  1YYC A;  1IK9 A;  1M7L A;  4JYB A;  2Z4E A;  1J1D B;  4DCK A;  3AE7 C;  1PP9 E;  2K1A A;  3L74 E;  1FJK A;  1NO4 A;  3AE1 D;  1EDL A;  2NPS D;  2Q5U A;  1N8R Q;  1R8E A;  1ZLL A;  3H1H J;  3EQ2 A;  1L4A D;  1JTH B;  3N4X A;  1OWA A;  5L8R J;  4GKG A;  2YIU C;  4YTN C;  1G2C B;  1NU1 D;  1QGK B;  1YJ9 P;  2H7H A;  1YQ3 D;  2JR8 A;  1NTZ E;  5B5E H;  3L73 J;  2JKV A;  3SFE C;  4L76 A;  2KXP B;  5KLI C;  3WMM 0;  2OTJ P;  1MFZ A;  2FXM A;  4JBZ A;  1LNQ A;  2MJZ A;  1OFC X;  4M3L A;  1NTM K;  5GTI H;  1RE4 C;  3CWB D;  3CX5 H;  2SPZ A;  1BCC G;  2BCC E;  1K05 A;  1RF1 B;  3HE5 B;  2WDQ D;  3RK2 D;  3E1R A;  1VQN P;  5AVV B;  1X22 A;  2O3J A;  1UIX A;  1DD3 A;  3BRV B;  2G3A A;  3HE4 A;  3AEE D;  3F89 A;  1NEK C;  1CSB A;  3P8C D;  2QJP B;  1JUN A;  4N78 D;  1BGY E;  3CME P;  3I5C A;  1E79 H;  1JY2 N;  4NPF X;  3AE5 D;  4DDG A;  1R5S A;  4DT0 A;  2HLO A;  1NTK G;  4ASV A;  1CI6 B;  1KIL A;  1JMB A;  4DHI B;  2KI7 B;  4FJV A;  5KJ7 C;  1A02 J;  2AEJ A;  1KYO I;  2HPC B;  1U7M A;  1AJY A;  1L0L J;  2WSE J;  1FZC C;  1EDK A;  2IBZ E;  3AE8 C;  4DZO A;  4LGD E;  1ZN5 A;  1L0N G;  5KAI H;  2QSI A;  2IDB A;  5DJU B;  2JP3 A;  2E5Y A;  3I55 P;  4YSX D;  5APS A;  1RE3 C;  1PP9 G;  3L72 J;  4YXW H;  1K9M Q;  1YJN P;  2D2C D;  4RO0 A;  3AED D;  5TIS E;  2FBW C;  3TK1 A;  2Y9Y A;  2YIU B;  2QM7 A;  1VQ8 P;  1ZRT E;  5CBO A;  1N7S D;  4WY4 A;  1VF5 C;  1VQ6 P;  1BE3 J;  1S3J A;  2K9J B;  1FAV A;  1SQP E;  5KLI B;  4AUW A;  1H88 A;  1S2E A;  3JCU E;  1PGQ A;  3U1C A;  4LLH A;  1FOS F;  2OYI A;  2XNX A;  3WU2 E;  4GOF A;  3IFM A;  2E74 D;  1KC8 Q;  1SQB J;  3CLQ A;  3RGU A;  1NEN C;  2OQQ A;  1TFF A;  2K9Y A;  2BCC G;  3IR9 A;  1NKZ B;  1FZF A;  3BAS A;  4JPZ B;  3H1H D;  1GW4 A;  2Y0E A;  3CCE P;  3H1L D;  4U7J A;  5KLV E;  1QL2 A;  3CPW O;  3S9O A;  2ZYA A;  1X79 B;  3CI9 A;  2KZI A;  2BS4 C;  1OX3 A;  1BDD A;  1NH4 A;  4BXL A;  1VL2 A;  1IFN A;  1KYO E;  1BGY G;  1G1I A;  3C8V