3AEEC

Crystal structure of porcine heart mitochondrial complex ii bound with atpenin a5
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of porcine heart mitochondrial complex II bound with Atpenin A5
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
total genus 46
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3aeeC01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3aeeC02
1ZOYC 4YXDD 3VR8D 4YXDC 1YQ3C 1YQ3D 4YSZD 4YSZC 3VR9D 3VRBD 2WDQC 2WU5D 4YT0C 3AE3D 1KTMA 3AEGD 5C3JD 3AE4D 1ZP0C 3AE4C 3P4RD 2H88C 3P4RC 1KF6D 1NENC 2ACZC 1YQ4C 4YTMC 4YTND 1YQ4D 3AEBC 3VR8C 1OW7A 2WS3D 2WDQD 2BS2C 3P4PC 3P4SD 3VRAC 1K04A 3AE1C 1ZP0D 5C2TC 3AE5D 3AE7D 2WDRD 4YSXD 1E7PC 2WDRC 4YSXC 3AE6C 4KX6D 3SFDD 3CIRD 3AE6D 1ZOYD 2WS3C 4YTPC 1K05A 3AEBD 4YTPD 1L0VC 3VRBC 3VR9C 1L0VD 2BS3C 3AE7C 1PV3A 3AE1D 5C3JC 3SFDC 2WDVC 3AE8C 3AE8D 4KX6C 2WQYD 2H89C 2H89D 4YTNC 3AEFD 2FBWC 4YTMD 2FBWD 3AEDC 3AEDD 3ABVC 3AEAC 3SFED 3AEEC 4YSYD 3AE3C 3AEGC 3B71A 5C2TD 1OW6A 1KFYD 2WU2D 3AECC 2WU2C 3AE2D 3AECD 3P4QC 3AE2C 3P4QD 3CIRC 3AEFC 1NEND 2ACZD 3AE9D 1NEKC 1OW8A 1NEKD 3SFEC 3AEAD 3AEED 2BS4C 3P4PD 2B76C 3ABVD 3P4SC 2B76D 3VRAD 4YSYC 2WU5C 1KFYC 4YT0D 3AE5C 2G3AA 2WDVD 2WP9D 2H88D 3S9OA 1QLBC 2WP9C 3AE9C 1KF6C 2WQYC
chains in the Genus database with same CATH superfamily
3OA7A 4H0LB 1PZQA 2KNCB 3E1IA 1CI6A 5KAIE 4LGDE 1WMKA 3HUSA 3D6YA 3GHGA 2W83C 2Q6QA 2J5UA 3AE4D 1NOHA 1SQPJ 3L73G 4H13B 5AW1B 1OIPA 2WS3D 2HPCB 3KZIE 2Y0EA 3O6QA 5BU8B 5KLVD 1MV8A 1JY3O 1H8AA 5GTIH 3WUUA 1JM0A 3FXEA 2E76B 2YIUB 1IK7A 3H1JG 1G2CA 2NPSA 3LW5H 2BS3C 3AE7C 3M0DA 1HGVA 2HODA 1ZRTD 3AEFD 1JMBA 2KZJA 1YHQP 4DZOA 4YSYD 3H1HE 1KILD 3AE2D 3P4QD 2HR3A 2FYUD 1N73C 1AFOA 1ZXGA 3H1LD 3CX5E 1YIJP 2SPZA 2B76D 1NKNA 1KILE 1HWTC 1KFYC 1BE3E 5AVYB 4W80A 1H88A 1FAVA 1Q81Q 4TT3H 1N2DC 2WZ7A 1JUNA 3V4WA 1L0NK 1U7JA 2OARA 1HUCA 5KLIC 2K3RA 3L70G 2YKOA 3BASA 4HYTB 4U3FJ 1BDCA 1W5CE 3AEBC 5BVZA 2R3CA 2WSCJ 2V7QJ 4UB8H 2JWDA 2Q3IA 5KLVE 3B5ND 4QMAA 3RK2D 3SFDD 3S1KA 2PRRA 1OVRA 3CMAP 4UB6E 1SP4A 3VMYA 5AVZB 1L0VC 2QE7H 1RF0C 2IZ1A 1JY2N 3P8CE 1N7SA 3N4XA 4HKZH 2N1TD 3L75J 2KYVA 2H89D 1FZCB 1M56D 1LT9C 3EWKA 1GL2C 2LKMA 2KUBA 5AVQB 1L0LG 2WSSH 5APUA 1OWAA 2LXCB 4UB8E 3Q3DA 4FJVA 1S2EA 2E74D 4K35A 4DHZA 3SWYA 1GW4A 1NTKK 3KQGA 5K5GB 1VQLP 1QLBC 3JC22 1VQ6P 1JY3N 3VR8D 2OTLP 1L4AB 3GG2A 3VR9D 1RF1A 3HE4A 2GM4A 1SQPG 3P4RD 1K73Q 1RE4C 1DD4A 1S4XA 1VF5B 3M0DC 1L0LJ 3BRVB 4W7YA 3S4RA 1M1JB 3H1IG 1FDIA 1P84I 2WPQA 2ZYGA 3AE5D 1SFCD 2KOGA 4IFFA 3P32A 3A0HE 1LTAC 1PGOA 4AQRD 2HFED 1QLED 3GMAA 1URQC 1KB9H 4U7JA 1H0TA 3RK3D 5B66H 1W2EA 2BCCE 1EDKA 1IJDB 2V4HA 4WBAA 1EXJA 3GHGC 2I1JA 3L70D 2Q5UA 2KLVA 4ZNCA 1USEA 3H1KE 3HD7C 2W90A 3HUSB 5KTBA 1OW6A 1A02F 1LTBC 2E76D 5BU5A 1BE3D 1GU4A 2K1AA 2ZT9B 2K37A 1FDOA 3BRTB 1N8RQ 2QRXA 2BS4C 3P4PD 3A0BH 1SVFA 3L75E 3ABVD 4I7ZB 3V6IA 3HE5B 3BCCD 3VMZA 2E75B 3PJSK 2G3AA 1BE3J 1S72P 2JDIH 3G4SP 2Y0DA 5B66E 4YXDD 1SQXD 3JCUH 2IX7C 5KKZB 1FE6A 3A7OA 2WU5D 3WMM0 1CZQA 2Y0CA 3GW6A 1HTLC 3RL0C 2PAJA 1OX3A 4WB4A 1YQ4C 3L71D 1M1JC 4BRYA 2BEQD 3P4PC 3T97B 5AVWB 1NWQA 1MFZA 2E43A 2RMZA 1NHLA 4RJTA 2XU6A 1NTMK 1SQQJ 2O01J 3L72J 3RGUA 2WS3C 2DW3A 3HE4B 5KLVG 1R5LA 1J1EB 4EDFA 5B5EH 4JPZB 3SWFA 1SQXK 2O01N 3WUVA 4XFJA 5C3JC 2JEEA 2G8YA 3JCUE 1IZNB 3L74G 3CLQA 2K9JA 3L72D 1IFJA 4C7RA 4BXLA 3CCSP 3OW2O 1Q86Q 3RK3B 4Y28J 4PJ0E 2V7QH 5APTA 5CCHC 1AVOA 1IFMA 1GMJA 1FZGA 2JWAA 3AECD 3AEAD 4PD4I 4WY4A 1PP9J 3L37A 3VMXA 2YMYA 4YT0D 5APYA 2W8ZA 2IYPA 1Q82Q 3MHVA 5KLVK 2AEFA 3P8CD 4NPDA 1NTMG 1HBWA 3HRNA 1QL2A 3CI9A 4PJ0H 2KZIA 1NO4A 2Y9ZA 2FYNC 1IFNA 1KC8Q 2WDQD 3V2RA 2H7HA 3WUTA 1K04A 2ZYAA 2ZFYA 5C2TC 2E76C 5APVA 1BCCD 1SQVD 