3AEEC

Crystal structure of porcine heart mitochondrial complex ii bound with atpenin a5
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of porcine heart mitochondrial complex II bound with Atpenin A5
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
total genus 46
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3aeeC01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3aeeC02
3AEDC 4YTND 3SFEC 5C3JD 3VR8C 1L0VC 2BS3C 3VR9D 2WDRC 1L0VD 2WQYC 3S9OA 2H89D 3AE4C 3AE2C 4KX6C 4YSYD 5C2TD 3P4PD 2B76D 4YTMC 5C2TC 1K04A 1YQ3D 4YSXD 3CIRD 1KFYC 2WU5D 3AE8C 2WU2D 3P4RD 1YQ4C 1OW7A 1ZOYC 3AEAC 2H89C 1KF6C 1NENC 1QLBC 1YQ3C 3AEDD 4YTNC 3AE2D 4KX6D 2BS4C 2B76C 2WDQC 3P4QD 1E7PC 1KF6D 4YT0C 4YXDD 3AE5C 4YSZD 3P4SD 3VR8D 5C3JC 3SFED 3AEGC 3SFDD 1NEND 2WDRD 2WDQD 3AE9D 3AEBD 1K05A 3AE7D 4YTMD 3AE1C 3AE7C 2FBWC 3AE8D 2BS2C 1KFYD 2WU5C 3P4QC 1ZP0C 2WP9D 4YTPD 3P4SC 1YQ4D 3P4RC 2WS3D 4YSYC 3CIRC 2FBWD 2ACZC 3P4PC 2ACZD 3B71A 1NEKD 3ABVC 2WDVC 1OW6A 2WDVD 3AEFC 3AECD 3AE6C 2H88C 2WU2C 1PV3A 4YXDC 2WP9C 4YTPC 1ZOYD 3VRAC 3VR9C 3AEGD 3AE4D 1NEKC 2G3AA 3AE5D 4YSZC 4YSXC 3AE1D 4YT0D 2WQYD 3AECC 3SFDC 3AEFD 3AEED 3AEBC 3AEEC 3VRBD 1ZP0D 3ABVD 3VRBC 3VRAD 3AE3D 3AEAD 1OW8A 3AE3C 2WS3C 3AE9C 2H88D 1KTMA 3AE6D
chains in the Genus database with same CATH superfamily
3O8ZA 3TGUE 3WUTA 5C3JD 2J5UA 4R4LA 1PGQA 5C2TC 3K5BA 4FJVA 1IFNA 1GTWA 1ZR4A 1SFCC 2OGUA 2WU2D 1G2CA 4IL6E 3H1HG 3KZIH 1GL2D 1YQ3C 3HD7C 3P32A 3R2PA 2KOGA 2KI7B 5AVVB 3KDPB 4LLHA 2XZRA 3NTNA 1BSHA 1FDIA 1NEND 1SQVG 4YPCA 2ZYGA 1GW3A 2XV5A 2DW3A 2YKOA 2HLOA 3P4RC 2WS3D 1Y47A 1YTZI 2A06E 3L70G 2Y0EA 1HJ0A 1URQC 3OW2O 4GOFA 1BCCG 3B71A 1R8EA 5DJUB 1RF1B 2FY8A 4NPEA 3H1LD 2VRSA 4PJ0H 4OGQD 3TNUB 1CI6B 2WWWA 1X8YA 2IBZI 4Z1MH 3CCQP 1BGYJ 3V4WA 2WQYD 3A5TA 3EQ2A 1BGYE 3EWKA 2W90A 3AE9C 1Y8AA 3LIDA 1SQXE 1SQPG 3RGUA 3L36A 2BS3C 3VR9D 2JJLA 1GL2B 1VQOP 2OTKE 3B5NC 1YYCA 1JY3P 2XKMA 2M0BA 5APTA 1FZCC 3A7OA 2YMYA 1W5CE 1FZCA 2WVRA 2H89C 3TNUA 1SQQG 2Y9YA 1SQPK 3L73J 5APWA 1SQBD 1JTHB 2QRXA 1USDA 1UIIA 4OGQB 1AVYA 1HWTC 1EZVI 1KFNA 1LTAC 1GW4A 5C3JC 1FZBA 4GODA 2NPSA 1HUCA 1T8ZA 2KP8A 3I55P 3AE7C 2R44A 3V2RA 5E79E 1NTMD 2OYHA 2E74B 1SVFA 1BDCA 1L4AA 3L75J 2YXQB 2WT7A 1PP9D 1OVRA 3EFFK 1H0TB 2YIUC 4DOJA 3OA7A 2WDVD 3AE6C 3LW5J 1AFOA 2B89A 1FZGA 1SQVK 1P84D 4WY4A 3AE4D 2WSEH 1LTJC 3SFDC 3AEEC 1PGOA 1KV4A 1R5SA 1NTKE 3AE3C 2AEJA 1PZQA 3SFEC 3VR8C 2P67A 2H89D 1U7JA 3AE4C 3I5CA 3H1HD 3MP7B 1FJPA 2JO1A 1RE4A 2K9YA 1ZW0A 1NO4A 5KTBA 1S5LX 2JWAA 1VQMP 1LWUA 2B9BA 3RBZA 1ZR2A 3CWBJ 5CCGA 1E79H 1FZEA 4HKZH 4YT0C 1M1JA 5CCHA 1RY3A 3AEGC 2ZXXA 1CW5A 4U3FJ 5APYA 3V2QA 1JB0J 3B5ND 1EDLA 2KS1B 2AXCA 1NGMB 2WSFJ 4H44D 2ZYAA 2YXRB 3A0BE 1VQNP 3M0DA 2QJPB 3VTPC 5L8RJ 4H13B 1J1DB 2ACZD 2P58A 3H1ID 4L75A 5B66E 1L0NJ 2LR2A 2L5GB 1HVVA 3GW6A 1AV1A 2HODA 4EYYQ 2QA4P 4PJ0E 1N7SD 3FXDA 4W7ZA 2WSCH 3AEBC 1HF9A 4KHXA 1J1EB 3LIEA 3W68A 1KQFB 4YTND 4AYCA 2NPSD 3BCCD 3RL0g 1L0VD 3CWBD 4JYCA 4YSYD 2B76D 2W6JH 3CC2P 1J1DC 1ZXGA 4A7PA 2Q3EA 1FC2C 1KILA 1CI6A 3L73G 3EFGA 1W2EA 2O01H 4Y99B 3PHLA 1LTBC 1N73C 4DT0A 1PP9J 1NTKD 3CCSP 2WDQC 2HPCB 2M3BA 3VP9A 3OJAB 4JF7A 1NOHA 3P4SD 3VR8D 1BE3G 2WSCJ 3M9QA 2Q9IA 1S72P 1DD3A 1JY2N 1VQ6P 4ZKPA 5KLVD 5GTHH 2OTLP 2LKMA 1H89A 2QG4A 1VF5D 1EZVD 1YJWP 2AXTE 3CIRC 1GL2C 2M3EA 2HR3A 2QM7A 5APUA 2E74D 5KAIE 3E1RA 3H1KD 4PD4E 1VL2A 2H88C 4I2LC 1BCCJ 3SWYA 4YTPC 