A;  3LIE A;  4ASW A;  1EQ7 A;  2R3S A;  4YTM C;  3BCC D;  4PD4 E;  3AEF C;  1GU5 A;  1CW5 A;  5C3J D;  4U3F D;  1LTJ C;  1FZC B;  1IJD B;  3A0H H;  2G8Y A;  1FC2 C;  3CCM P;  2JJL A;  2VRS A;  2KUB A;  2KZJ A;  3R4Y A;  4O9B A;  3CXH D;  2ZYD A;  1SQV J;  2YMK A;  1NTM D;  3PJS K;  3V4W A;  2IBZ G;  1TU3 F;  2H88 C;  1M1K Q;  2K37 A;  4R4M A;  1NKN A;  2UWJ E;  1JTH A;  3V5B A;  3P32 A;  3PHL A;  5CCH A;  1S5L X;  3CCS P;  1G2C A;  3AEA D;  3Q2Y A;  5BU8 B;  3VR8 C;  1K8A Q;  1SQQ K;  1UII A;  1T6A A;  3WUU A;  1YQ4 D;  1LJ2 A;  2FYU K;  2KK7 A;  1OVU A;  2CPB A;  1VF5 B;  4I6L A;  1JMM A;  2NZ2 A;  5CCG A;  1S4X A;  1PPJ D;  1IC2 A;  2YO3 A;  2KIK A;  2B87 B;  3FXD A;  1E7P C;  3CL3 D;  1RF1 A;  1SQP G;  3VR9 C;  3HE5 A;  4RES B;  1MV8 A;  1M90 Q;  2KS1 B;  2WDR C;  1P84 H;  2V7Q H;  2OYO A;  2YKO A;  4CPG A;  1SQX J;  4GDO A;  3CCV P;  2Q9I A;  1KFY D;  2YKQ A;  1Q86 Q;  3PP5 A;  3WUV A;  3P4R C;  3AE4 D;  1IFD A;  2B9B A;  3VN0 A;  4GOD A;  2BS3 C;  2YMY A;  1RF0 C;  3MP7 B;  2IYO A;  1NU1 E;  1CI6 A;  4AYC A;  1ZW0 A;  1GDT A;  2M5A B;  5APY A;  4UB8 H;  2HPC A;  3PH0 A;  2A06 D;  1NAF A;  5CBN A;  1LTJ B;  4HJG H;  5APV A;  1LT9 C;  4LC1 A;  3M9H A;  3L71 D;  2HYN A;  1JB0 J;  1EDJ A;  4WB4 A;  3MD0 A;  3HD7 B;  4D6T D;  3USS A;  2OTK E;  1NGM B;  1H8A A;  2ZVO B;  5AW5 B;  3M0D A;  3P8C E;  2WTY A;  2KLV A;  4N78 E;  3D6Y A;  1BCC J;  2C9N Y;  3M9Q A;  1JO5 A;  3EFG A;  1IFM A;  5M1B A;  2K9J A;  3P4S D;  3MUD C;  2FXP A;  2V7Q J;  2YXQ B;  1AV1 A;  4WVZ A;  1H0T B;  1RE4 A;  1VQ4 P;  2E76 C;  5AW3 B;  4YSZ D;  3KXD A;  2KLU A;  4KJM A;  2HG5 D;  3VRA C;  1FOS E;  3FXE A;  5C2T C;  1JCD A;  1FZB A;  3TGU J;  2QEX P;  2WU5 C;  2W6A A;  1NTK E;  1KQS O;  4H13 D;  1DIP A;  2XU6 A;  2B89 A;  3H1J J;  2ZT9 C;  1FZG A;  3OAK A;  1JY3 N;  2B76 D;  4H44 D;  2H89 C;  1LGH B;  2N1T C;  2HOD B;  1K04 A;  3CCR P;  2C0X A;  2R5D A;  2P7J A;  5AVU B;  3A0B E;  2JDI H;  