3AEEC

Crystal structure of porcine heart mitochondrial complex ii bound with atpenin a5
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with Atpenin A5
rcsb
total genus 46
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3aeeC01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3aeeC02
3AEFC 3AEAD 3AEDD 2WDRD 3VR8D 4YXDD 3AE5C 3P4SC 3SFED 4YTPD 1ZOYC 1YQ3C 3AE7C 3AE3C 3P4QD 2WDVC 3AE2C 2BS3C 3VRBD 1PV3A 2WDQC 4YSXD 4YSYD 1L0VD 2H88C 3AE9D 5C3JD 1KF6D 3AE8D 3P4PC 1OW6A 3ABVD 2WQYC 1NEND 4KX6D 3AE1D 1ZP0C 2WU2D 3AEED 3AEDC 3VR8C 2WU5D 3CIRD 2B76C 2WP9D 1K05A 3VRAC 1KFYC 4YSZD 1NEKC 3P4QC 2FBWD 4YTMC 4YT0D 4YTND 3VR9D 5C2TD 1YQ4D 1OW8A 1OW7A 2H89C 2ACZD 3AECC 2BS2C 3AE6D 1KTMA 3AEFD 2BS4C 3S9OA 3AEBD 3AE4C 3AEGD 3B71A 3P4SD 2WU2C 3AEAC 3P4RD 2G3AA 1ZOYD 1YQ3D 2WDRC 4YXDC 3AE3D 3AE7D 3CIRC 3AE2D 3SFEC 2WS3D 4YTPC 3SFDD 1K04A 3VRBC 2WDQD 1YQ4C 4YSXC 4YSYC 2ACZC 1L0VC 2WQYD 3AE9C 5C3JC 1ZP0D 1QLBC 1KF6C 3AE8C 3AEBC 3ABVC 1NENC 3AEGC 4KX6C 3AE1C 2B76D 3AE5D 3P4RC 3AEEC 3VRAD 1KFYD 1NEKD 2WU5C 2WDVD 2WP9C 4YTMD 2WS3C 4YSZC 2FBWC 3SFDC 4YT0C 4YTNC 3VR9C 5C2TC 2H89D 3AECD 2H88D 3P4PD 3AE4D 3AE6C 1E7PC
chains in the Genus database with same CATH superfamily
2OYHA 1LWUB 1QGKB 3SFED 1VPCA 1SQXE 3TGUD 5AW5B 3BVHA 2ITAA 3W67A 1IFDA 2FKWB 5C3JD 1AFOA 1DEEG 1OW6A 1NEND 4DCKA 3H1KD 5KAIE 1PP9E 2LXBA 2ZT9B 1LNQA 3U1AA 3VTPC 2E76B 1Q81Q 1YJ9P 2IYOA 1Q7YQ 3S4RA 1N7LA 2ZAEB 3EFGA 1LWUA 3CI9A 2XV5A 2XZRA 4UB8E 1VQ4P 2KLVA 2M3EA 2RN0A 3G71P 1EDLA 2OYHC 3P32A 4HYTB 2WWWA 1BGYG 1RH5B 3L70E 1PPJD 2YMKA 1SP4A 1FJKA 3CIRC 4HKZH 1NU1G 4W7ZA 3CCSP 1VQ8P 2L91A 4H0LB 1JMMA 1BE3D 5BU5A 3E1RA 1N73B 1SQVG 3Q5SA 1M1JB 1OXZA 2WSFJ 1VQPP 3H1IG 3AE5D 3V2PA 1NOHA 1HH0A 1BDCA 2A45I 1PGOA 1MUUA 1JCCA 4NPFX 1P84H 1KB9E 4H44D 3F89A 2WPSA 1IK7A 3ITKA 1N8RQ 3OW2O 4OGQD 1N73A 1M1JA 2IDBA 2ZT9C 3JCUH 1X0TA 2QM8A 2E76C 2BEQD 3RK3B 1KD1Q 2K9JB 2Q5UA 1GL2B 3H6PA 4U7JA 1KFYC 2KK7A 3CWBE 4LDTA 1OZHA 1XTCC 3V2RA 3WMM0 3GW6A 3RK2C 3CLQA 3MUDC 1SQPG 1BCCG 3HD7C 1SQXK 1BE3J 3IN6A 1URQB 3AEAC 3VMXA 1RHZB 1VQOP 4YTPC 2K9JA 2C9LY 1M1JC 3SFDD 1HGZA 3VRBC 1IFIA 3CX5D 1FDIA 1GL2A 4EI2A 4KT0J 4D6TE 2E75C 2ACZC 4DJGA 2P7JA 1NWQA 2Q3EA 1NU1E 3CC4P 2ZYGA 3SWKA 3A0HE 3U1CA 5AVZB 5APSA 3L36A 2FYNC 1KFMA 4PD4E 5AVXB 3GF7A 2WP9C 4EYYQ 3L75E 1FZAA 1S5LX 3U59A 1SQVE 1N86A 2GUVA 3VP9A 1ZN5A 1AJYA 1J1DC 2E43A 2B87B 2R5BA 2R3SA 3TGUG 3E7KA 1A02F 5CHXA 2OTLP 5CBNA 5AVTB 4N6JA 3CX5I 2W83C 2WSEJ 1SQXD 3PP5A 2AEJA 1T2KD 3KYQA 4R4LA 1FZCB 3H1KG 4U3FE 2YXRB 2K88A 3L73E 3MHVA 2QA4P 4ASVA 1PP9D 1YQ4D 2B87A 3D6ZA 2LR2A 1NVOA 1GU4A 3AE4C 4WY4C 2D2CC 2KB7P 3D71A 2O3JA 1JNMA 1PPJG 2FYUE 1Q90D 5L8RJ 5APWA 1FZCA 3L70D 2J58A 1BE3G 3CCLP 3L4FA 3WUUA 4XA4A 4N3YB 2R5DA 2J5UA 3AE1C 1ZLLA 1OMIA 2P2UA 1KFYD 1Q2NA 1IFPA 3CC7P 2M3BA 2KSJA 3L71G 2W8ZA 3D6YA 3F5HA 3RK2D 5AVQB 3HD7D 2QIWA 4DDIA 1YYCA 3AEAD 3NTNA 1GK4A 1KB9D 4YTPD 1T6AA 2WMMA 3P8MC 5AW1B 3VRBD 2JDIH 3VMAA 1NU1K 2E5YA 3C9IA 4WB4A 2AXTE 2E75D 1GW4A 3RL0C 1BDDA 2N9BA 1KQFB 5BVZA 1YIJP 3AEDC 1SQVK 1KC8Q 2WP9D 1L0NJ 1KQLA 1ZR4A 3O6QB 4DZOA 2RKLA 1JEKA 1FAVA 3HE4B 3RBXA 3CWBD 3TSIA 1KTMA 2BS4C 2ZJSE 1G1IA 1AQ5A 1ZXGA 1NAYA 2G3AA 3HE5B 2NPSC 1PL5A 1KB9I 5B66E 4I1LA 3FX0A 2A06E 1SQBE 1YI2P 3O6QA 1GMJA 1KF6C 1QLBC 2XNDH 3C1LA 2KUBA 1OIPA 4D6TD 3HE4A 1NTZG 5KLVE 3IAOA 1NU1D 2H8PD 2W90A 4YSZC 5KJ7A 4IL6H 5AW2B 1OFCX 4I6MC 5AW8B 2FYUK 4PD4D 1QL1A 1VL2A 3BCCE 1CI6B 4WY4D 4PJ0E 2K9YA 3L75D 2D2CD 3AE4D 3AEFC 4I7ZB 1SQVD 3VR8D 3L71E 1S2EA 2HG5D 1U57A 1ZR2A 4DHJA 3M91A 3H1LE 2Y9ZA 1SQXG 2RH0A 1AVOA 2CPBA 2WSFH 2NRGA 4MN4C 2QJPB 3AE1D 1ZP0C 1M8OB 1LTJB 5TISE 1L4AB 1CI6A 3BRTB 5KJ7C 1VDFA 3T97B 1S9KE 