1L4AA 1LTIC 2FYNB 1M7LA 1URQA 2IDBA 1L0NE 4AYCA 3H1KG 1M8OB 2FYUG 1PV3A 4C46A 4C7NB 1OVUA 2HG5D 2I8DA 5CCGD 2Z5HA 2O01H 2XNDH 2YKPA 3PTZA 2NZ2A 2BEZF 3VP9A 2ZFCA 1NU1G 1NTZK 3CWBD 4RO0A 3BVHA 1TFFA 3Q2YA 1NTKE 1YTZI 4DDIA 5AW5B 2JKVA 3RL0g 1L4AD 4H44D 1TU3F 4IFMA 5DJUB 2FY8A 3CX5D 1SQQD 3H1LE 1LP1A 3EFFK 1FZAA 2FFDC 4GOEA 1Y47A 4Y99B 2WP9D 4I7ZC 5CCHA 2Z5IA 5GTHH 1Y9BA 4EI2A 3AE3D 1ZLLA 1T2KC 2LR2A 1KD1Q 3MUDC 3AE4C 3HD7B 3GLMA 1NENC 2KXPB 4OGQD 1R5SA 4WY4D 3H1LJ 2BS2C 4D6TJ 1SQQK 2FXOA 4KHXA 4N78D 2WDRD 4KX6D 1KN7A 3VMAA 3D70A 4GODA 4NPFX 3E1RA 1NTMD 2C0WA 3AEBD 4YTPD 1BGYD 2A45I 1J1DB 5GTHE 1HJBA 1ZR4A 3AE1D 3BCCE 1PP9G 2E75D 3M9HA 4M3LA 1M1KQ 1GD2E 1NKZB 1P84E 2B9BA 3AEEC 4NPEA 2MJZA 2AEMA 2FXMA 3L71G 3TGUJ 3H1KD 3M06A 3H1JD 2IPPA 1HF9A 3GF7A 1UIIA 3WU2E 1N7LA 1NEKC 2QJYB 1RE3A 1L2PA 3H1HG 4O9BA 1Z56A 3TGUD 1M90Q 3MIWA 5APSA 2WP9C 2QJKC 3R2PA 3L75D 3CXHD 5AW2B 1SQQG 3VRBD 1Q90D 3JSVC 1URQB 3PHLA 5EFWB 1T2KD 1ZN5A 4K3AA 5APXA 1KZUB 4PD4H 1BSHA 4R4LA 1W2BO 3VP8A 1PP9E 4PD4D 3CXHI 1KYOI 3CCQP 2K88A 1NU1J 3WU2H 5AVVB 4XE5B 3NTNA 3W68A 4YSXC 1H0TB 3D6ZA 3L73J 1JO5A 1K05A 5E79E 5AW6B 3H32A 4Z1MH 1L0VD 1J2JB 1L4AC 1YJ9P 2WSEH 4YTMD 2FBWC 2W6AA 4BRYB 1KQFB 1L0LD 2KI7B 1KYOE 2AXTH 4KT0J 1IC2A 3AEDD 3ABVC 4CPGA 2KSEA 2R5DA 4PD4E 3Q5PA 3USSA 5C2TD 4WVZA 2YKQA 2N9YB 1JY3P 4JF7A 3CCLP 2ACZD 2OTJP 3L4FA 3L36A 3AEED 3LW5J 2LXBA 5AVXB 1U57A 2N1TB 5AVUB 2XZRA 3H1LG 2NPSB 3M91A 3ZDMA 1N86A 1NTME 5KJ7C 1MKMA 3PLNA 5TISH 3CMEP 1VPCA 1KQSO 3B4SA 4IL6E 2P10A 3H1JE 2WT7A 3SSUA 1A02J 2CPBA 1NTZD 2C9LY 1SQVJ 2ZYDA 3TF5A 2K9YA 2R44A 2C0XA 2WITA 1Q7YQ 3H1ID 1SQBK 4YSXD 2Z4EA 1S5LE 2YMKA 4DCKA 1FS0E 4A7PA 1S1CX 4U3FG 4RESB 2N1TA 2A06D 2ZVOB 4L73A 1QVFO 3B5NC 4I2LC 3MUDA 4ASWA 3CL3D 3G9RA 3II6A 2HLOA 4YTNC 1OMIA 2FBWD 3PRJA 3NXSA 1SLQA 3L71J 3L74J 1JTHA 3H1HD 3O8ZA 1NGMB 1NU1D 5CJ0A 2KNCA 3CIRC 2QIWA 4Y99C 4KJMA 1KFMA 4H0LC 3CWBJ 3SFEC 1OVVA 3P4SC 2QVAA 3HTKB 4JBZA 2IFMA 4W7ZA 5APWA 2H88D 1HJ0A 3CCJP 1PIXA 1J1DC 4YXDC 4I1LA 1SQQE 3VONA 4D6TD 2FYUE 4DT0A 1ZP0C 4OH8B 4LDTA 2YIUC 1KF6D 2E74C 5KAFH 3U1AA 1NTMJ 2ZXXA 3P4SD 3VRAC 3QWOC 4ZKUA 2B89A 1HGZA 5CHXA 3D71A 1JTHB 2WDRC 4I6MC 1GTWA 2QJPB 1FJKA 3L70J 1Q2NA 3VRBC 3KHUA 1NTZE 1EC5A 1R8EA 3H1KJ 1OXZA 2FFDB 1X79B 1VQOP 5M1BA 3MTUE 2AXCA 3PH0A 1JCCA 4UB6H 2ZAEB 2OYOA 5CCHD 3BCCJ 2KB7P 1IFDA 2WU2D 1SQVK 3CCUP 3U1CA 1GK6A 1LWUC 3L35A 4IOIH 4PV1B 5KAIH 3L72E 3FWNA 1SQXJ 3M9BA 3CC7P 2NPSC 1LT1A 2WDVD 3V2QA 2OGUA 4H44C 1AVYA 3AE9C 2XDJA 1ZW0A 2FKWB 2FXPA 1RQUA 1L0LE 1Y8AA 2ZXEB 2J58A 1FZEA 2CPSA 2ZT9D 1KTMA 2H8PD 1SQPE 1FJPA 3L74D 3PP5A 1RF1C 2P67A 3RK2B 5CCGA 1NU1K 3C8VA 1NAYA 4GDOA 1IFPA 5CMZA 2W6JH 1S9KE 1HVVA 1XTGB 1URQD 1WRGA 1DD3A 5KJ7D 2E42A 1H89A 3RBZA 1T8ZA 4XA4A 4WY4B 2P7JA 3L73E 1K8AQ 2E5TA 3KYQA 3TYYA 3CC4P 1GW3A 3Q1MA 3GF3A 3E7KA 1HH0A 1YJWP 4JYBA 3VN0A 1L0LK 1QX8A 3CXHE 3QH9A 1EZVD 1GZLA 1KV4A 2WU2C 1P84H 3AEFC 1PGPA 2QM8A 1DH3A 3IAOA 1VQMP 1SFCA 1VQNP 3VRAD 1VQ9P 3RK3E 4GKGA 4EIJA 1QL1A 2HODB 2R3SA 3MP7B 1YITP 1FOSE 1KF6C 3HTKA 3NFQA 2QJYC 3FXDA 1EZVE 1P84D 1YQ3C 3CCMP 1WT6A 1KB9D 2MKVA 3V2NA 1NAFA 1GDTA 1RY3A 2A06E 1K9MQ 4DHJA 2BASA 2KS1A 2OYIC 2O3JA 1NJIQ 3GHGB 2O1KA 1JMMA 5H2FE 2OQQA 3O6QB 1BGYE 1BE3G 3A5TA 2FYZA 2HPCA 3SWKA 1G1IA 1AJYA 4U3FE 1VQPP 1L0NG 3L75G 1G2CB 2BCCD 3AE6C 1YBKA 1EZVI 5CBNA 1YI2P 3CCEP 1QEXA 5AVTB 4HB1A 1VF5C 5AW3B 3AE8C 3L74E 4RKUJ 1SQPD 2QJKB 2E75C 4DHIB 1RHZB 2H89C 5AW4B 2OYIB 1VQ7P 2A06G 1GU5A 3SFED 5H2FH 3BCCG 2ZT9C 3TK1A 2HYNA 1CI6B 3BATA 1KMIZ 2QG4A 2WPRA 2XNXA 2AXTE 4DOJA 2WSEJ 3HUSC 1KORA 1FZCA 2QM7A 2OTKE 5AVRB 3I55P 3CPWO 1YTZT 1GL2D 4GT1A 3B5NA 2P1JA 4YSYC 2YXRB 3UIAA 2P2UA 4DDGA 4N3YB 1DEBA 3HE5A 1MZ9A 