1SFC D;  1VQP P;  1QVG O;  1L0N J;  3GF3 A;  4BWN A;  1G1J A;  3L75 G;  5KJ7 A;  1ZP0 C;  3Q1M A;  3GLM A;  3VMY A;  1GL2 D;  5CJ0 A;  3VRB C;  1ZR4 A;  2J58 A;  1SQQ D;  1NU1 G;  1FZC A;  1PP9 J;  4OH8 B;  3L74 J;  4Y99 C;  2IX7 C;  2FYU D;  1EZV D;  1LT9 B;  1URQ D;  3AEG D;  2QJK C;  3A2A A;  1GK6 A;  3D70 A;  4DJG A;  1RQU A;  2WVR A;  4TT3 H;  3SFD D;  1CZQ A;  3UIA A;  2WDV D;  2ZYG A;  5AVY B;  3CWB G;  5AW4 B;  1DH3 A;  3GF7 A;  1HBW A;  3VOP A;  4OWF A;  3AE1 C;  3L75 D;  1ZXG A;  1E5W A;  1RE3 A;  2NPS C;  5APU A;  1S72 P;  4L73 A;  3H1H E;  1HJB A;  1L4A C;  2IFN A;  1MZ9 A;  3H1L E;  1PV3 A;  1IFI A;  1S9K D;  1NTZ J;  2Y9Z A;  1LTG C;  5APQ A;  1IZN B;  3OJA B;  2WP9 D;  5TIS H;  4PV1 D;  1YQ3 C;  3CX5 I;  5APT A;  2Y0C A;  5KAF E;  2BCC J;  2A45 I;  3QWO C;  4YTP D;  2W27 A;  1NWQ A;  3BCC E;  2W83 C;  2LKM A;  3L70 D;  2BEQ D;  4U3F E;  2B87 A;  2E76 B;  5KKZ C;  2WIT A;  3RL0 D;  1U57 A;  3QH9 A;  1S1C X;  2ACZ D;  3ABV D;  4KHX A;  3B5N D;  3JCU H;  3CXH E;  2KS1 A;  2WDQ C;  3RK2 C;  3C9I A;  1NTM E;  2WT7 B;  2AXC A;  3NFQ A;  3WU2 H;  1Q90 D;  4HYT B;  2ZT9 B;  4XA4 A;  1EXJ A;  1KFM A;  1NOH A;  3W68 A;  3ITK A;  2N1T B;  3AEE C;  1L0L K;  1M57 D;  1RHZ B;  1M8O B;  1LTA C;  1NVO A;  3CC7 P;  3P4P D;  1N7L A;  3S4R A;  3AE5 C;  4YXD D;  1DX7 A;  1AQT A;  2W6J H;  3O6Q A;  2M5A A;  5AW6 B;  3AE2 D;  3H1I D;  1T2K D;  1BDC A;  2L5G B;  2CPS A;  1PPJ E;  2AXT E;  2Z5I A;  4DDI A;  4DHJ A;  4OGQ D;  1LTJ A;  1KB9 D;  1YJW P;  1KYO H;  3V4Q A;  4GT1 A;  2QJK B;  2YKP A;  2BEZ F;  2M8R A;  4PD4 H;  3GHG C;  2B88 A;  2WSF H;  3MGN A;  3TGU D;  1FZE A;  3HD7 A;  3CD6 P;  3P4Q D;  2XKM A;  2NPS B;  3S1K A;  3NTN A;  3TF5 A;  3H1J D;  4IFD K;  4YSX C;  1L4A B;  5BU5 A;  3E7K A;  3Q5S A;  2D2C C;  3JSV C;  4GIF A;  3AED C;  1SQP J;  4YSY D;  5H2F E;  3H1H G;  1SQB K;  2WU2 D;  2Y0D A;  3H1L G;  3H1K J;  1XTG B;  1N7S C;  3AE6 D;  1GTW A;  1H0T A;  3LW5 H;  