1EQ7A 1DX7A 3VR9C 1VQKP 3M06A 1CSBA 3L71J 4GOEA 2UWJE 3L70J 2E74C 1ZMEC 1KB9E 4PD4D 1ZP0D 2R5BA 4GT1A 1QLED 3AE6D 1MV8A 1SFCD 4IFMA 3MIWA 3G6EP 2WDRC 4L76A 4PD4H 1BE3D 2RKLA 1N86A 3S9OA 1Q81Q 1L4AC 1N7SA 4GKGA 4O9BA 5BVZA 1U57A 3MUDC 3AEAC 3H32A 1RE3A 3MHVA 3RK3B 1H88A 3HTKB 2XNXA 3H1HJ 1A02J 3L72D 2Z4EA 3AE2D 5AW2B 1NU1D 1QL1A 3S4RA 3VONA 3CL3D 1KF6D 1L2PA 1IO4A 3HUSB 1FE6A 3H1IE 1SQPE 3SFDD 2WDRD 2WPSA 4N6JA 3IF4A 3P4QC 1SFCB 4N3YB 2CPBA 3L73D 1FOSF 1E5WA 1A02F 2MJZA 3MZWB 3HD7B 1JMMA 1Q2NA 3BRVB 1LTIC 5KJ7D 2IFMA 5M1BA 3USSA 1KFMA 1PV3A 3FX0A 4ZMDA 1PP9G 1LP1B 2YNYA 3H1LE 1ZRTD 1KD1Q 4CPGA 4YT0D 1QGKB 3AECC 5AVUB 3KHUA 3ABVD 1NTMG 2E5TA 3D6YA 1X9VA 3FWNA 5APSA 5KAFE 4HJGH 5B66H 2J59M 1EZVE 4KX6C 1NTZD 3V5BA 1JNMA 1K04A 1ZLLA 2WU5D 2BEZF 4IOIH 1P84H 1RE4C 1AA0A 1YQ4C 1S1CX 3E7KA 3GHGA 2W6BA 4GDOA 1RQUA 2IDBA 4KX6D 2QIWA 1MFTA 4D6TD 1PPJD 3CCEP 5AW1B 3O6QB 1KORA 1SQXD 2H43A 2ZXEB 1OVVA 2WU5C 2FFDA 3VP8A 3W67A 3CXHI 3PTZA 1BDDA 5B5EH 4UB6H 3KYQA 4DJGA 2E75B 2AXTH 2W27A 3CCRP 4BXLA 4PD4I 1AQ5A 3ABVC 5EFWB 3CXHH 5GTIH 3CMAP 1FAVA 5CCGC 4IL6X 2H8PD 2AEFA 2KSJA 2OYIB 1L0LK 3FGAD 1PFIA 3RL0C 3TYYA 5KKZB 3L74D 3BVHA 3AE1D 1T2KD 2N9YB 2WSSH 1LTJA 3JC22 2K37A 2WMMA 1KYOD 1L0LG 2O1KA 2LXCB 4KT0J 4AQRD 4PV1B 3RL0D 1SQVE 1LT9C 5KLIC 1L0NE 3P4PD 3TSIA 4YTMC 2HODB 4TT3H 2G8YA 1SLQA 2PGDA 1YQ3D 1QVFO 3B8EB 5KKZC 2E76D 2Q5UA 2A06D 4ZNCA 3HE4A 1SQBG 1M7LA 2E75D 1RF1A 1KILC 1M57D 1VQPP 1L0ND 3M0AA 3VMYA 4K3AA 3CCMP 5E79H 1FDMA 2OYOA 2B76C 1DH3A 4ASWA 2ZYDA 1DD4A 2NPSC 2IBZG 3RK3E 3CX5D 1DEEG 4W7YA 3L74G 2E5YA 2KLUA 1GDTA 1GMJA 3P8MC 2YKPA 4C7RA 1L4AB 1XTCC 3MGNA 4OVNF 1G2CB 1PPJG 4C46A 2WDVC 2P1JA 1OW6A 1Q7YQ 5AVZB 2N1TC 2D2CB 1P84I 4K35A 3L35A 3Q5PA 3AEED 1H8AA 5CMZA 1NAFA 2NRGA 2E76B 3PRJA 4D6TE 4WY4D 4BRYA 2K3RA 1SQBJ 1NJIQ 1VF5C 3U59A 2WQYC 2WT7B 5AVXB 1MUUA 2ZFCA 2R5DA 1YTZT 3L72G 3G9RA 3O6QA 3MD0A 1QL2A 1KF6C 1S5LE 1UIXA 2IYPA 3AEDD 2OARA 2IZ0A 1L0LJ 2BCCJ 5CBOA 2IZ1A 1N73B 1M90Q 3U1CA 2JR8A 2CK3H 1G1JA 1JCDA 2WPVB 2W8ZA 3CPWO 3CWBE 2I8DA 3AE1C 1TU3F 2E43A 1T2KC 5KJ7A 3VYIA 1AQTA 2N1TD 1FBMA 3E1IA 2ZVNB 5CCHD 2H7HA 1SQPD 2Y9ZA 1FDOA 3GG2A 3L71D 1HH0A 2ACZC 3CCJP 2FYUE 3P4PC 1EDIA 2IX7C 2V7QJ 3JCUH 1H0TA 4H13C 1JCCA 3L73E 1URQD 2QJYB 3M91A 1SQQD 3H1LG 1JY3N 1RF0A 1NKZB 2C9NY 3GF3A 3VRBC 3Q5RA 3WU2E 3AEAD 2A45I 3AEDC 2BEQD 1KYOI 2YIUB 5C2TD 1KN7A 2JDIH 4MN4C 1JM0A 1KFYC 2A45H 1EXJA 1KQGB 3L75D 3GLMA 2I1JA 2Q7CA 1X22A 1N73A 3V6IA 4YTNC 3TGUJ 4N78D 5BU8B 1YIJP 3BRTB 1PPJE 2BS4C 3P4QD 1KB9I 3TDKA 4NPFX 4ASVA 3VOPA 4U3FE 1DEBA 3HRNA 2FXMA 3BCCG 1N7LA 1DIPA 1IC2A 3QH9A 3RBXA 5APXA 2R3CA 4JPZB 3AE9D 3BCCJ 3M9BA 1KB9H 1RF0C 2WPRA 3AE8D 2Z5HA 4DHIB 2QJYC 3TGUG 2L91A 1SQBE 2FYUG 1HTLC 2GM4A 3Q1MA 3U1AA 3B4SA 1NYHA 2KUBA 1KILD 3SWFA 2RH0A 2FXPA 1ZOYD 4OWFA 2FKWB 1W2BO 3AEGD 5CJ0A 1G1IA 3AE5D 3RK2B 1FZAA 2W6AA 2FYUK 1OXZA 3VRAD 3BCCE 3VMZA 3KQGA 2FYZA 2ZFYA 1J1EC 4GIFA 3V2PA 3D70A 2YKQA 2LXBA 2O1JA 1VQ8P 3F89A 4YSXD 1JMBA 3Q3DA 5C39A 2N9BA 2MKVA 3CC7P 4DDIA 1GK4A 3OAKA 1OIPA 2Y0CA 1YHQP 4H0LB 4EIJA 1T3UA 1M1JB 2WSEJ 3H1IG 4YXDD 4YSZD 2KS1A 1VQ7P 1JTHA 1K05A 1IFMA 2Y0DA 3AE7D 2K9JB 3H25A 4YTMD 5CCGD 2P10A 2A06G 1QVGO 3HTKA 5TISH 4U7JA 3WUVA 4Y28J 2O3JA 3KPEA 3L72J 1LWUB 4I7ZC 4XFJA 1LTSC 5AVWB 3SWKA 1BE3J 3S1KA 3G4SP 2FYNC 5CCHC 3B5NB 1HJBA 2KIKA 1FJKA 1BE3E 3G71P 1OVUA 4YSXC 1K73Q 4JQ0D 1PGJA 1RH5B 4N78E 3JCUE 5KJ7C 2K1AA 