3MGNA 1PP9G 2AEFA 4U3FD 1X8YA 2BASA 1K8AQ 3L73D 3NMDA 5GTHH 3P8CE 3M0DC 3AEGD 2W27A 1WRGA 2OTKE 1FBMA 1GDTA 1KZUB 1BGYJ 2A45H 1IJDB 3M9QA 1LTJA 3L70G 3PLNA 4BRYB 1VF5D 2FYUD 1NU1J 3RL0D 1L4AA 1FZFA 1NH4A 1NTME 3D70A 3T97A 4L73A 2JWDA 3M0AA 4DOJA 2FFDB 3BATA 5GTIH 1SQVJ 4I7ZC 1ZMEC 2C0WA 3H1IJ 2QSIA 2KXPB 4YTNC 1MV8A 2H88D 1XTGB 5BU8B 3CCUP 2P1JA 1VQ6P 1NTZE 2ZYDA 3C8VA 3B5NB 4PV1B 2NPSD 3MD0A 1SQQE 3P4SC 5KLIB 1SQBK 4K3AA 4TT3H 3HUSB 1LTJC 2QEXP 2JO1A 2W6AA 2FFDA 5AW6B 1L4AC 1JY3P 1KF6D 1OVVA 5KLVK 2RMZA 1YJWP 4GIFA 1P84E 3CXHI 2N9YB 4YSZD 5KKZB 4JF7A 3B5NA 3MZWB 3VP8A 4IOIH 3CWBG 3V2QA 3L37A 3HUSA 2FXMA 3AEFD 3S9OA 3KQGA 3JCUE 2YNYA 3VN0A 3TNUA 1SQPJ 1BCCJ 1YITP 1H88A 2W6BA 2Y0CA 3S1KA 1U7MA 2WS3D 2FFDC 2WSEH 3H1JE 2C9NY 3ZDMA 1ZV8A 3II6A 1RF1C 2A06D 2KI7B 1ZP0D 3AEBC 2Z4EA 4D6TG 1SQBD 4WWIA 3HRNA 1NJIQ 2WSCJ 2YO2A 3SWFA 1UIXA 4PV1C 5KLIC 3CX5H 3R4YA 4R4MA 1HJBA 1S3JA 3HUSC 5KLVD 1G1JA 2IFMA 1DX7A 3L75G 4NPDA 1M90Q 4H13B 2CPSA 3BCCD 1IC2A 3P4QD 4GT1A 1NTMK 5C39A 3HTKB 1GW3A 2SPZA 1LWUC 3L71D 4WVZA 2GM4A 3TGUJ 3FGAD 2L5GB 1EXJA 1NKZB 4ZKUA 3H1LD 1GZLA 1J2JB 4B86A 4GOFA 2KZJA 1KFNA 3FWNA 4LGDE 3H1KJ 4YTND 1NTZK 4U3FG 2O01N 1SQQK 2Y9YA 3HTKA 1S9KD 3L73G 4JBZA 4M3LA 1FZEA 3P4SD 1T8ZA 2E74B 5AVYB 1ZW0A 3L35A 4YXDC 3H1HG 1JM0A 4OVNF 2PGDA 1ZRTE 3R2PA 5CCGA 3P8CD 2ZVOB 1W2BO 2AXCA 2FYUG 1L4AD 2GUSA 2OYIB 5H2FH 2YIUB 3RK3E 1L0VC 1S72P 1BSHA 2IPPA 4H0LC 4XFJA 1Q82Q 1YBKA 1NTMD 2WU5C 1AV1A 2KIKA 5E79E 1N73C 4Y99B 4WBAA 1DIPA 3L71J 4JPZB 1J1EB 1LTIC 1IFMA 4QMAA 1JB0J 3FXDA 2JEEA 3SWYA 1PGQA 5CCGC 1NTZD 3W68A 1PV3A 1URQA 3NFQA 4BWNA 4XE5B 1SQQD 3IFMA 2PFXA 3BRVB 1R5SA 5AVWB 3CIRD 3RK3C 4ZNCA 3GMAA 1KB9H 4PV1D 2JKVA 2YMYA 1P84D 1L0LE 1GL2C 1OW8A 1K73Q 4DHIB 3RL0g 3PRJA 4Y28J 2YIUC 1NHLA 2H7HA 2JR8A 3WU2H 4RESB 1URQC 2QM7A 2QG4A 3E1IA 2YKPA 1KQSO 4Y99C 4UB6H 2O01J 1S1CX 3H1HE 3QH9A 1N7SB 2A06G 2G8YA 4GOEA 3A7OA 3H1JD 5CJ4A 3ABVC 5APVA 1SQBG 3P4RC 2I8DA 1SFCB 2IZ1A 2FBWC 3WUTA 5APYA 2WPVB 1RF0A 2ZT9D 1WMKA 1LP1B 3VMZA 1YHQP 2E76D 1NTZJ 1HTLC 1JUNA 2DW3A 3GG2A 5KLVG 5CCHA 4YXDD 2IZ0A 5EFWB 1KYOE 3BCCG 1NTKE 1N7SA 4AUWA 1MFZA 1NYHA 3CMEP 2WDQC 1IZNB 1SFCA 1L0VD 4IL6E 4H0LD 4L75A 3P4PC 3H1LG 1LP1A 1SQXJ 2Y0EA 2HYNA 2WU5D 1H8AA 5AW4B 3O8ZA 4AYCA 1FZCC 2I1KA 2R3CA 1T3UA 1AA0A 2ACZD 2BS2C 1X9VA 3Q5RA 1FS0E 1PP9J 5CCHC 1HF9A 2P10A 2WU2C 1JOCA 1S4XA 1JTHB 4OWFA 2FXPA 3PH0A 1M7LA 1SFCC 1VQMP 2I1JA 1JO5A 1ZRTD 3K5BA 3L70J 1HGVA 4IFFA 1FZBA 1FDMA 4KX6C 1L0LK 3RK3D 1NTMG 4OH8B 5GTHE 4DT0A 2QRXA 1LT9B 1GL2D 1JTHA 2OYOA 3VONA 2KYVA 2XKMA 2JWAA 3CCMP 3KPEA 2J59M 3CXHH 3TYYA 3V5BA 3EQ2A 2WDVC 3L72G 1URQD 1PFIA 1S5LH 4LLHA 3LW5J 4I2LC 1SQQG 5GTIE 3MP7B 3HE5A 1PIXA 1Q86Q 1RE4A 3ABVD 5DJTB 2WSCH 2AEMA 3BASA 5AW9B 2B76C 3TDKA 3VRAC 2V7QJ 1VQ5P 2FYZA 3Q3DA 2FBWD 1RE3A 2ZYAA 4H44B 1W5CE 2Y0DA 1E5WA 3I5CA 3CC2P 4HH2A 2ZFCA 2QJYB 5CBOA 2QE7H 2BCCG 1NTKK 2OTJP 4OGQB 3KXDA 3RGUA 1L0LD 3CWBJ 1FDOA 1QVFO 1N2DC 1H89A 4HB1A 2O1KA 2XU6A 1EDKA 3PJSK 2IX7C 2WDQD 1HUCA 1Y47A 1IFJA 4L76A 4YXWH 4PD4I 1IK9A 2QJKB 3AE8C 3H1JG 3IR9A 1YTZI 3Q5PA 3H1HD 4IFMA 1RE3C 4D6TJ 1CSBA 2N1TB 4K35A 3L74E 3AE6C 3CMAP 4JYCA 3AEDD 2HR3A 3AE5C 3A2AA 3L75J 1KILB 1KN7A 3AE2C 2WT7B 1K9MQ 1KYOD 4ASWA 1NTKD 1EZVE 2PAJA 4EOTA 4H44C 5M1BA 3L72E 4KX6D 2N1TA 4BRYA 1KILE 3NXSA 1K05A 3EFFK 1LTBC 2QJPC 4NPEA 1PGPA 2MJZA 3B4SA 1KILA 1OW7A 3AECC 1QEXA 2WT7A 1EXIA 2WITA 4U3FJ 3GHGB 3B71A 4BXLA 1KORA 3L73J 4GODA 2Q6QA 5AW3B 2QJKC 2IBZE 4W7YA 1OWAA 1QLED 2BCCE 5KAFH 2KNCB 2POHA 3H1HJ 1L2PA 3CCJP 1KYOI 2FYUJ 2M5AB 2N1TC 2KS1B 2B76D 4C7NB 3VRAD 1USEA 3M06A 1JY2N 2V4HA 5APQA 3SFDC 3GHGA 1TU3F 1PZQA 1KILC 1GK6A 3TF5A 2KP8A 2C0XA 1AVYA 3CCRP 2E42A 