2A06 E;  1N2D C;  1PGP A;  2IFM A;  5KKZ B;  3M06 A;  4EIJ A;  5AW2 B;  4OVN F;  5KLV K;  3BCC G;  1KOR A;  3L71 E;  1EZV I;  2E74 C;  4U3F G;  1VQ7 P;  3RK2 B;  2C0W A;  3MZW B;  1HJ0 A;  3KYQ A;  4D6T E;  5KLV J;  4L74 A;  1EDI A;  1GD2 E;  1KIL D;  4C7R A;  4XE5 B;  2HOD A;  1NTM G;  4H0L D;  1IFJ A;  1Q7Y Q;  4AQR D;  5APW A;  1ZOY D;  1LTS C;  1RF0 A;  2QM8 A;  1RQV A;  4IL6 E;  2J5U A;  3L73 D;  2WSF J;  5AVR B;  1X0T A;  1PGJ A;  1SQV K;  2M0B A;  5AVT B;  3G71 P;  1FJP A;  1OXZ A;  1OW6 A;  2AEM A;  1GZL A;  3FGA D;  1GMJ A;  3O8Z A;  5EFW B;  1T8Z A;  3B4S A;  2R3C A;  1LT9 A;  1VQO P;  5C3J C;  1USD A;  2FY8 A;  3CCL P;  3E1I A;  5AVS B;  2W6B A;  3CCQ P;  3HD7 D;  3GHG B;  1PPJ G;  3PRJ A;  3KHU A;  1GW3 A;  2C9L Y;  2GUS A;  1SP4 A;  4B86 A;  3AE9 D;  3ZDM A;  3VMX A;  3AEB D;  4LDT A;  3SSU A;  2FYN C;  4WY4 D;  1MKM A;  1GK4 A;  2E75 D;  3LW5 J;  3H25 A;  4JQ0 D;  2D2C B;  4DHZ A;  3VYI A;  3P7K A;  1OW7 A;  3L37 A;  3AEA C;  1J1E C;  3OW2 O;  2J59 M;  3H32 B;  1N7S B;  3L72 G;  1YI2 P;  1YQ4 C;  5GTH E;  1AVO A;  3MUD A;  1L0L D;  3G4S P;  1VPC A;  3PLN A;  1SQQ E;  2A45 G;  2QG4 A;  1SQX K;  1YHQ P;  2QE7 H;  4I6M C;  2FYU E;  1EZV E;  1HWT C;  5CMZ A;  5AVZ B;  2ZJS E;  3GG2 A;  5APX A;  1KB9 I;  5AW9 B;  1N86 A;  3KZI E;  2A06 G;  2E74 B;  2WT7 A;  1MFT A;  3HUS C;  5E79 E;  1R5L A;  3RK3 D;  3L72 D;  1BSN A;  3L75 E;  4BRY B;  3V2P A;  3L71 G;  3CX5 D;  2OYH C;  1ZRT D;  2N1T A;  4WWI A;  1NU1 J;  1OVR A;  3CIR D;  1KFY C;  4D6T G;  1S9K E;  3NMD A;  2ZXE B;  3O6Q B;  1RH5 B;  2FYZ A;  2GUV A;  3AE4 C;  3HTK B;  3M91 A;  2ZFC A;  1BE3 D;  4NPE A;  1A02 F;  2R5B A;  2KNC B;  3AEC D;  1Q82 Q;  4W7Y A;  5AW1 B;  2R44 A;  3CWB E;  3A0B H;  3H1K D;  2H43 A;  1U7J A;  1KTM A;  3LID A;  4EI2 A;  1DD4 A;  2HR3 A;  1FBM A;  2WSC H;  2WS3 D;  3AE3 D;  3L70 E;  2O01 H;  1SQB D;  1AA0 A;  3R2P A;  1PZQ A;  2IZ1 A;  1IK7 A;  4JF7 A;  5CCH D;  4IFM A;  2OAR