3AE3D 5GTHE 2H88D 1KTMA 4H13D 2WSFH 3T97B 2B87A 3H1JJ 1KQLA 2M5AB 2IYOA 4DDGA 2R32A 1BCCD 3HD7D 2N1TB 3AE8C 3N4XA 3NXSA 2C9LY 2KSEA 1ZOYC 1RF1C 3L72E 4RO0A 2XU6A 1NENC 1URQA 4WWIA 2ZT9C 1BCCE 5AW7B 4DCKA 4LDTA 4AUWA 1KQSO 3GMAA 1KYOE 4WB4A 4D6TG 3TF5A 1NTZJ 5APQA 2ZT9B 4R4MA 2WDQD 1NHLA 2IFNA 5AW5B 3BATA 1P84E 1SQXJ 1JY3O 1FS0E 5AW6B 4W80A 2YO3A 4UB8H 1SQQK 1S4XA 2BASA 2JEEA 1NVOA 2KB7P 1AJYA 5APVA 1KC8Q 1GL2A 1IFPA 1PGPA 2KZIA 4OH8B 4LGDE 3PLNA 4U3FG 1N8RQ 2PP6A 3VMXA 1GK6A 2PAJA 1FZCB 3CX5H 3SSUA 1GU4A 2KXPB 3H6PA 3F5HA 3BASA 1J2JB 3CWBG 3HUSC 4JBZA 1OX3A 2OQQA 2RMZA 2Q3IA 2JP3A 3CX5I 1L0VC 4B86A 1D7MA 3H1IJ 4C7NA 1HGZA 2ZT9D 2C0XA 3ITKA 3CLQA 5TISE 5AW9B 2E42A 3PH0A 2PRRA 3Q5SA 1QLBC 2Q6QA 1M8OB 1TFFA 1NU1G 1VQ9P 1X79B 3H1JD 2HFED 1WRGA 1EZVG 3IFMA 3L70D 4UB6E 2P7JA 2QM8A 2V4HA 3L75G 3NFQA 2O01N 1VQ4P 2NPSB 4H0LC 4YSYC 3MUDA 3H1JE 5CHXA 2FBWD 5AVYB 1XTGB 1SP4A 3C9IA 3M9HA 3RK2D 1NTKJ 1YBKA 5K5GB 3TGUD 2O01J 2WU2C 4ZKUA 1EXIA 4NPDA 1LWUC 4I7ZB 1S9KD 2GUVA 1QX8A 2IBZD 2YO2A 1OMIA 2K88A 4EI2A 1NTMJ 1IK7A 3ZDMA 1KILE 1M56D 1M1JC 1T3JA 5KLVJ 1PIXA 4DHZA 5KAIH 2C0WA 5CBNA 1NTME 2FYUD 2W83C 1SQQJ 2FYNB 2XDJA 3PJSK 1WT6A 5AW4B 2XNDH 1L4AD 4WVZA 4KJMA 5KLVG 3A0HE 4DZOA 3GF7A 1SS1A 1L0NK 1RE3C 1YJNP 3RK3C 1SQPJ 4HB1A 1N7SB 3CMEP 2WPQA 1NWQA 2OYIC 2OYHB 4WY4C 3CXHD 5DJTB 1FZFA 2ZAEB 3C8VA 4I6MC 1YJ9P 3FXEA 1E7PC 2ZVOB 2N1TA 1EDKA 1NTKG 2FFDB 3CC4P 2JKVA 4EDFA 3RK2C 1LTGC 3G3ZA 1LTTC 2FBWC 3L75E 2D2CC 1IK9A 1ZP0C 1KMIZ 1VPCA 1YQ4D 1LT1A 3H1LJ 3P8CD 1L0LD 1EC5A 1VQ5P 3D6ZA 1BSNA 1PL5A 3P7KA 1NU1J 3GHGB 3LW5H 1SQVJ 2V7QH 1OWAA 3VMAA 4TLFA 1JY2P 3VRAC 2YMKA 1LTJB 3JSVC 3CCVP 2G3AA 5BU5A 2B87B 3AEFD 5TJHA 3A3YB 1U7MA 3L74E 2M5AA 1OW8A 1NU1E 3L71G 4BRYB 1Q86Q 4H44C 2BCCD 3L4FA 4JYBA 1WMKA 4BWNA 1IFDA 3MTUE 1LT9A 5AVQB 1FU1A 3A0HH 1NTKK 3P4RD 2BCCG 1OW7A 3L70E 3H32B 3HE4B 3NMDA 2BCCE 4UB8E 4XE5B 4YXWH 4PV1C 2SPZA 3CI9A 1NTMK 1IFIA 1NTZK 1QEXA 2KZJA 4Y99C 1PP9E 2Q1KA 4DHJA 1ZRTE 2QEXP 4I1LA 2HPCA 1SQXK 3A0BH 1N2DC 3I56P 3CCUP 1IJDB 1MZ9A 4HH2A 2AEMA 4LC1A 3IAOA 1S5LH 3KXDA 3L71E 1SQXG 1SQBK 4RESB 3M0DC 2HYNA 1LJ2A 1NTZG 3B5NA 5AW3B 2E75C 1JEKA 4D6TJ 1VF5B 3QWOC 3WU2H 1Q82Q 2GA1A 5KLVE 1HBWA 1CZQA 3AEFC 2KNCA 3AECD 1SQQE 3WUUA 3HE5B 3Q2YA 3II6A 4YSZC 1JY2O 1LNQA 3WMM0 4L74A 3CXHE 5GTIE 1L0LE 1LP1A 5H2FH 2CPSA 3L74J 1GU5A 5AW0B 2KNCB 3A2AA 2K9JA 1IFJA 2QJPC 3H1JG 3AE2C 2NZ2A 5AW8B 3H1KJ 2QSIA 1L0NG 3PP5A 3CIRD 1JO5A 2D2CD 1BGYD 1NU1K 2I1KA 3H1KE 2OYHC 1KILB 1YI2P 5AVTB 2KYVA 1X0TA 1K9MQ 4IFFA 1GD2E 2QVAA 1Y9BA 1NKNA 5KLIB 1KYOH 1R5LA 3AE5C 1NH4A 3UIAA 2M8RA 3AEBD 2PFXA 4H44B 1N7SC 2FFDC 1VDFA 3FWLA 2BS2C 2HG5D 1KFYD 4RJTA 4YTPD 3L37A 4I6LA 1MFZA 5AVRB 1SQVD 1ZN5A 5AVSB 2J58A 2A45G 4M3LA 1FOSE 1OFCX 1OZHA 2WP9C 3CD6P 3GHGC 1JUNA 1KZUB 1LT9B 4L73A 3TK1A 1Z56A 1EDJA 3RL0B 4PV1D 1HGVA 5KLVK 3HUSA 3T97A 2POHA 2ITAA 5CJ4A 4HYTB 2QJKC 2WS3C 1NAYA 4RKUJ 1JOCA 1S9KE 2B88A 2ZJSE 2E76C 2IBZE 2R3SA 1LGHB 3RK3D 1S3JA 4IFDK 2WITA 2WTYA 4EOTA 1URQB 3H1KG 2JWDA 5B5EE 1SFCA 3HE5A 3V4QA 3CCLP 1NTZE 3N7NA 3H1HE 2OYIA 1YITP 3IR9A 1Q90D 2KK7A 3HD7A 1MKMA 1RHZB 2KLVA 1VQLP 1M1KQ 4OGQC 3SFED 2Z5IA 3CX5E 4U3FD 3P8CE 2FYUJ 1ZV8A 4C7NB 1USEA 1KB9D 1S2EA 1IZNB 1GZLA 2FXOA 2WP9D 4WY4B 3P4SC 1RQVA 1AVOA 2IPPA 1K8AQ 1T6AA 1NEKD 3C1LA 2QJKB 5KAFH 4YXDC 2QE7H 4QMAA 3IN6A 4WBAA 4XA4A 2OTJP 2WZ7A 4IL6H 1NEKC 3V2NA 2P2UA 2RN0A 3R4YA 3KZIE 3VRBD 5H2FE 2GUSA 4H0LD 1BGYG 3VN0A 3D71A