1ZOYC 3CWBE 2AEJA 1JY2P 2UWJE 1GL2B 4YSZC 3VYIA 2IBZG 2KIKA 1FZCC 5C3JD 1FBMA 1MFTA 2WT7B 3CCRP 4YTND 1RE4A 1OZHA 3IR9A 4AUWA 4C7NA 1ZP0D 3F89A 1BCCE 1LTJB 2M5AB 1VF5D 3CIRD 4U3FD 4H13D 1OFCX 5AW7B 4WWIA 3KPEA 4MN4C 1KILA 3P7KA 5CBOA 3CX5I 3AE8D 4D6TE 4L74A 3RBXA 1EDIA 1VQ4P 3A0BE 3MD0A 3V2PA 1ZV8A 3AEDC 3C1LA 4TLFA 1VQKP 1SQPK 3B71A 2NPSD 3CX5H 4JYCA 2B88A 5AW0B 3HD7A 1KYOH 3P4QC 1SQBJ 2D2CB 2IBZD 3AE2C 1FZFA 4ZMDA 1OW8A 2FFDA 5APQA 5AW8B 4HH2A 3HD7D 2B76C 1NTKG 2Q7CA 3P8MC 3AE5C 1NU1E 1LWUB 1PL5A 4LC1A 1VL2A 2C9NY 2R32A 2IFNA 1N7SB 2KP8A 4N6JA 2P58A 3FGAD 2OYHC 2D2CC 4WY4C 1LWUA 5TISE 1LTTC 2XV5A 3H1HJ 4R4MA 3K5BA 5B5EE 1N7SD 3G6EP 2WPSA 4YTMC 2Q1KA 1YQ4D 3TSIA 3VR8C 1S3JA 1VQ8P 2PGDA 1VDFA 1KB9I 1D7MA 1SQVG 1LT9A 2PFXA 1IO4A 3RK2C 1E7PC 3V5BA 1RF1B 2OYHA 2QJPC 1J1EC 1M57D 2QEXP 1S9KD 2YXQB 4YTPC 2ZJSE 2GUSA 3H25A 4BWNA 3VR9C 1LTGC 2E74B 1S5LH 1EQ7A 2OYHB 4H44B 3SFDC 2WDVC 4D6TG 1IFIA 4H13C 2WPVB 3H32B 1N7SC 5C39A 2M3EA 1GK4A 2IBZE 1PGJA 2KSJA 1N73B 3AEGC 2WSCH 3RL0B 3U59A 1GL2A 5KKZC 4ASVA 5CCGC 2JP3A 2GUVA 4GOFA 2NRGA 3RK3C 3RL0D 3S9OA 3OAKA 2WQYC 3G3ZA 1BGYG 1KFNA 1U7MA 1KYOD 2IBZI 2JR8A 1LNQA 1YQ3D 2D2CD 3EFGA 2WDQC 4YT0C 3Q5RA 1T3JA 3IN6A 1PFIA 3NMDA 3H1IJ 1ZR2A 5KLVJ 1YYCA 1JNMA 3B5NB 2ACZC 1PGQA 1E79H 3TNUB 3Q5SA 2IYOA 1LTJC 3W67A 3TNUA 1SQVE 4L75A 4JQ0D 3A0HH 2POHA 3AE1C 3VTPC 3H6PA 4L76A 1LP1B 3OJAB 1SQBE 1FC2C 1FZBA 1AQ5A 4IL6X 1DEEG 2A45G 2BCCJ 3IF4A 1NTKJ 3CCVP 1EDJA 2Q3EA 1YJNP 3V4QA 5AW9B 1JCDA 5AVSB 1KQGB 3I5CA 2GA1A 4ZKPA 1SQBG 1EDLA 1KFYD 3CXHH 3MGNA 1X9VA 3AE9D 1NVOA 1N73A 1S5LX 2QSIA 1MUUA 3B8EB 2WU5C 1KILC 1BSNA 3M9QA 2ZVNB 4YSZD 3VOPA 1NTZG 2B87A 3IFMA 1EZVG 2JJLA 2WSFJ 5L8RJ 4PV1D 2WVRA 2H88C 1SFCB 3A3YB 3LIEA 1LT9B 2YO3A 3R4YA 4OGQC 5KJ7A 2M3BA 1OW7A 2FYUK 4GIFA 3CD6P 3FWLA 1BDDA 5DJTB 4YXWH 1JB0J 1PPJE 3H1IE 1USDA 1G1JA 1FU1A 4N78E 2YO2A 1QVGO 1KB9E 2QA4P 1QGKB 1JY2O 1JOCA 2O1JA 3L71E 2PP6A 2IZ0A 1RQVA 3TGUG 4I6LA 3G71P 5CJ4A 1X0TA 4OVNF 1JEKA 2WWWA 4OGQB 1NH4A 2A45H 2M5AA 2WMMA 2KLUA 1LTSC 2JO1A 1CSBA 1PPJD 2N1TC 2WQYD 1SQXE 1KQLA 1LGHB 2W27A 1NYHA 3AEAC 2ITAA 2L91A 4YPCA 3AE3C 2M8RA 3AECC 4EOTA 1VQ5P 5KLIB 3KXDA 1XTCC 2KK7A 2KS1B 4DJGA 2J59M 2VRSA 1NEND 1NEKD 1E5WA 2L5GB 4H0LD 1RE3C 1ZMEC 1DX7A 2K9JB 3I56P 1SQBD 1T6AA 1IK9A 1EXIA 1LJ2A 1NTKD 2Y9YA 2XKMA 3L73D 3FX0A 2RH0A 3L70E 1AA0A 2E5YA 4HJGH 2R5BA 3CC2P 4LLHA 3M0AA 3CWBG 3AEGD 1X8YA 1ZRTE 1SQXG 1RF0A 3F5HA 3KDPB 3P4RC 1LTJA 5E79H 2BCCG 3N7NA 2RN0A 1X22A 2CK3H 3T97A 1L0ND 1AQTA 2OYIA 3L72G 3MZWB 1SFCC 3AE7D 1SS1A 1AV1A 2FYUJ 5TJHA 2W6BA 4EYYQ 3AE6D 4IFDK 1ZOYD 1BCCG 1L0NJ 1PP9D 1FOSF 1RH5B 5KAFE 2WTYA 2H43A 1KILB 4KX6C 3LIDA 2M0BA 3TDKA 4OWFA 1M1JA 1BGYJ 3A2AA 3C9IA 2YNYA 3EQ2A 3TGUE 1NTZJ 4PV1C 2RKLA 3KZIH 2B87B 1CW5A 3ITKA 4IL6H 4B86A 2WSFH 1UIXA 1PPJG 5GTIE 2N9BA 1DIPA 1BCCJ 2I1KA 1T3UA 2Q9IA 1FDMA 3H1JJ
chains in the Genus database with same CATH topology
1PIXA 2FXPA 1ZOYC 4H0LB 4YXDD 2QJKC 1RQUA 2QJYC 3VR8D 4YXDC 1YQ3C 1Y9BA 1YQ3D 2MKVA 3FGAD 2D2CD 4YSZD 2D2CC 4YSZC 3VR9D 3VRBD 2WDQC 5KLIC 1Q90D 2WU5D 4YT0C 2ZT9D 1KTMA 3AE3D 3AEGD 3Q5RA 2WSFJ 1WMKA 3D6YA 2P10A 3IN6A 1ZRTE 5L8RJ 5C3JD 2J5UA 3AE4D 1ZP0C 3AE4C 3P4RD 4R4MA 4PV1D 3GLMA 2H88C 3P4RC 4H13B 2YIUC 2OQQA 3C8VA 4R4LA 1KF6D 1DD4A 2FYNC 1NENC 1VF5B 1YQ4C 4GDOA 3R4YA 2ACZC 4YTMC 4YTND 1YQ4D 4OGQC 3AEBC 3VR8C 2K9YA 4OGQD 2E74C 1OW7A 3Q5SA 2WS3D 2WDQD 2BEQD 2BS2C 3P4PC 1AJYA 2WSCJ 1FDIA 3T97B 3P4SD 2V7QJ 3VRAC 1K04A 3AE1C 1JB0J 3O6QA 1ZP0D 5C2TC 3AE5D 3AE7D 1DD3A 2E76C 2WDRD 3D71A 1E7PC 4YSXD 2WDRC 4YSXC 1VF5D 3AE6C 4KX6D 3SFDD 2QJPC 3CIRD 3AE6D 4H13D 3D70A 2O01J 2E76B 1ZOYD 2YMKA 3D6ZA 2IDBA 2WS3C 1IK7A 4YTPC 1K05A 3AEBD 1RQVA 4YTPD 3GMAA 