A;  4KX6 D;  2NPS A;  1FU1 A;  2ZXX A;  2FYN B;  3IAO A;  1L4A A;  5CCG D;  2ZVN B;  4K3A A;  2P2U A;  4R4L A;  3NXS A;  3VP9 A;  3CCU P;  3I56 P;  3P8M C;  1J1E B;  1N73 C;  4HKZ H;  1HTL C;  1LWU C;  1L2P A;  4IFF A;  1NTK K;  1YIJ P;  3FX0 A;  1OW8 A;  1KF6 D;  3H1I E;  1AFO A;  5AW8 B;  2FFD C;  3PTZ A;  1KV4 A;  4L75 A;  2Q1K A;  2KOG A;  1KB9 E;  5B66 E;  1NTK J;  4YSZ C;  5KAF H;  2K3R A;  1SQV D;  1HUC A;  1LTI C;  3TNU B;  1SQQ G;  1L0N K;  1Y47 A;  4HB1 A;  2E42 A;  4YT0 D;  2O1K A;  3HUS B;  2FYU G;  1EZV G;  1ZME C;  1QLE D;  4H13 C;  1JEK A;  2I1K A;  2QRX A;  1L0V D;  2WQY D;  3CXH H;  1JY3 P;  2OYH B;  3H1J E;  2WSC J;  2B76 C;  5CJ4 A;  4H44 C;  2I1J A;  1K73 Q;  2O01 J;  2PFX A;  4UB6 E;  1NAY A;  5AVQ B;  1QLB C;  1W5C E;  1X8Y A;  1SFC C;  3T97 B;  1USE A;  3SWF A;  1OIP A;  2POH A;  3AE7 D;  3KQG A;  1NHL A;  1DEE G;  3CC4 P;  3D6Z A;  2P58 A;  1LTT C;  1GL2 C;  2ZFY A;  1YTZ T;  4C7N B;  3A7O A;  2LR2 A;  1FDM A;  2IBZ I;  3BVH A;  3GHG A;  1FS0 E;  3AEG C;  1URQ C;  3G3Z A;  3L35 A;  2AXT H;  1NTZ K;  2YNY A;  4YTN D;  3L70 G;  3SFD C;  1KZU B;  2P1J A;  1NJI Q;  3H1L J;  2WDV C;  4Y28 J;  1SQX D;  1HH0 A;  2WSE H;  4PJ0 E;  4WBA A;  2XND H;  3M0D C;  2YO2 A;  1KIL E;  2JWD A;  3SFE D;  3L4F A;  5K5G B;  1ZV8 A;  2AEF A;  3CMA P;  1FDO A;  3TYY A;  5AVW B;  1N73 B;  3BCC J;  3H32 A;  3CCJ P;  3L73 E;  1LWU B;  1N7S A;  4U3F J;  2L91 A;  2GA1 A;  2WP9 C;  4PV1 C;  1M1J C;  3MHV A;  3D71 A;  1KN7 A;  2FFD B;  3KPE A;  3Q5R A;  5H2F H;  1S5L E;  1Y9B A;  4YTP C;  1VQ9 P;  2A45 H;  2IZ0 A;  3MIW A;  4MN4 C;  1NEK D;  4Z1M H;  1NTM J;  4DOJ A;  1JY2 O;  3RL0 C;  3H1I G;  3Q5P A;  1BGY J;  2Q3I A;  1LT1 A;  5TJH A;  3G6E P;  2N9Y B;  2ACZ C;  3ABV C;  2Z5H A;  1LP1 B;  4RKU J;  1HGZ A;  3B5N C;  1VQ5 P;  1T3J A;  3MTU E;  4H13 B;  4BRY A;  1JY2 P;  2YXR B;  5KJ7 D;  2P67 A;  1BCC D;  3TGU G;  4H44 B;  3H6P A;  3FWN A;  4XFJ A;  1QEX A;  3K5B A;  3HTK