1CW5A 1FC2C 3Q2YA 2FY8A 2KNCA 1X79B 1NTKJ 3JC22 2Z5IA 5H2FE 4KJMA 5K5GB 5KJ7D 2R44A 1E79H 2M5AA 4KHXA 2HLOA 3B5NC 2KS1A 3TK1A 1L0NE 4C7NA 3OA7A 2P67A 2BEZF 2WSSH 2O01H 5CMZA 1DEBA 4RO0A 3AE8D 2Q3IA 5B5EH 3RK2B 4YPCA 4YTMC 3GHGC 3HD7B 5DJUB 3FXEA 2Q9IA 1QL2A 5APTA 3A5TA 3PTZA 5KKZC 3AE6D 5CJ0A 3KZIH 1L0LG 3V6IA 1T2KC 2YXQB 3AE2D 4DDGA 2E75B 1NGMB 3A0BH 2ZVNB 1YQ4C 4YSXC 3MUDA 4HJGH 4YSYC 4GKGA 2FYNB 1HVVA 3HD7A 2R32A 2UWJE 2JP3A 5APUA 1HJ0A 4C7RA 3CCEP 1FOSF 1EDJA 1SQBJ 1FZGA 4GDOA 1J1DB 3VR9C 3P7KA 3AECD 4O9BA 1M57D 3WU2E 5KAIH 2MKVA 1E7PC 2K3RA 1MFTA 3CD6P 5KLVJ 1G2CB 2OQQA 1Y8AA 4UB6E 3SSUA 3L74D 1ZOYC 2WPRA 2PRRA 4ZKPA 4UB8H 1EQ7A 4H13C 3BCCJ 1W2EA 1NTKG 2W6JH 1X22A 3CPWO 3OJAB 1GTWA 2N1TD 5TJHA 2OYIA 1EZVD 2XDJA 3H1LJ 1RY3A 4EIJA 3L72D 3UIAA 4WY4B 1KILD 2D2CB 1G2CA 1BGYE 3LIEA 5AVUB 4CPGA 2B88A 1USDA 2Q1KA 2OARA 1RQVA 1OX3A 3AEBD 3PHLA 1UIIA 1L0NK 2WDRC 3VYIA 3B5ND 1JY3N 1GD2E 3LW5H 4IL6X 2CK3H 1Z56A 3KHUA 2E74C 1SLQA 3H1IE 1PGJA 2O1JA 2IBZD 2BCCD 1WT6A 4WY4A 3GF3A 2M8RA 2OYIC 2V7QH 1VQLP 1EZVI 4YTMD 3JSVC 5AVRB 1EC5A 1OVRA 3L74J 1NTMJ 2E5TA 1LT1A 3MIWA 2ZXXA 3CL3D 1VQNP 3A3YB 2WTYA 4JQ0D 2A45G 1FU1A 1VF5B 3KDPB 1J1EC 1LTAC 3AE7C 3AE3C 3RL0B 3H25A 1DD4A 1TFFA 1R5LA 1IFNA 3CCVP 4YSXD 4YSYD 1P84I 3L72J 1AQTA 1Y9BA 5E79H 2IBZI 3V2NA 1SQQJ 1L0ND 2OGUA 5AVSB 3VR8C 3G6EP 1BSNA 4JYBA 2WPQA 1SQPE 1NEKC 1OVUA 1BCCE 1SS1A 4N78E 3VR9D 2H43A 4A7PA 2JJLA 3CXHE 1NAFA 2HODB 3A0HH 1HWTC 2H89C 2NZ2A 1EDIA 2LXCB 2NPSB 1S5LE 2IFNA 3V4QA 4PD4H 1YJNP 2HPCB 4AQRD 3IF4A 1YTZT 4EDFA 1JY2O 2BCCJ 1ZOYD 1LTGC 4H13D 1K04A 1RF0C 2K1AA 3WUVA 2IYPA 2KZIA 3H32B 3AE9C 2PP6A 1LTSC 3AEGC 2HODA 3AEEC 1A02J 2NPSA 5CCGD 5AW7B 1N7SC 3H1JJ 2B89A 2HPCA 4TLFA 1H0TB 4YT0C 1VF5C 5C2TC 1M56D 1KQGB 2FXOA 3TGUE 2ZFYA 4DHZA 3G9RA 2WDRD 4L74A 3L74G 1YQ3C 3H32A 2BS3C 3LIDA 2E74D 1JY2P 2QVAA 3H1KE 2H88C 1LTTC 1R8EA 1H0TA 2WQYC 2KLUA 1EZVG 1D7MA 1RQUA 2WZ7A 2Q7CA 3N7NA 1DD3A 1SVFA 2YO3A 1PPJE 1KYOH 1LT9A 4LC1A 1U7JA 4RJTA 1BGYD 3CCQP 3I56P 3P4RD 1BE3E 3AE3D 3AE7D 2M0BA 1LJ2A 3SFEC 1DH3A 3MTUE 2YKOA 3USSA 3G4SP 2IBZG 1SQPK 5C3JC 3M0DA 1NENC 3G3ZA 3H1ID 3VOPA 1NEKD 2AXTH 4IFDK 4W80A 1KV4A 2WS3C 1FE6A 3EWKA 2LKMA 3M9HA 2H89D 3QWOC 1LT9C 3P4PD 5KAFE 1RE4C 4ZMDA 1NO4A 3OAKA 1CZQA 1IO4A 1T3JA 1GU5A 3VMYA 2ZXEB 2XNXA 3Q1MA 4I6LA 2WVRA 4Z1MH 1VQ9P 3AE9D 2YKQA 5CCHD 3FWLA 1L0NG 2B9BA 2P58A 5B66H 1VQ7P 2WU2D 3AEED 1FOSE 1N7SD 1JY3O 3P4QC 4YT0D 1NKNA 5C2TD 1SFCD 1SQPD 1BCCD 4N78D 5APXA 1M1KQ 3CXHD 1QVGO 1HBWA 3CX5E 1YQ3D 1JCDA 2VRSA 2QJYC 1MKMA 2K37A 1MZ9A 1L0LJ 4C46A 3B8EB 2KOGA 4OGQC 5B5EE 1RF1B 4PJ0H 5AVVB 2OYHB 1LGHB 3M9BA 2HFED 1QX8A 2GA1A 3RBZA 2Z5HA 2WQYD 3I55P 2KSEA 1VQKP 3N4XA 4RKUJ 1KMIZ 3GLMA 3KZIE 2WDVD 4FJVA 3TNUB 5KTBA 1FJPA 5TISH 1JMBA 5AW0B 3V4WA 1RF1A 3A0BE
chains in the Genus database with same CATH topology
3AEFC 4I7ZB 1AJYA 3C8VA 3AEAD 3AEDD 3G9RA 1JB0J 2WDRD 3VR8D 4H13B 4PV1B 4YXDD 2OQQA 3AE5C 3P4SC 3SFED 1U57A 1VF5B 4YTPD 1ZOYC 1YQ3C 4OGQD 3AE7C 3AE3C 4TT3H 3P4QD 2WDVC 3AE2C 3H25A 2BS3C 1DD4A 1NYHA 3VRBD 1PV3A 2E74D 3Q1MA 4H13C 2IDBA 2ZT9C 3LW5J 2JO1A 2WDQC 4YSXD 4YSYD 2E76C 2E75D 2BEZF 1L0VD 3FGAD 1PIXA 2WSEJ 4Z1MH 1EXJA 1Y9BA 2H88C 3AE9D 5C3JD 2BEQD 4H0LD 1KF6D 1R8EA 4H44C 3AE8D 1OW6A 3P4PC 5M1BA 3ABVD 2WQYC 3AE6C 1NEND 4KX6D 3AE1D 1ZP0C 1KQFB 2WU2D 4R4LA 3AEED 3AEDC 1KILE 3VR8C 2ZT9B 2WU5D 3CIRD 2B76C 2WP9D 1K05A 3VRAC 4U7JA 2E76B 1KFYC 4YSZD 2V7QJ 1NEKC 3GMAA 3Q3DA 2FBWD 3P4QC 1RQUA 4PV1D 3T97B 2QJPC 4YT0D 4YTMC 4YTND 1DD3A 3VR9D 4H44B 5C2TD 2D2CB 1YQ4D 3D6ZA 1OW8A 1OW7A 2H89C 2ACZD 3AECC 2BS2C 2NZ2A 3Q5RA 5KKZC 3AE6D 1EXIA 1KTMA 1RQVA 3IN6A 3AEFD 2BS4C 3S9OA 4OGQB 1HF9A 2P10A 3AEBD 3AE4C 2D2CC 