3H25A 1L0VC 3VRBC 3VR9C 1S1CX 4Z1MH 1L0VD 2BS3C 3AE7C 1PV3A 2E74B 4U7JA 1R8EA 4OGQB 3AE1D 4IL6X 4XFJA 5C3JC 4H44B 1VF5C 2G8YA 3SFDC 2WDVC 3AE8C 3Q1MA 4H13C 3GF3A 3AE8D 2E75D 4RKUJ 2JO1A 2WPVB 3G9RA 2E75C 1EXJA 2WQYD 4KX6C 2H89C 2H89D 2NZ2A 2BEZF 2FBWC 3AEFD 4YTNC 4YTMD 1OMIA 2FBWD 3AEDC 1KQFB 4KT0J 3AEDD 1NYHA 3ABVC 5M1BA 3AEAC 3SFED 3EWKA 3AEEC 4Y28J 3Q5PA 4YSYD 3Q2YA 2ZT9C 3AE3C 1KQGB 3AEGC 1NGMB 3B71A 5C2TD 1OW6A 3RL0g 1KF6C 2E76D 1KFYD 1GMJA 1KMIZ 3AECC 4H44D 2WU2D 1TU3F 2WU2C 4PV1C 5KKZC 3AE2D 2D2CB 3AECD 3P4QC 3AE2C 3P4QD 2WSEJ 3CIRC 2QIWA 3AEFC 3Q3DA 1NEND 2ZT9B 1HF9A 1KORA 1OW8A 3GF7A 1NEKC 2ACZD 3AE9D 1NEKD 2JP3A 4PV1B 1FDOA 3IAOA 4H0LC 3SFEC 1S5LX 2E74D 4H0LD 3AEAD 2QSIA 3AEED 3LW5J 2BS4C 3P4PD 2B76C 3ABVD 1U57A 3P4SC 4I7ZB 1UIXA 2B76D 3VRAD 1ZMEC 4YSYC 1DIPA 2E75B 1KILE 2WU5C 3RK3E 1KFYC 4YT0D 3AE5C 2G3AA 2WDVD 1PL5A 4I7ZC 4H44C 2H88D 3S9OA 1VL2A 1EXIA 1QLBC 2WP9C 2WP9D 3AE9C 4TT3H 1HJ0A 2WQYC 1MKMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZOY C;  4YXD D;  3VR8 D;  4YXD C;  1YQ3 C;  1YQ3 D;  4YSZ D;  4YSZ C;  3VR9 D;  3VRB D;  2WDQ C;  2WU5 D;  4YT0 C;  3AE3 D;  1KTM A;  3AEG D;  5C3J D;  3AE4 D;  1ZP0 C;  3AE4 C;  3P4R D;  2H88 C;  3P4R C;  1KF6 D;  1NEN C;  2ACZ C;  1YQ4 C;  4YTM C;  4YTN D;  1YQ4 D;  3AEB C;  3VR8 C;  1OW7 A;  2WS3 D;  2WDQ D;  2BS2 C;  3P4P C;  3P4S D;  3VRA C;  1K04 A;  3AE1 C;  1ZP0 D;  5C2T C;  3AE5 D;  3AE7 D;  2WDR D;  4YSX D;  1E7P C;  2WDR C;  4YSX C;  3AE6 C;  4KX6 D;  3SFD D;  3CIR D;  3AE6 D;  1ZOY D;  2WS3 C;  4YTP C;  1K05 A;  3AEB D;  4YTP D;  1L0V C;  3VRB C;  3VR9 C;  1L0V D;  2BS3 C;  3AE7 C;  1PV3 A;  3AE1 D;  5C3J C;  3SFD C;  2WDV C;  3AE8 C;  3AE8 D;  4KX6 C;  2WQY D;  2H89 C;  2H89 D;  4YTN C;  3AEF D;  2FBW C;  4YTM D;  2FBW D;  3AED C;  3AED D;  3ABV C;  3AEA C;  3SFE D;  3AEE C;  4YSY D;  3AE3 C;  3AEG C;  3B71 A;  5C2T D;  1OW6 A;  1KFY D;  2WU2 D;  3AEC C;  2WU2 C;  3AE2 D;  3AEC D;  3P4Q C;  3AE2 C;  3P4Q D;  3CIR C;  3AEF C;  1NEN D;  2ACZ D;  3AE9 D;  1NEK C;  1OW8 A;  1NEK D;  3SFE C;  3AEA D;  3AEE D;  2BS4 C;  3P4P D;  2B76 C;  3ABV D;  3P4S C;  2B76 D;  3VRA D;  4YSY C;  2WU5 C;  1KFY C;  4YT0 D;  3AE5 C;  2G3A A;  2WDV D;  2WP9 D;  2H88 D;  3S9O A;  1QLB C;  2WP9 C;  3AE9 C;  1KF6 C;  2WQY C; 
#chains in the Genus database with same CATH topology
 3OA7 A;  4H0L B;  1PZQ A;  2KNC B;  3E1I A;  1CI6 A;  5KAI E;  4LGD E;  1WMK A;  3HUS A;  3D6Y A;  3GHG A;  2W83 C;  2Q6Q A;  2J5U A;  3AE4 D;  1NOH A;  1SQP J;  3L73 G;  4H13 B;  5AW1 B;  1OIP A;  2WS3 D;  2HPC B;  3KZI E;  2Y0E A;  3O6Q A;  5BU8 B;  5KLV D;  1MV8 A;  1JY3 O;  1H8A A;  5GTI H;  3WUU A;  1JM0 A;  3FXE A;  2E76 B;  2YIU B;  1IK7 A;  3H1J G;  1G2C A;  2NPS A;  3LW5 H;  2BS3 C;  3AE7 C;  3M0D A;  1HGV A;  2HOD A;  1ZRT D;  3AEF D;  1JMB A;  2KZJ A;  1YHQ P;  4DZO A;  4YSY D;  3H1H E;  1KIL D;  3AE2 D;  3P4Q D;  2HR3 A;  2FYU D;  1N73 C;  1AFO A;  1ZXG A;  3H1L D;  3CX5 E;  1YIJ P;  2SPZ A;  2B76 D;  1NKN A;  1KIL E;  1HWT C;  1KFY C;  1BE3 E;  5AVY B;  4W80 A;  1H88 A;  1FAV A;  1Q81 Q;  4TT3 H;  1N2D C;  2WZ7 A;  1JUN A;  3V4W A;  1L0N K;  1U7J A;  2OAR A;  1HUC A;  5KLI C;  2K3R A;  3L70 G;  2YKO A;  3BAS A;  4HYT B;  4U3F J;  1BDC A;  1W5C E;  3AEB C;  5BVZ A;  2R3C A;  2WSC J;  2V7Q J;  4UB8 H;  2JWD A;  2Q3I A;  5KLV E;  3B5N D;  4QMA A;  3RK2 D;  3SFD D;  3S1K A;  2PRR A;  1OVR A;  3CMA P;  4UB6 E;  1SP4 A;  3VMY A;  5AVZ B;  1L0V C;  2QE7 H;  1RF0 C;  2IZ1 A;  1JY2 N;  3P8C E;  1N7S A;  3N4X A;  4HKZ H;  2N1T D;  3L75 J;  2KYV A;  2H89 D;  1FZC B;  1M56 D;  1LT9 C;  3EWK A;  1GL2 C;  2LKM A;  2KUB A;  5AVQ B;  1L0L G;  2WSS H;  5APU