A;  2KYV A;  1SFC B;  2PRR A;  3AE8 D;  3P4P C;  3H1J G;  1P84 D;  1HGV A;  2KNC A;  4EOT A;  4YXD C;  2WPV B;  4Y99 B;  1XTC C;  1L0L E;  4W7Z A;  1OZH A;  4IL6 H;  4NPD A;  2ZAE B;  4PD4 I;  3AE2 C;  1GL2 B;  1T2K C;  2H8P D;  4GOE A;  1Q2N A;  4OGQ C;  1AVY A;  4YPC A;  2E43 A;  1RY3 A;  4N3Y B;  1JOC A;  2XDJ A;  1URQ B;  2WPR A;  1NTK D;  2FBW D;  3U1A A;  3OA7 A;  1FE6 A;  1X9V A;  3GMA A;  2N9B A;  1SQP K;  5AW0 B;  5B5E E;  1MUU A;  3EWK A;  3W67 A;  3HRN A;  4RJT A;  3RK3 E;  1Z56 A;  3L72 E;  3L74 G;  1KQL A;  4EDF A;  1VF5 D;  5GTI E;  5BVZ A;  2IPP A;  3P4Q C;  3CX5 E;  1D7M A;  1L0N D;  2PP6 A;  3FWL A;  3BAT A;  3GW6 A;  5AVX B;  5CHX A;  1BE3 E;  2PAJ A;  4ZMD A;  2O01 N;  2I8D A;  4YSY C;  1NEN D;  2WU2 C;  1M1J B;  1PP9 D;  4PV1 B;  3AE6 C;  3IN6 A;  3H1K E;  3L74 D;  1NTZ G;  3L73 G;  3L71 J;  2GM4 A;  3SWK A;  5GTH H;  1SQB E;  1SLQ A;  1T3U A;  3RL0 B;  2P10 A;  4D6T J;  2FKW B;  3Q3D A;  1PFI A;  3TNU A;  1Q81 Q;  4I7Z C;  3HUS A;  3II6 A;  3B5N B;  2Q6Q A;  3RBZ A;  2JO1 A;  2IYP A;  1DEB A;  2Q7C A;  2OYH A;  3KZI H;  1QVF O;  3U59 A;  2V4H A;  1NTZ D;  4YTM D;  1KIL C;  3AEF D;  2LXB A;  5E79 H;  5KAI E;  3V6I A;  4ZKP A;  1H89 A; 
#chains in the Genus database with same CATH homology
 4H0L C;  2FBW D;  2WU2 D;  2NZ2 A;  1NGM B;  2E76 D;  1ZP0 C;  1ZOY C;  3Q1M A;  3AE6 D;  1Q90 D;  3P4R D;  3GLM A;  4YT0 D;  3GMA A;  2QJY C;  3RL0 g;  3VRA D;  3AEC D;  5C2T D;  2ZT9 B;  1AJY A;  3AE9 D;  4I7Z B;  1EXJ A;  3P4S C;  3VRB C;  2WSE J;  1ZME C;  5L8R J;  3AEB D;  3EWK A;  4H13 C;  1KTM A;  2WP9 C;  2FYN C;  2YIU C;  4PV1 C;  4U7J A;  3RK3 E;  3AE8 C;  3D71 A;  1E7P C;  4YTN C;  1DD4 A;  2WU5 D;  1MKM A;  1L0V D;  4KT0 J;  2WQY D;  3D6Y A;  2E75 D;  3LW5 J;  3S9O A;  3Q5R A;  1VF5 D;  3AEE C;  2WS3 D;  3AEG D;  2QJK C;  3AE3 D;  3H25 A;  1Y9B A;  3P4Q C;  3VR9 C;  4YTP C;  2QSI A;  3D70 A;  2H88 D;  2D2C B;  1RQU A;  2WSC J;  2BS4 C;  2B76 C;  