chains in the Genus database with same CATH topology
1KQFB 4RKUJ 3AEDC 2E76C 2JP3A 4YTND 3SFEC 4H44C 3T97B 5C3JD 1L0VC 2BEQD 1VF5C 2QJPC 3RL0g 1WMKA 2BS3C 2WDRC 3VR9D 4KT0J 2WQYC 3S9OA 3D70A 3AE4C 4PV1B 1L0VD 2H89D 5KLIC 3AE2C 2NZ2A 4KX6C 4YSYD 5C2TD 3P4PD 2J5UA 4R4LA 2B76D 4YTMC 5C2TC 4TT3H 1K04A 2G8YA 2QSIA 1YQ3D 4YSXD 3AE6D 3CIRD 2JO1A 2ZT9D 1KFYC 2WU5D 2K9YA 2D2CD 3AE8C 2BEZF 3Q3DA 2MKVA 5KKZC 2E76D 3G9RA 3O6QA 2WU2D 1S5LX 1U57A 1EXJA 1KQGB 3P4RD 1YQ4C 3GF7A 1OW7A 1ZOYC 3GLMA 3AEAC 2H89C 3VR8C 2E75D 1S1CX 1KF6C 1NENC 3Q5SA 1UIXA 1QLBC 1YQ3C 3AEDD 4GDOA 4YTNC 1RQUA 2IDBA 2ZT9C 4PV1C 1Q90D 3AE2D 4KX6D 1KTMA 2BS4C 1MKMA 3C8VA 2QIWA 2B76C 2WDQC 3P4QD 4H0LB 1Y9BA 4OGQB 1E7PC 3GMAA 1KF6D 4YT0C 2WSEJ 4YXDD 4OGQC 1DIPA 3AE5C 4YSZD 1ZRTE 2WS3C 2WPVB 3P4SD 3VR8D 1DD4A 5C3JC 3SFED 3AEGC 1KORA 1FDIA 1NEND 2WDRD 2ZT9B 2WSCJ 4R4MA 2WDQD 3SFDD 3AE9D 3AEBD 1K05A 1JB0J 3AE7D 3RK3E 3H25A 4YTMD 4H44B 1DD3A 3AE1C 3AE7C 2FBWC 1TU3F 2D2CC 3AE8D 2BS2C 1KFYD 2WU5C 1NGMB 3P4QC 2WSFJ 1ZP0C 3IAOA 4H44D 2WP9D 2P10A 4YTPD 3P4SC 1KMIZ 1YQ4D 3P4RC 1RQVA 4H0LC 2WS3D 4YSYC 1GMJA 2QJYC 2E74B 4U7JA 4Y28J 5L8RJ 1VF5D 1AJYA 1FDOA 3CIRC 3D6ZA 2E75B 1HJ0A 2FBWD 4H13B 2ACZC 1PL5A 2E74D 2E75C 2ACZD 1VF5B 3Q1MA 3P4PC 3VRBC 3B71A 1R8EA 1NYHA 4I7ZC 4XFJA 3ABVC 1NEKD 2V7QJ 5M1BA 2WDVC 1OW6A 2YIUC 1VL2A 4IL6X 2WDVD 2O01J 3AEFC 3AECD 3AE6C 4H13C 3LW5J 2H88C 2WU2C 4OGQD 1PV3A 2FXPA 4YXDC 4YTPC 2WP9C 2FYNC 1EXIA 1ZOYD 3VRAC 2YMKA 2D2CB 4I7ZB 3IN6A 3VR9C 3FGAD 3AEGD 3AE4D 4Z1MH 3Q2YA 1NEKC 2G3AA 3AE5D 4YSZC 4YSXC 4PV1D 1OMIA 3AE1D 2WQYD 4YT0D 2E74C 3AECC 1IK7A 3SFDC 3AEFD 3Q5PA 3AEED 1ZMEC 3AEBC 3AEEC 3R4YA 1KILE 1ZP0D 3VRBD 2OQQA 3GF3A 1HF9A 3Q5RA 3ABVD 3EWKA 3D6YA 3AE3D 3AEAD 3VRAD 1OW8A 1PIXA 2QJKC 3AE9C 3AE3C 4H0LD 2E76B 2H88D 3D71A 4H13D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AED C;  4YTN D;  3SFE C;  5C3J D;  3VR8 C;  1L0V C;  2BS3 C;  3VR9 D;  2WDR C;  1L0V D;  2WQY C;  3S9O A;  2H89 D;  3AE4 C;  3AE2 C;  4KX6 C;  4YSY D;  5C2T D;  3P4P D;  2B76 D;  4YTM C;  5C2T C;  1K04 A;  1YQ3 D;  4YSX D;  3CIR D;  1KFY C;  2WU5 D;  3AE8 C;  2WU2 D;  3P4R D;  1YQ4 C;  1OW7 A;  1ZOY C;  3AEA C;  2H89 C;  1KF6 C;  1NEN C;  1QLB C;  1YQ3 C;  3AED D;  4YTN C;  3AE2 D;  4KX6 D;  2BS4 C;  2B76 C;  2WDQ C;  3P4Q D;  1E7P C;  1KF6 D;  4YT0 C;  4YXD D;  3AE5 C;  4YSZ D;  3P4S D;  3VR8 D;  5C3J C;  3SFE D;  3AEG C;  3SFD D;  1NEN D;  2WDR D;  2WDQ D;  3AE9 D;  3AEB D;  1K05 A;  3AE7 D;  4YTM D;  3AE1 C;  3AE7 C;  2FBW C;  3AE8 D;  2BS2 C;  1KFY D;  2WU5 C;  3P4Q C;  1ZP0 C;  2WP9 D;  4YTP D;  3P4S C;  1YQ4 D;  3P4R C;  2WS3 D;  4YSY C;  3CIR C;  2FBW D;  2ACZ C;  3P4P C;  2ACZ D;  3B71 A;  1NEK D;  3ABV C;  2WDV C;  1OW6 A;  2WDV D;  3AEF C;  3AEC D;  3AE6 C;  2H88 C;  2WU2 C;  1PV3 A;  4YXD C;  2WP9 C;  4YTP C;  1ZOY D;  3VRA C;  3VR9 C;  3AEG D;  3AE4 D;  1NEK C;  2G3A A;  3AE5 D;  4YSZ C;  4YSX C;  3AE1 D;  4YT0 D;  2WQY D;  3AEC C;  3SFD C;  3AEF D;  3AEE D;  3AEB C;  3AEE C;  3VRB D;  1ZP0 D;  3ABV D;  3VRB C;  3VRA D;  3AE3 D;  3AEA D;  1OW8 A;  3AE3 C;  2WS3 C;  3AE9 C;  2H88 D;  1KTM A;  3AE6 D; 
#chains in the Genus database with same CATH topology