A;  1OWA A;  2LXC B;  4UB8 E;  3Q3D A;  4FJV A;  1S2E A;  2E74 D;  4K35 A;  4DHZ A;  3SWY A;  1GW4 A;  1NTK K;  3KQG A;  5K5G B;  1VQL P;  1QLB C;  3JC2 2;  1VQ6 P;  1JY3 N;  3VR8 D;  2OTL P;  1L4A B;  3GG2 A;  3VR9 D;  1RF1 A;  3HE4 A;  2GM4 A;  1SQP G;  3P4R D;  1K73 Q;  1RE4 C;  1DD4 A;  1S4X A;  1VF5 B;  3M0D C;  1L0L J;  3BRV B;  4W7Y A;  3S4R A;  1M1J B;  3H1I G;  1FDI A;  1P84 I;  2WPQ A;  2ZYG A;  3AE5 D;  1SFC D;  2KOG A;  4IFF A;  3P32 A;  3A0H E;  1LTA C;  1PGO A;  4AQR D;  2HFE D;  1QLE D;  3GMA A;  1URQ C;  1KB9 H;  4U7J A;  1H0T A;  3RK3 D;  5B66 H;  1W2E A;  2BCC E;  1EDK A;  1IJD B;  2V4H A;  4WBA A;  1EXJ A;  3GHG C;  2I1J A;  3L70 D;  2Q5U A;  2KLV A;  4ZNC A;  1USE A;  3H1K E;  3HD7 C;  2W90 A;  3HUS B;  5KTB A;  1OW6 A;  1A02 F;  1LTB C;  2E76 D;  5BU5 A;  1BE3 D;  1GU4 A;  2K1A A;  2ZT9 B;  2K37 A;  1FDO A;  3BRT B;  1N8R Q;  2QRX A;  2BS4 C;  3P4P D;  3A0B H;  1SVF A;  3L75 E;  3ABV D;  4I7Z B;  3V6I A;  3HE5 B;  3BCC D;  3VMZ A;  2E75 B;  3PJS K;  2G3A A;  1BE3 J;  1S72 P;  2JDI H;  3G4S P;  2Y0D A;  5B66 E;  4YXD D;  1SQX D;  3JCU H;  2IX7 C;  5KKZ B;  1FE6 A;  3A7O A;  2WU5 D;  3WMM 0;  1CZQ A;  2Y0C A;  3GW6 A;  1HTL C;  3RL0 C;  2PAJ A;  1OX3 A;  4WB4 A;  1YQ4 C;  3L71 D;  1M1J C;  4BRY A;  2BEQ D;  3P4P C;  3T97 B;  5AVW B;  1NWQ A;  1MFZ A;  2E43 A;  2RMZ A;  1NHL A;  4RJT A;  2XU6 A;  1NTM K;  1SQQ J;  2O01 J;  3L72 J;  3RGU A;  2WS3 C;  2DW3 A;  3HE4 B;  5KLV G;  1R5L A;  1J1E B;  4EDF A;  5B5E H;  4JPZ B;  3SWF A;  1SQX K;  2O01 N;  3WUV A;  4XFJ A;  5C3J C;  2JEE A;  2G8Y A;  3JCU E;  1IZN B;  3L74 G;  3CLQ A;  2K9J A;  3L72 D;  1IFJ A;  4C7R A;  4BXL A;  3CCS P;  3OW2 O;  1Q86 Q;  3RK3 B;  4Y28 J;  4PJ0 E;  2V7Q H;  5APT A;  5CCH C;  1AVO A;  1IFM A;  1GMJ A;  1FZG A;  2JWA A;  3AEC D;  3AEA D;  4PD4 I;  4WY4 A;  1PP9 J;  3L37 A;  3VMX A;  2YMY A;  4YT0 D;  5APY A;  2W8Z A;  2IYP A;  1Q82 Q;  3MHV A;  5KLV K;  2AEF A;  3P8C D;  4NPD A;  1NTM G;  1HBW A;  3HRN A;  1QL2 A;  3CI9 A;  4PJ0 H;  2KZI A;  1NO4 A;  2Y9Z A;  2FYN C;  1IFN A;  1KC8 Q;  2WDQ D;  3V2R A;  2H7H A;  3WUT A;  1K04 A;  2ZYA A;  2ZFY A;  5C2T C;  2E76 C;  5APV A;  1BCC D;  1SQV D;  1L4A A;  1LTI C;  2FYN B;  1M7L A;  1URQ A;  2IDB A;  1L0N E;  4AYC A;  3H1K G;  1M8O B;  2FYU G;  1PV3 A;  4C46 A;  4C7N B;  1OVU A;  2HG5 D;  2I8D A;  5CCG D;  2Z5H A;  2O01 H;  2XND H;  2YKP A;  3PTZ A;  2NZ2 A;  2BEZ F;  3VP9 A;  2ZFC A;  1NU1 G;  1NTZ K;  3CWB D;  4RO0 A;  3BVH A;  1TFF A;  3Q2Y A;  1NTK E;  1YTZ I;  4DDI A;  5AW5 B;  2JKV A;  3RL0 g;  1L4A D;  4H44 D;  1TU3 F;  4IFM A;  5DJU B;  2FY8 A;  3CX5 D;  1SQQ D;  3H1L E;  1LP1 A;  3EFF K;  1FZA A;  2FFD C;  4GOE A;  1Y47 A;  4Y99 B;  2WP9 D;  4I7Z C;  5CCH A;  2Z5I A;  5GTH H;  1Y9B A;  4EI2 A;  3AE3 D;  1ZLL A;  1T2K C;  2LR2 A;  1KD1 Q;  3MUD C;  3AE4 C;  3HD7 B;  3GLM A;  1NEN C;  2KXP B;  4OGQ D;  1R5S A;  4WY4 D;  3H1L J;  2BS2 C;  4D6T J;  1SQQ K;  2FXO A;  4KHX A;  4N78 D;  2WDR D;  4KX6 D;  1KN7 A;  3VMA A;  3D70 A;  4GOD A;  4NPF X;  3E1R A;  1NTM D;  2C0W A;  3AEB D;  4YTP D;  1BGY D;  2A45 I;  1J1D B;  5GTH E;  1HJB A;  1ZR4 A;  3AE1 D;  3BCC E;  1PP9 G;  2E75 D;  3M9H A;  4M3L A;  1M1K Q;  1GD2 E;  1NKZ B;  1P84 E;  2B9B A;  3AEE C;  4NPE A;  2MJZ A;  2AEM A;  2FXM A;  3L71 G;  3TGU J;  3H1K D;  3M06 A;  3H1J D;  2IPP A;  1HF9 A;  3GF7 A;  1UII A;  3WU2 E;  1N7L A;  1NEK C;  2QJY B;  1RE3 A;  1L2P A;  3H1H G;  4O9B A;  1Z56 A;  3TGU D;  1M90 Q;  3MIW A;  5APS A;  2WP9 C;  2QJK C;  3R2P A;  3L75 D;  3CXH D;  5AW2 B;  1SQQ G;  3VRB D;  1Q90 D;  3JSV C;  1URQ B;  3PHL A;  5EFW B;  1T2K D;  1ZN5 A;  4K3A A;  5APX A;  