3RL0g 3D71A 3AEGD 1FDOA 3B71A 4Y28J 2YIUC 2WU2C 3AEAC 3AE4D 3P4RD 2E74B 3P4SD 2G3AA 1ZOYD 1KORA 1YQ3D 2YMKA 4YXDC 2WDRC 3AE3D 3AE7D 2QJYC 1MKMA 3CIRC 1PL5A 3AE2D 3SFEC 1Q90D 2FXPA 2WS3D 4YTPC 5L8RJ 2E75B 1ZRTE 2QJKC 4OGQC 1NGMB 3SFDD 4IL6X 4H13D 1K04A 4H0LB 3VRBC 2WDQD 1VF5D 1FDIA 2E74C 1YQ4C 4KT0J 4YSXC 4YSYC 3RK3E 3D70A 4KX6C 2E75C 1L0VC 2ACZC 2O01J 3O6QA 1S1CX 2WQYD 2G8YA 3AE9C 5C3JC 1GMJA 4H0LC 1KF6C 1QLBC 1ZP0D 3AE8C 3Q5SA 3AEBC 3GF3A 3ABVC 2WSFJ 4RKUJ 2JP3A 4XFJA 3AEGC 1NENC 2J5UA 1HJ0A 1KMIZ 3AE1C 1OMIA 2B76D 3AE5D 3P4RC 3AEEC 3GLMA 3VRAD 1KFYD 2FYNC 1NEKD 3Q5PA 2WSCJ 2WU5C 3GF7A 2WDVD 2WP9C 4YTMD 3IAOA 4I7ZC 1ZMEC 2WS3C 4YSZC 1UIXA 2FBWC 3SFDC 2QSIA 1S5LX 4PV1C 2WPVB 3D6YA 1TU3F 2ZT9D 1WMKA 3EWKA 4YT0C 4YTNC 4GDOA 3VR9C 1VF5C 5KLIC 5C2TC 2E76D 2H89D 3AECD 3R4YA 4R4MA 2H88D 1DIPA 1KQGB 1VL2A 3Q2YA 4H44D 3P4PD 2MKVA 2K9YA 2D2CD 2QIWA 1IK7A 1E7PC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AEF C;  3AEA D;  3AED D;  2WDR D;  3VR8 D;  4YXD D;  3AE5 C;  3P4S C;  3SFE D;  4YTP D;  1ZOY C;  1YQ3 C;  3AE7 C;  3AE3 C;  3P4Q D;  2WDV C;  3AE2 C;  2BS3 C;  3VRB D;  1PV3 A;  2WDQ C;  4YSX D;  4YSY D;  1L0V D;  2H88 C;  3AE9 D;  5C3J D;  1KF6 D;  3AE8 D;  3P4P C;  1OW6 A;  3ABV D;  2WQY C;  1NEN D;  4KX6 D;  3AE1 D;  1ZP0 C;  2WU2 D;  3AEE D;  3AED C;  3VR8 C;  2WU5 D;  3CIR D;  2B76 C;  2WP9 D;  1K05 A;  3VRA C;  1KFY C;  4YSZ D;  1NEK C;  3P4Q C;  2FBW D;  4YTM C;  4YT0 D;  4YTN D;  3VR9 D;  5C2T D;  1YQ4 D;  1OW8 A;  1OW7 A;  2H89 C;  2ACZ D;  3AEC C;  2BS2 C;  3AE6 D;  1KTM A;  3AEF D;  2BS4 C;  3S9O A;  3AEB D;  3AE4 C;  3AEG D;  3B71 A;  3P4S D;  2WU2 C;  3AEA C;  3P4R D;  2G3A A;  1ZOY D;  1YQ3 D;  2WDR C;  4YXD C;  3AE3 D;  3AE7 D;  3CIR C;  3AE2 D;  3SFE C;  2WS3 D;  4YTP C;  3SFD D;  1K04 A;  3VRB C;  2WDQ D;  1YQ4 C;  4YSX C;  4YSY C;  2ACZ C;  1L0V C;  2WQY D;  3AE9 C;  5C3J C;  1ZP0 D;  1QLB C;  1KF6 C;  3AE8 C;  3AEB C;  3ABV C;  1NEN C;  3AEG C;  4KX6 C;  3AE1 C;  2B76 D;  3AE5 D;  3P4R C;  3AEE C;  3VRA D;  1KFY D;  1NEK D;  2WU5 C;  2WDV D;  2WP9 C;  4YTM D;  2WS3 C;  4YSZ C;  2FBW C;  3SFD C;  4YT0 C;  4YTN C;  3VR9 C;  5C2T C;  2H89 D;  3AEC D;  2H88 D;  3P4P D;  3AE4 D;  3AE6 C;  1E7P C; 
#chains in the Genus database with same CATH topology
 2OYH A;  1LWU B;  1QGK B;  3SFE D;  1VPC A;  1SQX E;  3TGU D;  5AW5 B;  3BVH A;  2ITA A;  3W67 A;  1IFD A;  2FKW B;  5C3J D;  1AFO A;  1DEE G;  1OW6 A;  1NEN D;  4DCK A;  3H1K D;  5KAI E;  1PP9 E;  2LXB A;  2ZT9 B;  1LNQ A;  3U1A A;  3VTP C;  2E76 B;  1Q81 Q;  1YJ9 P;  2IYO A;  1Q7Y Q;  3S4R A;  1N7L A;  2ZAE B;  3EFG A;  1LWU A;  3CI9 A;  2XV5 A;  2XZR A;  4UB8 E;  1VQ4 P;  2KLV A;  2M3E A;  2RN0 A;  3G71 P;  1EDL A;  2OYH C;  3P32 A;  4HYT B;  2WWW A;  1BGY G;  1RH5 B;  3L70 E;  1PPJ D;  2YMK A;  1SP4 A;  1FJK A;  3CIR C;  4HKZ H;  1NU1 G;  4W7Z A;  3CCS P;  1VQ8 P;  2L91 A;  4H0L B;  1JMM A;  1BE3 D;  5BU5 A;  3E1R A;  1N73 B;  1SQV G;  3Q5S A;  1M1J B;  1OXZ A;  2WSF J;  1VQP P;  3H1I G;  3AE5 D;  3V2P A;  1NOH A;  1HH0 A;  1BDC A;  2A45 I;  1PGO A;  1MUU A;  1JCC A;  4NPF X;  1P84 H;  1KB9 E;  4H44 D;  3F89 A;  2WPS A;  1IK7 A;  3ITK A;  1N8R Q;  3OW2 O;  4OGQ D;  1N73 A;  1M1J A;  2IDB A;  2ZT9 C;  3JCU H;  1X0T A;  2QM8 A;  2E76 C;  2BEQ D;  3RK3 B;  1KD1 Q;  2K9J B;  2Q5U A;  1GL2 B;  3H6P A;  4U7J A;  1KFY C;  2KK7 A;  3CWB E;  4LDT A;  1OZH A;  1XTC C;  3V2R A;  3WMM 0;  3GW6 A;  3RK2 C;  3CLQ A;  3MUD C;  1SQP G;  1BCC G;  3HD7 C;  1SQX K;  1BE3 J;  3IN6 A;  1URQ B;  3AEA C;  3VMX A;  1RHZ B;  1VQO P;  4YTP C;  2K9J A;  2C9L Y;  1M1J C;  3SFD D;  1HGZ A;  3VRB C;  1IFI A;  3CX5 D;  1FDI