 3O8Z A;  3TGU E;  3WUT A;  5C3J D;  2J5U A;  4R4L A;  1PGQ A;  5C2T C;  3K5B A;  4FJV A;  1IFN A;  1GTW A;  1ZR4 A;  1SFC C;  2OGU A;  2WU2 D;  1G2C A;  4IL6 E;  3H1H G;  3KZI H;  1GL2 D;  1YQ3 C;  3HD7 C;  3P32 A;  3R2P A;  2KOG A;  2KI7 B;  5AVV B;  3KDP B;  4LLH A;  2XZR A;  3NTN A;  1BSH A;  1FDI A;  1NEN D;  1SQV G;  4YPC A;  2ZYG A;  1GW3 A;  2XV5 A;  2DW3 A;  2YKO A;  2HLO A;  3P4R C;  2WS3 D;  1Y47 A;  1YTZ I;  2A06 E;  3L70 G;  2Y0E A;  1HJ0 A;  1URQ C;  3OW2 O;  4GOF A;  1BCC G;  3B71 A;  1R8E A;  5DJU B;  1RF1 B;  2FY8 A;  4NPE A;  3H1L D;  2VRS A;  4PJ0 H;  4OGQ D;  3TNU B;  1CI6 B;  2WWW A;  1X8Y A;  2IBZ I;  4Z1M H;  3CCQ P;  1BGY J;  3V4W A;  2WQY D;  3A5T A;  3EQ2 A;  1BGY E;  3EWK A;  2W90 A;  3AE9 C;  1Y8A A;  3LID A;  1SQX E;  1SQP G;  3RGU A;  3L36 A;  2BS3 C;  3VR9 D;  2JJL A;  1GL2 B;  1VQO P;  2OTK E;  3B5N C;  1YYC A;  1JY3 P;  2XKM A;  2M0B A;  5APT A;  1FZC C;  3A7O A;  2YMY A;  1W5C E;  1FZC A;  2WVR A;  2H89 C;  3TNU A;  1SQQ G;  2Y9Y A;  1SQP K;  3L73 J;  5APW A;  1SQB D;  1JTH B;  2QRX A;  1USD A;  1UII A;  4OGQ B;  1AVY A;  1HWT C;  1EZV I;  1KFN A;  1LTA C;  1GW4 A;  5C3J C;  1FZB A;  4GOD A;  2NPS A;  1HUC A;  1T8Z A;  2KP8 A;  3I55 P;  3AE7 C;  2R44 A;  3V2R A;  5E79 E;  1NTM D;  2OYH A;  2E74 B;  1SVF A;  1BDC A;  1L4A A;  3L75 J;  2YXQ B;  2WT7 A;  1PP9 D;  1OVR A;  3EFF K;  1H0T B;  2YIU C;  4DOJ A;  3OA7 A;  2WDV D;  3AE6 C;  3LW5 J;  1AFO A;  2B89 A;  1FZG A;  1SQV K;  1P84 D;  4WY4 A;  3AE4 D;  2WSE H;  1LTJ C;  3SFD C;  3AEE C;  1PGO A;  1KV4 A;  1R5S A;  1NTK E;  3AE3 C;  2AEJ A;  1PZQ A;  3SFE C;  3VR8 C;  2P67 A;  2H89 D;  1U7J A;  3AE4 C;  3I5C A;  3H1H D;  3MP7 B;  1FJP A;  2JO1 A;  1RE4 A;  2K9Y A;  1ZW0 A;  1NO4 A;  5KTB A;  1S5L X;  2JWA A;  1VQM P;  1LWU A;  2B9B A;  3RBZ A;  1ZR2 A;  3CWB J;  5CCG A;  1E79 H;  1FZE A;  4HKZ H;  4YT0 C;  1M1J A;  5CCH A;  1RY3 A;  3AEG C;  2ZXX A;  1CW5 A;  4U3F J;  5APY A;  3V2Q A;  1JB0 J;  3B5N D;  1EDL A;  2KS1 B;  2AXC A;  1NGM B;  2WSF J;  4H44 D;  2ZYA A;  2YXR B;  3A0B E;  1VQN P;  3M0D A;  2QJP B;  3VTP C;  5L8R J;  4H13 B;  1J1D B;  2ACZ D;  2P58 A;  3H1I D;  4L75 A;  5B66 E;  1L0N J;  2LR2 A;  2L5G B;  1HVV A;  3GW6 A;  1AV1 A;  2HOD A;  4EYY Q;  2QA4 P;  4PJ0 E;  1N7S D;  3FXD A;  4W7Z A;  2WSC H;  3AEB C;  1HF9 A;  4KHX A;  1J1E B;  3LIE A;  3W68 A;  1KQF B;  4YTN D;  4AYC A;  2NPS D;  3BCC D;  3RL0 g;  1L0V D;  3CWB D;  4JYC A;  4YSY D;  2B76 D;  2W6J H;  3CC2 P;  1J1D C;  1ZXG A;  4A7P A;  2Q3E A;  1FC2 C;  1KIL A;  1CI6 A;  3L73 G;  3EFG A;  1W2E A;  2O01 H;  4Y99 B;  3PHL A;  1LTB C;  1N73 C;  4DT0 A;  1PP9 J;  1NTK D;  3CCS P;  2WDQ C;  2HPC B;  2M3B A;  3VP9 A;  3OJA B;  4JF7 A;  1NOH A;  3P4S D;  3VR8 D;  1BE3 G;  2WSC J;  3M9Q A;  2Q9I A;  1S72 P;  1DD3 A;  1JY2 N;  1VQ6 P;  4ZKP A;  5KLV D;  5GTH H;  2OTL P;  2LKM A;  1H89 A;  2QG4 A;  1VF5 D;  1EZV D;  1YJW P;  2AXT E;  3CIR C;  1GL2 C;  2M3E A;  2HR3 A;  2QM7 A;  5APU A;  2E74 D;  5KAI E;  3E1R A;  3H1K D;  4PD4 E;  1VL2 A;  2H88 C;  4I2L C;  1BCC J;  3SWY A;  4YTP C;  1EQ7 A;  1DX7 A;  3VR9 C;  1VQK P;  3M06 A;  1CSB A;  3L71 J;  4GOE A;  2UWJ E;  3L70 J;  2E74 C;  1ZME C;  1KB9 E;  4PD4 D;  1ZP0 D;  2R5B A;  4GT1 A;  1QLE D;  3AE6 D;  1MV8 A;  1SFC D;  4IFM A;  3MIW A;  3G6E P;  2WDR C;  4L76 A;  4PD4 H;  1BE3 D;  2RKL A;  1N86 A;  3S9O A;  1Q81 Q;  1L4A C;  1N7S A;  4GKG A;  4O9B A;  5BVZ A;  1U57 A;  3MUD C;  3AEA C;  3H32 A;  1RE3 A;  3MHV A;  3RK3 B;  1H88 A;  3HTK B;  2XNX A;  3H1H J;  1A02 J;  