1KZU B;  4PD4 H;  1BSH A;  4R4L A;  1W2B O;  3VP8 A;  1PP9 E;  4PD4 D;  3CXH I;  1KYO I;  3CCQ P;  2K88 A;  1NU1 J;  3WU2 H;  5AVV B;  4XE5 B;  3NTN A;  3W68 A;  4YSX C;  1H0T B;  3D6Z A;  3L73 J;  1JO5 A;  1K05 A;  5E79 E;  5AW6 B;  3H32 A;  4Z1M H;  1L0V D;  1J2J B;  1L4A C;  1YJ9 P;  2WSE H;  4YTM D;  2FBW C;  2W6A A;  4BRY B;  1KQF B;  1L0L D;  2KI7 B;  1KYO E;  2AXT H;  4KT0 J;  1IC2 A;  3AED D;  3ABV C;  4CPG A;  2KSE A;  2R5D A;  4PD4 E;  3Q5P A;  3USS A;  5C2T D;  4WVZ A;  2YKQ A;  2N9Y B;  1JY3 P;  4JF7 A;  3CCL P;  2ACZ D;  2OTJ P;  3L4F A;  3L36 A;  3AEE D;  3LW5 J;  2LXB A;  5AVX B;  1U57 A;  2N1T B;  5AVU B;  2XZR A;  3H1L G;  2NPS B;  3M91 A;  3ZDM A;  1N86 A;  1NTM E;  5KJ7 C;  1MKM A;  3PLN A;  5TIS H;  3CME P;  1VPC A;  1KQS O;  3B4S A;  4IL6 E;  2P10 A;  3H1J E;  2WT7 A;  3SSU A;  1A02 J;  2CPB A;  1NTZ D;  2C9L Y;  1SQV J;  2ZYD A;  3TF5 A;  2K9Y A;  2R44 A;  2C0X A;  2WIT A;  1Q7Y Q;  3H1I D;  1SQB K;  4YSX D;  2Z4E A;  1S5L E;  2YMK A;  4DCK A;  1FS0 E;  4A7P A;  1S1C X;  4U3F G;  4RES B;  2N1T A;  2A06 D;  2ZVO B;  4L73 A;  1QVF O;  3B5N C;  4I2L C;  3MUD A;  4ASW A;  3CL3 D;  3G9R A;  3II6 A;  2HLO A;  4YTN C;  1OMI A;  2FBW D;  3PRJ A;  3NXS A;  1SLQ A;  3L71 J;  3L74 J;  1JTH A;  3H1H D;  3O8Z A;  1NGM B;  1NU1 D;  5CJ0 A;  2KNC A;  3CIR C;  2QIW A;  4Y99 C;  4KJM A;  1KFM A;  4H0L C;  3CWB J;  3SFE C;  1OVV A;  3P4S C;  2QVA A;  3HTK B;  4JBZ A;  2IFM A;  4W7Z A;  5APW A;  2H88 D;  1HJ0 A;  3CCJ P;  1PIX A;  1J1D C;  4YXD C;  4I1L A;  1SQQ E;  3VON A;  4D6T D;  2FYU E;  4DT0 A;  1ZP0 C;  4OH8 B;  4LDT A;  2YIU C;  1KF6 D;  2E74 C;  5KAF H;  3U1A A;  1NTM J;  2ZXX A;  3P4S D;  3VRA C;  3QWO C;  4ZKU A;  2B89 A;  1HGZ A;  5CHX A;  3D71 A;  1JTH B;  2WDR C;  4I6M C;  1GTW A;  2QJP B;  1FJK A;  3L70 J;  1Q2N A;  3VRB C;  3KHU A;  1NTZ E;  1EC5 A;  1R8E A;  3H1K J;  1OXZ A;  2FFD B;  1X79 B;  1VQO P;  5M1B A;  3MTU E;  2AXC A;  3PH0 A;  1JCC A;  4UB6 H;  2ZAE B;  2OYO A;  5CCH D;  3BCC J;  2KB7 P;  1IFD A;  2WU2 D;  1SQV K;  3CCU P;  3U1C A;  1GK6 A;  1LWU C;  3L35 A;  4IOI H;  4PV1 B;  5KAI H;  3L72 E;  3FWN A;  1SQX J;  3M9B A;  3CC7 P;  2NPS C;  1LT1 A;  2WDV D;  3V2Q A;  2OGU A;  4H44 C;  1AVY A;  3AE9 C;  2XDJ A;  1ZW0 A;  2FKW B;  2FXP A;  1RQU A;  1L0L E;  1Y8A A;  2ZXE B;  2J58 A;  1FZE A;  2CPS A;  2ZT9 D;  1KTM A;  2H8P D;  1SQP E;  1FJP A;  3L74 D;  3PP5 A;  1RF1 C;  2P67 A;  3RK2 B;  5CCG A;  1NU1 K;  3C8V A;  1NAY A;  4GDO A;  1IFP A;  5CMZ A;  2W6J H;  1S9K E;  1HVV A;  1XTG B;  1URQ D;  1WRG A;  1DD3 A;  5KJ7 D;  2E42 A;  1H89 A;  3RBZ A;  1T8Z A;  4XA4 A;  4WY4 B;  2P7J A;  3L73 E;  1K8A Q;  2E5T A;  3KYQ A;  3TYY A;  3CC4 P;  1GW3 A;  3Q1M A;  3GF3 A;  3E7K A;  1HH0 A;  1YJW P;  4JYB A;  3VN0 A;  1L0L K;  1QX8 A;  3CXH E;  3QH9 A;  1EZV D;  1GZL A;  1KV4 A;  2WU2 C;  1P84 H;  3AEF C;  1PGP A;  2QM8 A;  1DH3 A;  3IAO A;  1VQM P;  1SFC A;  1VQN P;  3VRA D;  1VQ9 P;  3RK3 E;  4GKG A;  4EIJ A;  1QL1 A;  2HOD B;  2R3S A;  3MP7 B;  1YIT P;  1FOS E;  1KF6 C;  3HTK A;  3NFQ A;  2QJY C;  3FXD A;  1EZV E;  1P84 D;  1YQ3 C;  3CCM P;  1WT6 A;  1KB9 D;  2MKV A;  3V2N A;  1NAF A;  1GDT A;  1RY3 A;  2A06 E;  1K9M Q;  4DHJ A;  2BAS A;  2KS1 A;  2OYI C;  2O3J A;  1NJI Q;  3GHG B;  2O1K A;  1JMM A;  5H2F E;  2OQQ A;  3O6Q B;  1BGY E;  1BE3 G;  3A5T A;  2FYZ A;  2HPC A;  3SWK A;  1G1I A;  1AJY A;  4U3F E;  1VQP P;  1L0N G;  3L75 G;  1G2C B;  2BCC D;  3AE6 C;  1YBK A;  1EZV I;  5CBN A;  1YI2 P;  3CCE P;  1QEX A;  5AVT B;  4HB1 A;  1VF5 C;  5AW3 B;  3AE8 C;  3L74 E;  4RKU J;  1SQP D;  2QJK B;  2E75 C;  4DHI B;  1RHZ B;  2H89 C;  5AW4 B;  2OYI B;  1VQ7 P;  