A;  1GL2 A;  4EI2 A;  4KT0 J;  4D6T E;  2E75 C;  2ACZ C;  4DJG A;  2P7J A;  1NWQ A;  2Q3E A;  1NU1 E;  3CC4 P;  2ZYG A;  3SWK A;  3A0H E;  3U1C A;  5AVZ B;  5APS A;  3L36 A;  2FYN C;  1KFM A;  4PD4 E;  5AVX B;  3GF7 A;  2WP9 C;  4EYY Q;  3L75 E;  1FZA A;  1S5L X;  3U59 A;  1SQV E;  1N86 A;  2GUV A;  3VP9 A;  1ZN5 A;  1AJY A;  1J1D C;  2E43 A;  2B87 B;  2R5B A;  2R3S A;  3TGU G;  3E7K A;  1A02 F;  5CHX A;  2OTL P;  5CBN A;  5AVT B;  4N6J A;  3CX5 I;  2W83 C;  2WSE J;  1SQX D;  3PP5 A;  2AEJ A;  1T2K D;  3KYQ A;  4R4L A;  1FZC B;  3H1K G;  4U3F E;  2YXR B;  2K88 A;  3L73 E;  3MHV A;  2QA4 P;  4ASV A;  1PP9 D;  1YQ4 D;  2B87 A;  3D6Z A;  2LR2 A;  1NVO A;  1GU4 A;  3AE4 C;  4WY4 C;  2D2C C;  2KB7 P;  3D71 A;  2O3J A;  1JNM A;  1PPJ G;  2FYU E;  1Q90 D;  5L8R J;  5APW A;  1FZC A;  3L70 D;  2J58 A;  1BE3 G;  3CCL P;  3L4F A;  3WUU A;  4XA4 A;  4N3Y B;  2R5D A;  2J5U A;  3AE1 C;  1ZLL A;  1OMI A;  2P2U A;  1KFY D;  1Q2N A;  1IFP A;  3CC7 P;  2M3B A;  2KSJ A;  3L71 G;  2W8Z A;  3D6Y A;  3F5H A;  3RK2 D;  5AVQ B;  3HD7 D;  2QIW A;  4DDI A;  1YYC A;  3AEA D;  3NTN A;  1GK4 A;  1KB9 D;  4YTP D;  1T6A A;  2WMM A;  3P8M C;  5AW1 B;  3VRB D;  2JDI H;  3VMA A;  1NU1 K;  2E5Y A;  3C9I A;  4WB4 A;  2AXT E;  2E75 D;  1GW4 A;  3RL0 C;  1BDD A;  2N9B A;  1KQF B;  5BVZ A;  1YIJ P;  3AED C;  1SQV K;  1KC8 Q;  2WP9 D;  1L0N J;  1KQL A;  1ZR4 A;  3O6Q B;  4DZO A;  2RKL A;  1JEK A;  1FAV A;  3HE4 B;  3RBX A;  3CWB D;  3TSI A;  1KTM A;  2BS4 C;  2ZJS E;  1G1I A;  1AQ5 A;  1ZXG A;  1NAY A;  2G3A A;  3HE5 B;  2NPS C;  1PL5 A;  1KB9 I;  5B66 E;  4I1L A;  3FX0 A;  2A06 E;  1SQB E;  1YI2 P;  3O6Q A;  1GMJ A;  1KF6 C;  1QLB C;  2XND H;  3C1L A;  2KUB A;  1OIP A;  4D6T D;  3HE4 A;  1NTZ G;  5KLV E;  3IAO A;  1NU1 D;  2H8P D;  2W90 A;  4YSZ C;  5KJ7 A;  4IL6 H;  5AW2 B;  1OFC X;  4I6M C;  5AW8 B;  2FYU K;  4PD4 D;  1QL1 A;  1VL2 A;  3BCC E;  1CI6 B;  4WY4 D;  4PJ0 E;  2K9Y A;  3L75 D;  2D2C D;  3AE4 D;  3AEF C;  4I7Z B;  1SQV D;  3VR8 D;  3L71 E;  1S2E A;  2HG5 D;  1U57 A;  1ZR2 A;  4DHJ A;  3M91 A;  3H1L E;  2Y9Z A;  1SQX G;  2RH0 A;  1AVO A;  2CPB A;  2WSF H;  2NRG A;  4MN4 C;  2QJP B;  3AE1 D;  1ZP0 C;  1M8O B;  1LTJ B;  5TIS E;  1L4A B;  1CI6 A;  3BRT B;  5KJ7 C;  1VDF A;  3T97 B;  1S9K E;  3MGN A;  1PP9 G;  2AEF A;  4U3F D;  1X8Y A;  2BAS A;  1K8A Q;  3L73 D;  3NMD A;  5GTH H;  3P8C E;  3M0D C;  3AEG D;  2W27 A;  1WRG A;  2OTK E;  1FBM A;  1GDT A;  1KZU B;  1BGY J;  2A45 H;  1IJD B;  3M9Q A;  1LTJ A;  3L70 G;  3PLN A;  4BRY B;  1VF5 D;  2FYU D;  1NU1 J;  3RL0 D;  1L4A A;  1FZF A;  1NH4 A;  1NTM E;  3D70 A;  3T97 A;  4L73 A;  2JWD A;  3M0A A;  4DOJ A;  2FFD B;  3BAT A;  5GTI H;  1SQV J;  4I7Z C;  1ZME C;  2C0W A;  3H1I J;  2QSI A;  2KXP B;  4YTN C;  1MV8 A;  2H88 D;  1XTG B;  5BU8 B;  3CCU P;  2P1J A;  1VQ6 P;  1NTZ E;  2ZYD A;  3C8V A;  3B5N B;  4PV1 B;  2NPS D;  3MD0 A;  1SQQ E;  3P4S C;  5KLI B;  1SQB K;  4K3A A;  4TT3 H;  3HUS B;  1LTJ C;  2QEX P;  2JO1 A;  2W6A A;  2FFD A;  5AW6 B;  1L4A C;  1JY3 P;  1KF6 D;  1OVV A;  5KLV K;  2RMZ A;  1YJW P;  4GIF A;  1P84 E;  3CXH I;  2N9Y B;  4YSZ D;  5KKZ B;  4JF7 A;  3B5N A;  3MZW B;  3VP8 A;  4IOI H;  3CWB G;  3V2Q A;  3L37 A;  3HUS A;  2FXM A;  3AEF D;  3S9O A;  3KQG A;  3JCU E;  2YNY A;  3VN0 A;  3TNU A;  1SQP J;  1BCC J;  1YIT P;  1H88 A;  2W6B A;  2Y0C A;  3S1K A;  1U7M A;  2WS3 D;  2FFD C;  2WSE H;  3H1J E;  2C9N Y;  3ZDM A;  1ZV8 A;  3II6 A;  1RF1 C;  2A06 D;  2KI7 B;  1ZP0 D;  3AEB C;  2Z4E A;  4D6T G;  1SQB D;  4WWI A;  3HRN A;  1NJI Q;  2WSC J;  2YO2 A;  3SWF A;  1UIX A;  4PV1 C;  5KLI C;  3CX5 H;  3R4Y A;  4R4M A;  1HJB A;  1S3J A;  3HUS