3L72 D;  2Z4E A;  3AE2 D;  5AW2 B;  1NU1 D;  1QL1 A;  3S4R A;  3VON A;  3CL3 D;  1KF6 D;  1L2P A;  1IO4 A;  3HUS B;  1FE6 A;  3H1I E;  1SQP E;  3SFD D;  2WDR D;  2WPS A;  4N6J A;  3IF4 A;  3P4Q C;  1SFC B;  4N3Y B;  2CPB A;  3L73 D;  1FOS F;  1E5W A;  1A02 F;  2MJZ A;  3MZW B;  3HD7 B;  1JMM A;  1Q2N A;  3BRV B;  1LTI C;  5KJ7 D;  2IFM A;  5M1B A;  3USS A;  1KFM A;  1PV3 A;  3FX0 A;  4ZMD A;  1PP9 G;  1LP1 B;  2YNY A;  3H1L E;  1ZRT D;  1KD1 Q;  4CPG A;  4YT0 D;  1QGK B;  3AEC C;  5AVU B;  3KHU A;  3ABV D;  1NTM G;  2E5T A;  3D6Y A;  1X9V A;  3FWN A;  5APS A;  5KAF E;  4HJG H;  5B66 H;  2J59 M;  1EZV E;  4KX6 C;  1NTZ D;  3V5B A;  1JNM A;  1K04 A;  1ZLL A;  2WU5 D;  2BEZ F;  4IOI H;  1P84 H;  1RE4 C;  1AA0 A;  1YQ4 C;  1S1C X;  3E7K A;  3GHG A;  2W6B A;  4GDO A;  1RQU A;  2IDB A;  4KX6 D;  2QIW A;  1MFT A;  4D6T D;  1PPJ D;  3CCE P;  5AW1 B;  3O6Q B;  1KOR A;  1SQX D;  2H43 A;  2ZXE B;  1OVV A;  2WU5 C;  2FFD A;  3VP8 A;  3W67 A;  3CXH I;  3PTZ A;  1BDD A;  5B5E H;  4UB6 H;  3KYQ A;  4DJG A;  2E75 B;  2AXT H;  2W27 A;  3CCR P;  4BXL A;  4PD4 I;  1AQ5 A;  3ABV C;  5EFW B;  3CXH H;  5GTI H;  3CMA P;  1FAV A;  5CCG C;  4IL6 X;  2H8P D;  2AEF A;  2KSJ A;  2OYI B;  1L0L K;  3FGA D;  1PFI A;  3RL0 C;  3TYY A;  5KKZ B;  3L74 D;  3BVH A;  3AE1 D;  1T2K D;  2N9Y B;  2WSS H;  1LTJ A;  3JC2 2;  2K37 A;  2WMM A;  1KYO D;  1L0L G;  2O1K A;  2LXC B;  4KT0 J;  4AQR D;  4PV1 B;  3RL0 D;  1SQV E;  1LT9 C;  5KLI C;  1L0N E;  3P4P D;  3TSI A;  4YTM C;  2HOD B;  4TT3 H;  2G8Y A;  1SLQ A;  2PGD A;  1YQ3 D;  1QVF O;  3B8E B;  5KKZ C;  2E76 D;  2Q5U A;  2A06 D;  4ZNC A;  3HE4 A;  1SQB G;  1M7L A;  2E75 D;  1RF1 A;  1KIL C;  1M57 D;  1VQP P;  1L0N D;  3M0A A;  3VMY A;  4K3A A;  3CCM P;  5E79 H;  1FDM A;  2OYO A;  2B76 C;  1DH3 A;  4ASW A;  2ZYD A;  1DD4 A;  2NPS C;  2IBZ G;  3RK3 E;  3CX5 D;  1DEE G;  4W7Y A;  3L74 G;  2E5Y A;  2KLU A;  1GDT A;  1GMJ A;  3P8M C;  2YKP A;  4C7R A;  1L4A B;  1XTC C;  3MGN A;  4OVN F;  1G2C B;  1PPJ G;  4C46 A;  2WDV C;  2P1J A;  1OW6 A;  1Q7Y Q;  5AVZ B;  2N1T C;  2D2C B;  1P84 I;  4K35 A;  3L35 A;  3Q5P A;  3AEE D;  1H8A A;  5CMZ A;  1NAF A;  2NRG A;  2E76 B;  3PRJ A;  4D6T E;  4WY4 D;  4BRY A;  2K3R A;  1SQB J;  1NJI Q;  1VF5 C;  3U59 A;  2WQY C;  2WT7 B;  5AVX B;  1MUU A;  2ZFC A;  2R5D A;  1YTZ T;  3L72 G;  3G9R A;  3O6Q A;  3MD0 A;  1QL2 A;  1KF6 C;  1S5L E;  1UIX A;  2IYP A;  3AED D;  2OAR A;  2IZ0 A;  1L0L J;  2BCC J;  5CBO A;  2IZ1 A;  1N73 B;  1M90 Q;  3U1C A;  2JR8 A;  2CK3 H;  1G1J A;  1JCD A;  2WPV B;  2W8Z A;  3CPW O;  3CWB E;  2I8D A;  3AE1 C;  1TU3 F;  2E43 A;  1T2K C;  5KJ7 A;  3VYI A;  1AQT A;  2N1T D;  1FBM A;  3E1I A;  2ZVN B;  5CCH D;  2H7H A;  1SQP D;  2Y9Z A;  1FDO A;  3GG2 A;  3L71 D;  1HH0 A;  2ACZ C;  3CCJ P;  2FYU E;  3P4P C;  1EDI A;  2IX7 C;  2V7Q J;  3JCU H;  1H0T A;  4H13 C;  1JCC A;  3L73 E;  1URQ D;  2QJY B;  3M91 A;  1SQQ D;  3H1L G;  1JY3 N;  1RF0 A;  1NKZ B;  2C9N Y;  3GF3 A;  3VRB C;  3Q5R A;  3WU2 E;  3AEA D;  2A45 I;  3AED C;  2BEQ D;  1KYO I;  2YIU B;  5C2T D;  1KN7 A;  2JDI H;  4MN4 C;  1JM0 A;  1KFY C;  2A45 H;  1EXJ A;  1KQG B;  3L75 D;  3GLM A;  2I1J A;  2Q7C A;  1X22 A;  1N73 A;  3V6I A;  4YTN C;  3TGU J;  4N78 D;  5BU8 B;  1YIJ P;  3BRT B;  1PPJ E;  2BS4 C;  3P4Q D;  1KB9 I;  3TDK A;  4NPF X;  4ASV A;  3VOP A;  4U3F E;  1DEB A;  3HRN A;  2FXM A;  3BCC