2A06 G;  1GU5 A;  3SFE D;  5H2F H;  3BCC G;  2ZT9 C;  3TK1 A;  2HYN A;  1CI6 B;  3BAT A;  1KMI Z;  2QG4 A;  2WPR A;  2XNX A;  2AXT E;  4DOJ A;  2WSE J;  3HUS C;  1KOR A;  1FZC A;  2QM7 A;  2OTK E;  5AVR B;  3I55 P;  3CPW O;  1YTZ T;  1GL2 D;  4GT1 A;  3B5N A;  2P1J A;  4YSY C;  2YXR B;  3UIA A;  2P2U A;  4DDG A;  4N3Y B;  1DEB A;  3HE5 A;  1MZ9 A;  1ZOY C;  3CWB E;  2AEJ A;  1JY2 P;  2UWJ E;  1GL2 B;  4YSZ C;  3VYI A;  2IBZ G;  2KIK A;  1FZC C;  5C3J D;  1FBM A;  1MFT A;  2WT7 B;  3CCR P;  4YTN D;  1RE4 A;  1OZH A;  3IR9 A;  4AUW A;  4C7N A;  1ZP0 D;  3F89 A;  1BCC E;  1LTJ B;  2M5A B;  1VF5 D;  3CIR D;  4U3F D;  4H13 D;  1OFC X;  5AW7 B;  4WWI A;  3KPE A;  4MN4 C;  1KIL A;  3P7K A;  5CBO A;  3CX5 I;  3AE8 D;  4D6T E;  4L74 A;  3RBX A;  1EDI A;  1VQ4 P;  3A0B E;  3MD0 A;  3V2P A;  1ZV8 A;  3AED C;  3C1L A;  4TLF A;  1VQK P;  1SQP K;  3B71 A;  2NPS D;  3CX5 H;  4JYC A;  2B88 A;  5AW0 B;  3HD7 A;  1KYO H;  3P4Q C;  1SQB J;  2D2C B;  2IBZ D;  3AE2 C;  1FZF A;  4ZMD A;  1OW8 A;  2FFD A;  5APQ A;  5AW8 B;  4HH2 A;  3HD7 D;  2B76 C;  1NTK G;  2Q7C A;  3P8M C;  3AE5 C;  1NU1 E;  1LWU B;  1PL5 A;  4LC1 A;  1VL2 A;  2C9N Y;  2R32 A;  2IFN A;  1N7S B;  2KP8 A;  4N6J A;  2P58 A;  3FGA D;  2OYH C;  2D2C C;  4WY4 C;  1LWU A;  5TIS E;  1LTT C;  2XV5 A;  3H1H J;  4R4M A;  3K5B A;  5B5E E;  1N7S D;  3G6E P;  2WPS A;  4YTM C;  2Q1K A;  1YQ4 D;  3TSI A;  3VR8 C;  1S3J A;  1VQ8 P;  2PGD A;  1VDF A;  1KB9 I;  1D7M A;  1SQV G;  1LT9 A;  2PFX A;  1IO4 A;  3RK2 C;  1E7P C;  3V5B A;  1RF1 B;  2OYH A;  2QJP C;  1J1E C;  1M57 D;  2QEX P;  1S9K D;  2YXQ B;  4YTP C;  2ZJS E;  2GUS A;  3H25 A;  4BWN A;  3VR9 C;  1LTG C;  2E74 B;  1S5L H;  1EQ7 A;  2OYH B;  4H44 B;  3SFD C;  2WDV C;  4D6T G;  1IFI A;  4H13 C;  2WPV B;  3H32 B;  1N7S C;  5C39 A;  2M3E A;  1GK4 A;  2IBZ E;  1PGJ A;  2KSJ A;  1N73 B;  3AEG C;  2WSC H;  3RL0 B;  3U59 A;  1GL2 A;  5KKZ C;  4ASV A;  5CCG C;  2JP3 A;  2GUV A;  4GOF A;  2NRG A;  3RK3 C;  3RL0 D;  3S9O A;  3OAK A;  2WQY C;  3G3Z A;  1BGY G;  1KFN A;  1U7M A;  1KYO D;  2IBZ I;  2JR8 A;  1LNQ A;  1YQ3 D;  2D2C D;  3EFG A;  2WDQ C;  4YT0 C;  3Q5R A;  1T3J A;  3IN6 A;  1PFI A;  3NMD A;  3H1I J;  1ZR2 A;  5KLV J;  1YYC A;  1JNM A;  3B5N B;  2ACZ C;  1PGQ A;  1E79 H;  3TNU B;  3Q5S A;  2IYO A;  1LTJ C;  3W67 A;  3TNU A;  1SQV E;  4L75 A;  4JQ0 D;  3A0H H;  2POH A;  3AE1 C;  3VTP C;  3H6P A;  4L76 A;  1LP1 B;  3OJA B;  1SQB E;  1FC2 C;  1FZB A;  1AQ5 A;  4IL6 X;  1DEE G;  2A45 G;  2BCC J;  3IF4 A;  1NTK J;  3CCV P;  1EDJ A;  2Q3E A;  1YJN P;  3V4Q A;  5AW9 B;  1JCD A;  5AVS B;  1KQG B;  3I5C A;  2GA1 A;  4ZKP A;  1SQB G;  1EDL A;  1KFY D;  3CXH H;  3MGN A;  1X9V A;  3AE9 D;  1NVO A;  1N73 A;  1S5L X;  2QSI A;  1MUU A;  3B8E B;  2WU5 C;  1KIL C;  1BSN A;  3M9Q A;  2ZVN B;  4YSZ D;  3VOP A;  1NTZ G;  2B87 A;  3IFM A;  1EZV G;  2JJL A;  2WSF J;  5L8R J;  4PV1 D;  2WVR A;  2H88 C;  1SFC B;  3A3Y B;  3LIE A;  1LT9 B;  2YO3 A;  3R4Y A;  4OGQ C;  5KJ7 A;  2M3B A;  1OW7 A;  2FYU K;  4GIF A;  3CD6 P;  3FWL A;  1BDD A;  5DJT B;  4YXW H;  1JB0 J;  1PPJ E;  3H1I E;  1USD A;  1G1J A;  1FU1 A;  4N78 E;  2YO2 A;  1QVG O;  1KB9 E;  2QA4 P;  1QGK B;  1JY2 O;  1JOC A;  2O1J A;  3L71 E;  2PP6 A;  2IZ0 A;  1RQV A;  3TGU G;  4I6L A;  3G71 P;  5CJ4 A;  1X0T A;  4OVN F;  1JEK A;  2WWW A;  4OGQ B;  1NH4 A;  2A45 H;  2M5A A;  2WMM A;  2KLU A;  1LTS C;  2JO1 A;  1CSB A;  1PPJ D;  2N1T C;  2WQY D;  1SQX E;  1KQL A;  1LGH B;  2W27 A;  1NYH A;  3AEA C;  2ITA A;  2L91 A;  4YPC A;  3AE3 C;  2M8R A;  3AEC C;  4EOT A;  1VQ5 P;  5KLI B;  3KXD A;  1XTC C;  2KK7 A;  2KS1 B;  4DJG A;  2J59 M;  2VRS A;  1NEN D;  1NEK D;  