C;  5KLV D;  1G1J A;  2IFM A;  1DX7 A;  3L75 G;  4NPD A;  1M90 Q;  4H13 B;  2CPS A;  3BCC D;  1IC2 A;  3P4Q D;  4GT1 A;  1NTM K;  5C39 A;  3HTK B;  1GW3 A;  2SPZ A;  1LWU C;  3L71 D;  4WVZ A;  2GM4 A;  3TGU J;  3FGA D;  2L5G B;  1EXJ A;  1NKZ B;  4ZKU A;  3H1L D;  1GZL A;  1J2J B;  4B86 A;  4GOF A;  2KZJ A;  1KFN A;  3FWN A;  4LGD E;  3H1K J;  4YTN D;  1NTZ K;  4U3F G;  2O01 N;  1SQQ K;  2Y9Y A;  3HTK A;  1S9K D;  3L73 G;  4JBZ A;  4M3L A;  1FZE A;  3P4S D;  1T8Z A;  2E74 B;  5AVY B;  1ZW0 A;  3L35 A;  4YXD C;  3H1H G;  1JM0 A;  4OVN F;  2PGD A;  1ZRT E;  3R2P A;  5CCG A;  3P8C D;  2ZVO B;  1W2B O;  2AXC A;  2FYU G;  1L4A D;  2GUS A;  2OYI B;  5H2F H;  2YIU B;  3RK3 E;  1L0V C;  1S72 P;  1BSH A;  2IPP A;  4H0L C;  4XFJ A;  1Q82 Q;  1YBK A;  1NTM D;  2WU5 C;  1AV1 A;  2KIK A;  5E79 E;  1N73 C;  4Y99 B;  4WBA A;  1DIP A;  3L71 J;  4JPZ B;  1J1E B;  1LTI C;  1IFM A;  4QMA A;  1JB0 J;  3FXD A;  2JEE A;  3SWY A;  1PGQ A;  5CCG C;  1NTZ D;  3W68 A;  1PV3 A;  1URQ A;  3NFQ A;  4BWN A;  4XE5 B;  1SQQ D;  3IFM A;  2PFX A;  3BRV B;  1R5S A;  5AVW B;  3CIR D;  3RK3 C;  4ZNC A;  3GMA A;  1KB9 H;  4PV1 D;  2JKV A;  2YMY A;  1P84 D;  1L0L E;  1GL2 C;  1OW8 A;  1K73 Q;  4DHI B;  3RL0 g;  3PRJ A;  4Y28 J;  2YIU C;  1NHL A;  2H7H A;  2JR8 A;  3WU2 H;  4RES B;  1URQ C;  2QM7 A;  2QG4 A;  3E1I A;  2YKP A;  1KQS O;  4Y99 C;  4UB6 H;  2O01 J;  1S1C X;  3H1H E;  3QH9 A;  1N7S B;  2A06 G;  2G8Y A;  4GOE A;  3A7O A;  3H1J D;  5CJ4 A;  3ABV C;  5APV A;  1SQB G;  3P4R C;  2I8D A;  1SFC B;  2IZ1 A;  2FBW C;  3WUT A;  5APY A;  2WPV B;  1RF0 A;  2ZT9 D;  1WMK A;  1LP1 B;  3VMZ A;  1YHQ P;  2E76 D;  1NTZ J;  1HTL C;  1JUN A;  2DW3 A;  3GG2 A;  5KLV G;  5CCH A;  4YXD D;  2IZ0 A;  5EFW B;  1KYO E;  3BCC G;  1NTK E;  1N7S A;  4AUW A;  1MFZ A;  1NYH A;  3CME P;  2WDQ C;  1IZN B;  1SFC A;  1L0V D;  4IL6 E;  4H0L D;  4L75 A;  3P4P C;  3H1L G;  1LP1 A;  1SQX J;  2Y0E A;  2HYN A;  2WU5 D;  1H8A A;  5AW4 B;  3O8Z A;  4AYC A;  1FZC C;  2I1K A;  2R3C A;  1T3U A;  1AA0 A;  2ACZ D;  2BS2 C;  1X9V A;  3Q5R A;  1FS0 E;  1PP9 J;  5CCH C;  1HF9 A;  2P10 A;  2WU2 C;  1JOC A;  1S4X A;  1JTH B;  4OWF A;  2FXP A;  3PH0 A;  1M7L A;  1SFC C;  1VQM P;  2I1J A;  1JO5 A;  1ZRT D;  3K5B A;  3L70 J;  1HGV A;  4IFF A;  1FZB A;  1FDM A;  4KX6 C;  1L0L K;  3RK3 D;  1NTM G;  4OH8 B;  5GTH E;  4DT0 A;  2QRX A;  1LT9 B;  1GL2 D;  1JTH A;  2OYO A;  3VON A;  2KYV A;  2XKM A;  2JWA A;  3CCM P;  3KPE A;  2J59 M;  3CXH H;  3TYY A;  3V5B A;  3EQ2 A;  2WDV C;  3L72 G;  1URQ D;  1PFI A;  1S5L H;  4LLH A;  3LW5 J;  4I2L C;  1SQQ G;  5GTI E;  3MP7 B;  3HE5 A;  1PIX A;  1Q86 Q;  1RE4 A;  3ABV D;  5DJT B;  2WSC H;  2AEM A;  3BAS A;  5AW9 B;  2B76 C;  3TDK A;  3VRA C;  2V7Q J;  1VQ5 P;  2FYZ A;  3Q3D A;  2FBW D;  1RE3 A;  2ZYA A;  4H44 B;  1W5C E;  2Y0D A;  1E5W A;  3I5C A;  3CC2 P;  4HH2 A;  2ZFC A;  2QJY B;  5CBO A;  2QE7 H;  2BCC G;  1NTK K;  2OTJ P;  4OGQ B;  3KXD A;  3RGU A;  1L0L D;  3CWB J;  1FDO A;  1QVF O;  1N2D C;  1H89 A;  4HB1 A;  2O1K A;  2XU6 A;  1EDK A;  3PJS K;  2IX7 C;  2WDQ D;  1HUC A;  1Y47 A;  1IFJ A;  4L76 A;  4YXW H;  4PD4 I;  1IK9 A;  2QJK B;  3AE8 C;  3H1J G;  3IR9 A;  1YTZ I;  3Q5P A;  3H1H D;  4IFM A;  1RE3 C;  4D6T J;  1CSB A;  2N1T B;  4K35 A;  3L74 E;  3AE6 C;  3CMA P;  4JYC A;  3AED D;  2HR3 A;  3AE5 C;  3A2A A;  3L75 J;  1KIL B;  1KN7 A;  3AE2 C;  2WT7 B;  1K9M Q;  1KYO D;  4ASW A;  1NTK D;  1EZV E;  2PAJ A;  4EOT A;  4H44 C;  5M1B A;  3L72 E;  4KX6 D;  2N1T A;  4BRY A;  1KIL E;  3NXS A;  1K05 A;  3EFF K;  1LTB C;  2QJP C;  4NPE A;  1PGP A;  2MJZ A;  3B4S A;  1KIL A;  1OW7 A;  3AEC C;  1QEX A;  2WT7 A;  