1YQ3 D;  4H44 C;  4IL6 X;  3P4P D;  2IDB A;  1KF6 C;  1OW7 A;  4TT3 H;  1KQG B;  2JP3 A;  3SFD D;  2O01 J;  3B71 A;  4OGQ B;  2ZT9 D;  1NEK D;  4Z1M H;  1KOR A;  1VL2 A;  3AE5 C;  3AEA C;  4YXD D;  1QLB C;  3C8V A;  1FDI A;  5M1B A;  1IK7 A;  2E74 C;  3Q5P A;  2WDV D;  2WDR C;  2H89 D;  3SFE C;  4H0L B;  3T97 B;  3CIR C;  3GF7 A;  3O6Q A;  5KLI C;  3P4S D;  4YSX D;  2ACZ C;  3ABV C;  4YTM C;  1HJ0 A;  3AE1 C;  3AEF C;  2FXP A;  2V7Q J;  1YQ4 C;  4RKU J;  3AE2 D;  2QJP C;  1KMI Z;  3AE7 D;  5C3J D;  2D2C D;  3VR8 D;  4KX6 D;  1EXI A;  4YSY C;  3AED D;  4GDO A;  1KFY D;  2FBW C;  4OGQ D;  1NEN D;  2WU2 C;  4H13 B;  1K05 A;  2G8Y A;  2E76 C;  4PV1 B;  3D6Z A;  4YSZ D;  3AE6 C;  3IAO A;  3IN6 A;  3P4R C;  4YT0 C;  1ZRT E;  1PV3 A;  3AE4 D;  1HF9 A;  3VRA C;  3AEC C;  5C2T C;  2WDQ D;  3AE9 C;  4H0L D;  2BEZ F;  2BS3 C;  3R4Y A;  3AEB C;  1ZP0 D;  1ZOY D;  3G9R A;  1KQF B;  1UIX A;  4H44 B;  4R4L A;  4XFJ A;  1RQV A;  2WU5 C;  2WQY C;  1L0V C;  2YMK A;  1DD3 A;  2E75 C;  2J5U A;  1NYH A;  3VRB D;  3AEG C;  1VF5 C;  2WS3 C;  2G3A A;  3AE3 C;  2P10 A;  2E74 B;  1TU3 F;  4H13 D;  2H88 C;  2BS2 C;  2MKV A;  3Q3D A;  2WSF J;  4PV1 D;  1DIP A;  2WP9 D;  1YQ3 C;  3AE8 D;  4YTN D;  4R4M A;  1PIX A;  3P4P C;  3SFD C;  2ZT9 C;  1NEK C;  3AEE D;  4I7Z C;  3P4Q D;  3VR9 D;  4YTP D;  4YXD C;  2WPV B;  2WDV C;  1PL5 A;  2B76 D;  4H44 D;  4Y28 J;  2QIW A;  2H89 C;  1OW6 A;  1OW8 A;  1KF6 D;  3FGA D;  1WMK A;  2BEQ D;  1S5L X;  1GMJ A;  4YSX C;  2E76 B;  1OMI A;  2JO1 A;  5KKZ C;  1K04 A;  3AEA D;  3Q5S A;  3AE5 D;  3Q2Y A;  3AE2 C;  2E74 D;  1U57 A;  1KIL E;  3AE7 C;  2WDR D;  5C3J C;  2D2C C;  3SFE D;  3VR8 C;  4KX6 C;  1S1C X;  3CIR D;  3AED C;  1KFY C;  2ACZ D;  3ABV D;  4YTM D;  4OGQ C;  1NEN C;  3AE1 D;  1JB0 J;  1FDO A;  2OQQ A;  3AEF D;  1YQ4 D;  4YSZ C;  3GF3 A;  2K9Y A;  3AE4 C;  4YSY D;  2E75 B;  1R8E A;  2WDQ C;  1VF5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...