G;  1N7L A;  1DIP A;  1IC2 A;  3QH9 A;  3RBX A;  5APX A;  2R3C A;  4JPZ B;  3AE9 D;  3BCC J;  3M9B A;  1KB9 H;  1RF0 C;  2WPR A;  3AE8 D;  2Z5H A;  4DHI B;  2QJY C;  3TGU G;  2L91 A;  1SQB E;  2FYU G;  1HTL C;  2GM4 A;  3Q1M A;  3U1A A;  3B4S A;  1NYH A;  2KUB A;  1KIL D;  3SWF A;  2RH0 A;  2FXP A;  1ZOY D;  4OWF A;  2FKW B;  1W2B O;  3AEG D;  5CJ0 A;  1G1I A;  3AE5 D;  3RK2 B;  1FZA A;  2W6A A;  2FYU K;  1OXZ A;  3VRA D;  3BCC E;  3VMZ A;  3KQG A;  2FYZ A;  2ZFY A;  1J1E C;  4GIF A;  3V2P A;  3D70 A;  2YKQ A;  2LXB A;  2O1J A;  1VQ8 P;  3F89 A;  4YSX D;  1JMB A;  3Q3D A;  5C39 A;  2N9B A;  2MKV A;  3CC7 P;  4DDI A;  1GK4 A;  3OAK A;  1OIP A;  2Y0C A;  1YHQ P;  4H0L B;  4EIJ A;  1T3U A;  1M1J B;  2WSE J;  3H1I G;  4YXD D;  4YSZ D;  2KS1 A;  1VQ7 P;  1JTH A;  1K05 A;  1IFM A;  2Y0D A;  3AE7 D;  2K9J B;  3H25 A;  4YTM D;  5CCG D;  2P10 A;  2A06 G;  1QVG O;  3HTK A;  5TIS H;  4U7J A;  3WUV A;  4Y28 J;  2O3J A;  3KPE A;  3L72 J;  1LWU B;  4I7Z C;  4XFJ A;  1LTS C;  5AVW B;  3SWK A;  1BE3 J;  3S1K A;  3G4S P;  2FYN C;  5CCH C;  3B5N B;  1HJB A;  2KIK A;  1FJK A;  1BE3 E;  3G71 P;  1OVU A;  4YSX C;  1K73 Q;  4JQ0 D;  1PGJ A;  1RH5 B;  4N78 E;  3JCU E;  5KJ7 C;  2K1A A;  3AE3 D;  5GTH E;  2H88 D;  1KTM A;  4H13 D;  2WSF H;  3T97 B;  2B87 A;  3H1J J;  1KQL A;  2M5A B;  2IYO A;  4DDG A;  2R32 A;  1BCC D;  3HD7 D;  2N1T B;  3AE8 C;  3N4X A;  3NXS A;  2C9L Y;  2KSE A;  1ZOY C;  1RF1 C;  3L72 E;  4RO0 A;  2XU6 A;  1NEN C;  1URQ A;  4WWI A;  2ZT9 C;  1BCC E;  5AW7 B;  4DCK A;  4LDT A;  4AUW A;  1KQS O;  3GMA A;  1KYO E;  4WB4 A;  4D6T G;  3TF5 A;  1NTZ J;  5APQ A;  2ZT9 B;  4R4M A;  2WDQ D;  1NHL A;  2IFN A;  5AW5 B;  3BAT A;  1P84 E;  1SQX J;  1JY3 O;  1FS0 E;  5AW6 B;  4W80 A;  2YO3 A;  4UB8 H;  1SQQ K;  1S4X A;  2BAS A;  2JEE A;  1NVO A;  2KB7 P;  1AJY A;  5APV A;  1KC8 Q;  1GL2 A;  1IFP A;  1PGP A;  2KZI A;  4OH8 B;  4LGD E;  3PLN A;  4U3F G;  1N8R Q;  2PP6 A;  3VMX A;  1GK6 A;  2PAJ A;  1FZC B;  3CX5 H;  3SSU A;  1GU4 A;  2KXP B;  3H6P A;  3F5H A;  3BAS A;  1J2J B;  3CWB G;  3HUS C;  4JBZ A;  1OX3 A;  2OQQ A;  2RMZ A;  2Q3I A;  2JP3 A;  3CX5 I;  1L0V C;  4B86 A;  1D7M A;  3H1I J;  4C7N A;  1HGZ A;  2ZT9 D;  2C0X A;  3ITK A;  3CLQ A;  5TIS E;  5AW9 B;  2E42 A;  3PH0 A;  2PRR A;  3Q5S A;  1QLB C;  2Q6Q A;  1M8O B;  1TFF A;  1NU1 G;  1VQ9 P;  1X79 B;  3H1J D;  2HFE D;  1WRG A;  1EZV G;  3IFM A;  3L70 D;  4UB6 E;  2P7J A;  2QM8 A;  2V4H A;  3L75 G;  3NFQ A;  2O01 N;  1VQ4 P;  2NPS B;  4H0L C;  4YSY C;  3MUD A;  3H1J E;  5CHX A;  2FBW D;  5AVY B;  1XTG B;  1SP4 A;  3C9I A;  3M9H A;  3RK2 D;  1NTK J;  1YBK A;  5K5G B;  3TGU D;  2O01 J;  2WU2 C;  4ZKU A;  1EXI A;  4NPD A;  1LWU C;  4I7Z B;  1S9K D;  2GUV A;  1QX8 A;  2IBZ D;  2YO2 A;  1OMI A;  2K88 A;  4EI2 A;  1NTM J;  1IK7 A;  3ZDM A;  1KIL E;  1M56 D;  1M1J C;  1T3J A;  5KLV J;  1PIX A;  4DHZ A;  5KAI H;  2C0W A;  5CBN A;  1NTM E;  2FYU D;  2W83 C;  1SQQ J;  2FYN B;  2XDJ A;  3PJS K;  1WT6 A;  5AW4 B;  2XND H;  1L4A D;  4WVZ A;  4KJM A;  5KLV G;  3A0H E;  4DZO A;  3GF7 A;  1SS1 A;  1L0N K;  1RE3 C;  1YJN P;  3RK3 C;  1SQP J;  4HB1 A;  1N7S B;  3CME P;  2WPQ A;  1NWQ A;  2OYI C;  2OYH B;  4WY4 C;  3CXH D;  5DJT B;  1FZF A;  2ZAE B;  3C8V A;  4I6M C;  1YJ9 P;  3FXE A;  1E7P C;  2ZVO B;  2N1T A;  1EDK A;  1NTK G;  2FFD B;  3CC4 P;  2JKV A;  4EDF A;  3RK2 C;  1LTG