1EXI A;  2WIT A;  4U3F J;  3GHG B;  3B71 A;  4BXL A;  1KOR A;  3L73 J;  4GOD A;  2Q6Q A;  5AW3 B;  2QJK C;  2IBZ E;  4W7Y A;  1OWA A;  1QLE D;  2BCC E;  5KAF H;  2KNC B;  2POH A;  3H1H J;  1L2P A;  3CCJ P;  1KYO I;  2FYU J;  2M5A B;  2N1T C;  2KS1 B;  2B76 D;  4C7N B;  3VRA D;  1USE A;  3M06 A;  1JY2 N;  2V4H A;  5APQ A;  3SFD C;  3GHG A;  1TU3 F;  1PZQ A;  1KIL C;  1GK6 A;  3TF5 A;  2KP8 A;  2C0X A;  1AVY A;  3CCR P;  2E42 A;  1CW5 A;  1FC2 C;  3Q2Y A;  2FY8 A;  2KNC A;  1X79 B;  1NTK J;  3JC2 2;  2Z5I A;  5H2F E;  4KJM A;  5K5G B;  5KJ7 D;  2R44 A;  1E79 H;  2M5A A;  4KHX A;  2HLO A;  3B5N C;  2KS1 A;  3TK1 A;  1L0N E;  4C7N A;  3OA7 A;  2P67 A;  2BEZ F;  2WSS H;  2O01 H;  5CMZ A;  1DEB A;  4RO0 A;  3AE8 D;  2Q3I A;  5B5E H;  3RK2 B;  4YPC A;  4YTM C;  3GHG C;  3HD7 B;  5DJU B;  3FXE A;  2Q9I A;  1QL2 A;  5APT A;  3A5T A;  3PTZ A;  5KKZ C;  3AE6 D;  5CJ0 A;  3KZI H;  1L0L G;  3V6I A;  1T2K C;  2YXQ B;  3AE2 D;  4DDG A;  2E75 B;  1NGM B;  3A0B H;  2ZVN B;  1YQ4 C;  4YSX C;  3MUD A;  4HJG H;  4YSY C;  4GKG A;  2FYN B;  1HVV A;  3HD7 A;  2R32 A;  2UWJ E;  2JP3 A;  5APU A;  1HJ0 A;  4C7R A;  3CCE P;  1FOS F;  1EDJ A;  1SQB J;  1FZG A;  4GDO A;  1J1D B;  3VR9 C;  3P7K A;  3AEC D;  4O9B A;  1M57 D;  3WU2 E;  5KAI H;  2MKV A;  1E7P C;  2K3R A;  1MFT A;  3CD6 P;  5KLV J;  1G2C B;  2OQQ A;  1Y8A A;  4UB6 E;  3SSU A;  3L74 D;  1ZOY C;  2WPR A;  2PRR A;  4ZKP A;  4UB8 H;  1EQ7 A;  4H13 C;  3BCC J;  1W2E A;  1NTK G;  2W6J H;  1X22 A;  3CPW O;  3OJA B;  1GTW A;  2N1T D;  5TJH A;  2OYI A;  1EZV D;  2XDJ A;  3H1L J;  1RY3 A;  4EIJ A;  3L72 D;  3UIA A;  4WY4 B;  1KIL D;  2D2C B;  1G2C A;  1BGY E;  3LIE A;  5AVU B;  4CPG A;  2B88 A;  1USD A;  2Q1K A;  2OAR A;  1RQV A;  1OX3 A;  3AEB D;  3PHL A;  1UII A;  1L0N K;  2WDR C;  3VYI A;  3B5N D;  1JY3 N;  1GD2 E;  3LW5 H;  4IL6 X;  2CK3 H;  1Z56 A;  3KHU A;  2E74 C;  1SLQ A;  3H1I E;  1PGJ A;  2O1J A;  2IBZ D;  2BCC D;  1WT6 A;  4WY4 A;  3GF3 A;  2M8R A;  2OYI C;  2V7Q H;  1VQL P;  1EZV I;  4YTM D;  3JSV C;  5AVR B;  1EC5 A;  1OVR A;  3L74 J;  1NTM J;  2E5T A;  1LT1 A;  3MIW A;  2ZXX A;  3CL3 D;  1VQN P;  3A3Y B;  2WTY A;  4JQ0 D;  2A45 G;  1FU1 A;  1VF5 B;  3KDP B;  1J1E C;  1LTA C;  3AE7 C;  3AE3 C;  3RL0 B;  3H25 A;  1DD4 A;  1TFF A;  1R5L A;  1IFN A;  3CCV P;  4YSX D;  4YSY D;  1P84 I;  3L72 J;  1AQT A;  1Y9B A;  5E79 H;  2IBZ I;  3V2N A;  1SQQ J;  1L0N D;  2OGU A;  5AVS B;  3VR8 C;  3G6E P;  1BSN A;  4JYB A;  2WPQ A;  1SQP E;  1NEK C;  1OVU A;  1BCC E;  1SS1 A;  4N78 E;  3VR9 D;  2H43 A;  4A7P A;  2JJL A;  3CXH E;  1NAF A;  2HOD B;  3A0H H;  1HWT C;  2H89 C;  2NZ2 A;  1EDI A;  2LXC B;  2NPS B;  1S5L E;  2IFN A;  3V4Q A;  4PD4 H;  1YJN P;  2HPC B;  4AQR D;  3IF4 A;  1YTZ T;  4EDF A;  1JY2 O;  2BCC J;  1ZOY D;  1LTG C;  4H13 D;  1K04 A;  1RF0 C;  2K1A A;  3WUV A;  2IYP A;  2KZI A;  3H32 B;  3AE9 C;  2PP6 A;  1LTS C;  3AEG C;  2HOD A;  3AEE C;  1A02 J;  2NPS A;  5CCG D;  5AW7 B;  1N7S C;  3H1J J;  2B89 A;  2HPC A;  4TLF A;  1H0T B;  4YT0 C;  1VF5 C;  5C2T C;  1M56 D;  1KQG B;  2FXO A;  3TGU E;  2ZFY A;  4DHZ A;  3G9R A;  2WDR D;  4L74 A;  3L74 G;  1YQ3 C;  3H32 A;  2BS3 C;  3LID A;  2E74 D;  1JY2 P;  2QVA A;  3H1K E;  2H88 C;  1LTT C;  1R8E A;  1H0T A;  2WQY C;  2KLU A;  1EZV G;  1D7M A;  1RQU A;  2WZ7 A;  2Q7C A;  3N7N A;  1DD3 A;  1SVF A;  2YO3 A;  1PPJ E;  1KYO H;  1LT9 A;  4LC1 A;  1U7J A;  4RJT A;  1BGY D;  3CCQ P;  3I56 P;  3P4R D;  1BE3 E;  3AE3 D;  3AE7 D;  2M0B A;  1LJ2 A;  3SFE C;  1DH3 A;  3MTU E;  2YKO A;  3USS A;  3G4S P;  2IBZ G;  1SQP K;  5C3J C;  3M0D A;  1NEN C;  3G3Z A;  3H1I D;  3VOP A;  1NEK D;  2AXT H;  4IFD