1E5W A;  2L5G B;  4H0L D;  1RE3 C;  1ZME C;  1DX7 A;  2K9J B;  3I56 P;  1SQB D;  1T6A A;  1IK9 A;  1EXI A;  1LJ2 A;  1NTK D;  2Y9Y A;  2XKM A;  3L73 D;  3FX0 A;  2RH0 A;  3L70 E;  1AA0 A;  2E5Y A;  4HJG H;  2R5B A;  3CC2 P;  4LLH A;  3M0A A;  3CWB G;  3AEG D;  1X8Y A;  1ZRT E;  1SQX G;  1RF0 A;  3F5H A;  3KDP B;  3P4R C;  1LTJ A;  5E79 H;  2BCC G;  3N7N A;  2RN0 A;  1X22 A;  2CK3 H;  3T97 A;  1L0N D;  1AQT A;  2OYI A;  3L72 G;  3MZW B;  1SFC C;  3AE7 D;  1SS1 A;  1AV1 A;  2FYU J;  5TJH A;  2W6B A;  4EYY Q;  3AE6 D;  4IFD K;  1ZOY D;  1BCC G;  1L0N J;  1PP9 D;  1FOS F;  1RH5 B;  5KAF E;  2WTY A;  2H43 A;  1KIL B;  4KX6 C;  3LID A;  2M0B A;  3TDK A;  4OWF A;  1M1J A;  1BGY J;  3A2A A;  3C9I A;  2YNY A;  3EQ2 A;  3TGU E;  1NTZ J;  4PV1 C;  2RKL A;  3KZI H;  2B87 B;  1CW5 A;  3ITK A;  4IL6 H;  4B86 A;  2WSF H;  1UIX A;  1PPJ G;  5GTI E;  2N9B A;  1DIP A;  1BCC J;  2I1K A;  1T3U A;  2Q9I A;  1FDM A;  3H1J J; 
#chains in the Genus database with same CATH homology
 1PIX A;  2FXP A;  1ZOY C;  4H0L B;  4YXD D;  2QJK C;  1RQU A;  2QJY C;  3VR8 D;  4YXD C;  1YQ3 C;  1Y9B A;  1YQ3 D;  2MKV A;  3FGA D;  2D2C D;  4YSZ D;  2D2C C;  4YSZ C;  3VR9 D;  3VRB D;  2WDQ C;  5KLI C;  1Q90 D;  2WU5 D;  4YT0 C;  2ZT9 D;  1KTM A;  3AE3 D;  3AEG D;  3Q5R A;  2WSF J;  1WMK A;  3D6Y A;  2P10 A;  3IN6 A;  1ZRT E;  5L8R J;  5C3J D;  2J5U A;  3AE4 D;  1ZP0 C;  3AE4 C;  3P4R D;  4R4M A;  4PV1 D;  3GLM A;  2H88 C;  3P4R C;  4H13 B;  2YIU C;  2OQQ A;  3C8V A;  4R4L A;  1KF6 D;  1DD4 A;  2FYN C;  1NEN C;  1VF5 B;  1YQ4 C;  4GDO A;  3R4Y A;  2ACZ C;  4YTM C;  4YTN D;  1YQ4 D;  4OGQ C;  3AEB C;  3VR8 C;  2K9Y A;  4OGQ D;  2E74 C;  1OW7 A;  3Q5S A;  2WS3 D;  2WDQ D;  2BEQ D;  2BS2 C;  3P4P C;  1AJY A;  2WSC J;  1FDI A;  3T97 B;  3P4S D;  2V7Q J;  3VRA C;  1K04 A;  3AE1 C;  1JB0 J;  3O6Q A;  1ZP0 D;  5C2T C;  3AE5 D;  3AE7 D;  1DD3 A;  2E76 C;  2WDR D;  3D71 A;  1E7P C;  4YSX D;  2WDR C;  4YSX C;  1VF5 D;  3AE6 C;  4KX6 D;  3SFD D;  2QJP C;  3CIR D;  3AE6 D;  4H13 D;  3D70 A;  2O01 J;  2E76 B;  1ZOY D;  2YMK A;  3D6Z A;  2IDB A;  2WS3 C;  1IK7 A;  4YTP C;  1K05 A;  3AEB D;  1RQV A;  4YTP D;  3GMA A;  3H25 A;  1L0V C;  3VRB C;  3VR9 C;  1S1C X;  4Z1M H;  1L0V D;  2BS3 C;  3AE7 C;  1PV3 A;  2E74 B;  4U7J A;  1R8E A;  4OGQ B;  3AE1 D;  4IL6 X;  4XFJ A;  5C3J C;  4H44 B;  1VF5 C;  2G8Y A;  3SFD C;  2WDV C;  3AE8 C;  3Q1M A;  4H13 C;  3GF3 A;  3AE8 D;  2E75 D;  4RKU J;  2JO1 A;  2WPV B;  3G9R A;  2E75 C;  1EXJ A;  2WQY D;  4KX6 C;  2H89 C;  2H89 D;  2NZ2 A;  2BEZ F;  2FBW C;  3AEF D;  4YTN C;  4YTM D;  1OMI A;  2FBW D;  3AED C;  1KQF B;  4KT0 J;  3AED D;  1NYH A;  3ABV C;  5M1B A;  3AEA C;  3SFE D;  3EWK A;  3AEE C;  4Y28 J;  3Q5P A;  4YSY D;  3Q2Y A;  2ZT9 C;  3AE3 C;  1KQG B;  3AEG C;  1NGM B;  3B71 A;  5C2T D;  1OW6 A;  3RL0 g;  1KF6 C;  2E76 D;  1KFY D;  1GMJ A;  1KMI Z;  3AEC C;  4H44 D;  2WU2 D;  1TU3 F;  2WU2 C;  4PV1 C;  5KKZ C;  3AE2 D;  2D2C B;  3AEC D;  3P4Q C;  3AE2 C;  3P4Q D;  2WSE J;  3CIR C;  2QIW A;  3AEF C;  3Q3D A;  1NEN D;  2ZT9 B;  1HF9 A;  1KOR A;  1OW8 A;  3GF7 A;  1NEK C;  2ACZ D;  3AE9 D;  1NEK D;  2JP3 A;  4PV1 B;  1FDO A;  3IAO A;  4H0L C;  3SFE C;  1S5L X;  2E74 D;  4H0L D;  3AEA D;  2QSI A;  3AEE D;  3LW5 J;  2BS4 C;  3P4P D;  2B76 C;  3ABV D;  1U57 A;  3P4S C;  4I7Z B;  1UIX A;  2B76 D;  3VRA D;  1ZME C;  4YSY C;  1DIP A;  2E75 B;  1KIL E;  2WU5 C;  3RK3 E;  1KFY C;  4YT0 D;  3AE5 C;  2G3A A;  2WDV D;  1PL5 A;  4I7Z C;  4H44 C;  2H88 D;  3S9O A;  1VL2 A;  1EXI A;  1QLB C;  2WP9 C;  2WP9 D;  3AE9 C;  4TT3 H;  1HJ0 A;  2WQY C;  1MKM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...