K;  4W80 A;  1KV4 A;  2WS3 C;  1FE6 A;  3EWK A;  2LKM A;  3M9H A;  2H89 D;  3QWO C;  1LT9 C;  3P4P D;  5KAF E;  1RE4 C;  4ZMD A;  1NO4 A;  3OAK A;  1CZQ A;  1IO4 A;  1T3J A;  1GU5 A;  3VMY A;  2ZXE B;  2XNX A;  3Q1M A;  4I6L A;  2WVR A;  4Z1M H;  1VQ9 P;  3AE9 D;  2YKQ A;  5CCH D;  3FWL A;  1L0N G;  2B9B A;  2P58 A;  5B66 H;  1VQ7 P;  2WU2 D;  3AEE D;  1FOS E;  1N7S D;  1JY3 O;  3P4Q C;  4YT0 D;  1NKN A;  5C2T D;  1SFC D;  1SQP D;  1BCC D;  4N78 D;  5APX A;  1M1K Q;  3CXH D;  1QVG O;  1HBW A;  3CX5 E;  1YQ3 D;  1JCD A;  2VRS A;  2QJY C;  1MKM A;  2K37 A;  1MZ9 A;  1L0L J;  4C46 A;  3B8E B;  2KOG A;  4OGQ C;  5B5E E;  1RF1 B;  4PJ0 H;  5AVV B;  2OYH B;  1LGH B;  3M9B A;  2HFE D;  1QX8 A;  2GA1 A;  3RBZ A;  2Z5H A;  2WQY D;  3I55 P;  2KSE A;  1VQK P;  3N4X A;  4RKU J;  1KMI Z;  3GLM A;  3KZI E;  2WDV D;  4FJV A;  3TNU B;  5KTB A;  1FJP A;  5TIS H;  1JMB A;  5AW0 B;  3V4W A;  1RF1 A;  3A0B E; 
#chains in the Genus database with same CATH homology
 3AEF C;  4I7Z B;  1AJY A;  3C8V A;  3AEA D;  3AED D;  3G9R A;  1JB0 J;  2WDR D;  3VR8 D;  4H13 B;  4PV1 B;  4YXD D;  2OQQ A;  3AE5 C;  3P4S C;  3SFE D;  1U57 A;  1VF5 B;  4YTP D;  1ZOY C;  1YQ3 C;  4OGQ D;  3AE7 C;  3AE3 C;  4TT3 H;  3P4Q D;  2WDV C;  3AE2 C;  3H25 A;  2BS3 C;  1DD4 A;  1NYH A;  3VRB D;  1PV3 A;  2E74 D;  3Q1M A;  4H13 C;  2IDB A;  2ZT9 C;  3LW5 J;  2JO1 A;  2WDQ C;  4YSX D;  4YSY D;  2E76 C;  2E75 D;  2BEZ F;  1L0V D;  3FGA D;  1PIX A;  2WSE J;  4Z1M H;  1EXJ A;  1Y9B A;  2H88 C;  3AE9 D;  5C3J D;  2BEQ D;  4H0L D;  1KF6 D;  1R8E A;  4H44 C;  3AE8 D;  1OW6 A;  3P4P C;  5M1B A;  3ABV D;  2WQY C;  3AE6 C;  1NEN D;  4KX6 D;  3AE1 D;  1ZP0 C;  1KQF B;  2WU2 D;  4R4L A;  3AEE D;  3AED C;  1KIL E;  3VR8 C;  2ZT9 B;  2WU5 D;  3CIR D;  2B76 C;  2WP9 D;  1K05 A;  3VRA C;  4U7J A;  2E76 B;  1KFY C;  4YSZ D;  2V7Q J;  1NEK C;  3GMA A;  3Q3D A;  2FBW D;  3P4Q C;  1RQU A;  4PV1 D;  3T97 B;  2QJP C;  4YT0 D;  4YTM C;  4YTN D;  1DD3 A;  3VR9 D;  4H44 B;  5C2T D;  2D2C B;  1YQ4 D;  3D6Z A;  1OW8 A;  1OW7 A;  2H89 C;  2ACZ D;  3AEC C;  2BS2 C;  2NZ2 A;  3Q5R A;  5KKZ C;  3AE6 D;  1EXI A;  1KTM A;  1RQV A;  3IN6 A;  3AEF D;  2BS4 C;  3S9O A;  4OGQ B;  1HF9 A;  2P10 A;  3AEB D;  3AE4 C;  2D2C C;  3RL0 g;  3D71 A;  3AEG D;  1FDO A;  3B71 A;  4Y28 J;  2YIU C;  2WU2 C;  3AEA C;  3AE4 D;  3P4R D;  2E74 B;  3P4S D;  2G3A A;  1ZOY D;  1KOR A;  1YQ3 D;  2YMK A;  4YXD C;  2WDR C;  3AE3 D;  3AE7 D;  2QJY C;  1MKM A;  3CIR C;  1PL5 A;  3AE2 D;  3SFE C;  1Q90 D;  2FXP A;  2WS3 D;  4YTP C;  5L8R J;  2E75 B;  1ZRT E;  2QJK C;  4OGQ C;  1NGM B;  3SFD D;  4IL6 X;  4H13 D;  1K04 A;  4H0L B;  3VRB C;  2WDQ D;  1VF5 D;  1FDI A;  2E74 C;  1YQ4 C;  4KT0 J;  4YSX C;  4YSY C;  3RK3 E;  3D70 A;  4KX6 C;  2E75 C;  1L0V C;  2ACZ C;  2O01 J;  3O6Q A;  1S1C X;  2WQY D;  2G8Y A;  3AE9 C;  5C3J C;  1GMJ A;  4H0L C;  1KF6 C;  1QLB C;  1ZP0 D;  3AE8 C;  3Q5S A;  3AEB C;  3GF3 A;  3ABV C;  2WSF J;  4RKU J;  2JP3 A;  4XFJ A;  3AEG C;  1NEN C;  2J5U A;  1HJ0 A;  1KMI Z;  3AE1 C;  1OMI A;  2B76 D;  3AE5 D;  3P4R C;  3AEE C;  3GLM A;  3VRA D;  1KFY D;  2FYN C;  1NEK D;  3Q5P A;  2WSC J;  2WU5 C;  3GF7 A;  2WDV D;  2WP9 C;  4YTM D;  3IAO A;  4I7Z C;  1ZME C;  2WS3 C;  4YSZ C;  1UIX A;  2FBW C;  3SFD C;  2QSI A;  1S5L X;  4PV1 C;  2WPV B;  3D6Y A;  1TU3 F;  2ZT9 D;  1WMK A;  3EWK A;  4YT0 C;  4YTN C;  4GDO A;  3VR9 C;  1VF5 C;  5KLI C;  5C2T C;  2E76 D;  2H89 D;  3AEC D;  3R4Y A;  4R4M A;  2H88 D;  1DIP A;  1KQG B;  1VL2 A;  3Q2Y A;  4H44 D;  3P4P D;  2MKV A;  2K9Y A;  2D2C D;  2QIW A;  1IK7 A;  1E7P C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...