C;  3G3Z A;  1LTT C;  2FBW C;  3L75 E;  2D2C C;  1IK9 A;  1ZP0 C;  1KMI Z;  1VPC A;  1YQ4 D;  1LT1 A;  3H1L J;  3P8C D;  1L0L D;  1EC5 A;  1VQ5 P;  3D6Z A;  1BSN A;  1PL5 A;  3P7K A;  1NU1 J;  3GHG B;  3LW5 H;  1SQV J;  2V7Q H;  1OWA A;  3VMA A;  4TLF A;  1JY2 P;  3VRA C;  2YMK A;  1LTJ B;  3JSV C;  3CCV P;  2G3A A;  5BU5 A;  2B87 B;  3AEF D;  5TJH A;  3A3Y B;  1U7M A;  3L74 E;  2M5A A;  1OW8 A;  1NU1 E;  3L71 G;  4BRY B;  1Q86 Q;  4H44 C;  2BCC D;  3L4F A;  4JYB A;  1WMK A;  4BWN A;  1IFD A;  3MTU E;  1LT9 A;  5AVQ B;  1FU1 A;  3A0H H;  1NTK K;  3P4R D;  2BCC G;  1OW7 A;  3L70 E;  3H32 B;  3HE4 B;  3NMD A;  2BCC E;  4UB8 E;  4XE5 B;  4YXW H;  4PV1 C;  2SPZ A;  3CI9 A;  1NTM K;  1IFI A;  1NTZ K;  1QEX A;  2KZJ A;  4Y99 C;  1PP9 E;  2Q1K A;  4DHJ A;  1ZRT E;  2QEX P;  4I1L A;  2HPC A;  1SQX K;  3A0B H;  1N2D C;  3I56 P;  3CCU P;  1IJD B;  1MZ9 A;  4HH2 A;  2AEM A;  4LC1 A;  3IAO A;  1S5L H;  3KXD A;  3L71 E;  1SQX G;  1SQB K;  4RES B;  3M0D C;  2HYN A;  1LJ2 A;  1NTZ G;  3B5N A;  5AW3 B;  2E75 C;  1JEK A;  4D6T J;  1VF5 B;  3QWO C;  3WU2 H;  1Q82 Q;  2GA1 A;  5KLV E;  1HBW A;  1CZQ A;  3AEF C;  2KNC A;  3AEC D;  1SQQ E;  3WUU A;  3HE5 B;  3Q2Y A;  3II6 A;  4YSZ C;  1JY2 O;  1LNQ A;  3WMM 0;  4L74 A;  3CXH E;  5GTI E;  1L0L E;  1LP1 A;  5H2F H;  2CPS A;  3L74 J;  1GU5 A;  5AW0 B;  2KNC B;  3A2A A;  2K9J A;  1IFJ A;  2QJP C;  3H1J G;  3AE2 C;  2NZ2 A;  5AW8 B;  3H1K J;  2QSI A;  1L0N G;  3PP5 A;  3CIR D;  1JO5 A;  2D2C D;  1BGY D;  1NU1 K;  2I1K A;  3H1K E;  2OYH C;  1KIL B;  1YI2 P;  5AVT B;  2KYV A;  1X0T A;  1K9M Q;  4IFF A;  1GD2 E;  2QVA A;  1Y9B A;  1NKN A;  5KLI B;  1KYO H;  1R5L A;  3AE5 C;  1NH4 A;  3UIA A;  2M8R A;  3AEB D;  2PFX A;  4H44 B;  1N7S C;  2FFD C;  1VDF A;  3FWL A;  2BS2 C;  2HG5 D;  1KFY D;  4RJT A;  4YTP D;  3L37 A;  4I6L A;  1MFZ A;  5AVR B;  1SQV D;  1ZN5 A;  5AVS B;  2J58 A;  2A45 G;  4M3L A;  1FOS E;  1OFC X;  1OZH A;  2WP9 C;  3CD6 P;  3GHG C;  1JUN A;  1KZU B;  1LT9 B;  4L73 A;  3TK1 A;  1Z56 A;  1EDJ A;  3RL0 B;  4PV1 D;  1HGV A;  5KLV K;  3HUS A;  3T97 A;  2POH A;  2ITA A;  5CJ4 A;  4HYT B;  2QJK C;  2WS3 C;  1NAY A;  4RKU J;  1JOC A;  1S9K E;  2B88 A;  2ZJS E;  2E76 C;  2IBZ E;  2R3S A;  1LGH B;  3RK3 D;  1S3J A;  4IFD K;  2WIT A;  2WTY A;  4EOT A;  1URQ B;  3H1K G;  2JWD A;  5B5E E;  1SFC A;  3HE5 A;  3V4Q A;  3CCL P;  1NTZ E;  3N7N A;  3H1H E;  2OYI A;  1YIT P;  3IR9 A;  1Q90 D;  2KK7 A;  3HD7 A;  1MKM A;  1RHZ B;  2KLV A;  1VQL P;  1M1K Q;  4OGQ C;  3SFE D;  2Z5I A;  3CX5 E;  4U3F D;  3P8C E;  2FYU J;  1ZV8 A;  4C7N B;  1USE A;  1KB9 D;  1S2E A;  1IZN B;  1GZL A;  2FXO A;  2WP9 D;  4WY4 B;  3P4S C;  1RQV A;  1AVO A;  2IPP A;  1K8A Q;  1T6A A;  1NEK D;  3C1L A;  2QJK B;  5KAF H;  4YXD C;  2QE7 H;  4QMA A;  3IN6 A;  4WBA A;  4XA4 A;  2OTJ P;  2WZ7 A;  4IL6 H;  1NEK C;  3V2N A;  2P2U A;  2RN0 A;  3R4Y A;  3KZI E;  3VRB D;  5H2F E;  2GUS A;  4H0L D;  1BGY G;  3VN0 A;  3D71 A; 
#chains in the Genus database with same CATH homology
 1KQF B;  4RKU J;  3AED C;  2E76 C;  2JP3 A;  4YTN D;  3SFE C;  4H44 C;  3T97 B;  5C3J D;  1L0V C;  2BEQ D;  1VF5 C;  2QJP C;  3RL0 g;  1WMK A;  2BS3 C;  2WDR C;  3VR9 D;  4KT0 J;  2WQY C;  3S9O A;  3D70 A;  3AE4 C;  4PV1 B;  1L0V D;  2H89 D;  5KLI C;  3AE2 C;  2NZ2 A;  4KX6 C;  4YSY D;  5C2T D;  3P4P D;  2J5U A;  4R4L A;  2B76 D;  4YTM C;  5C2T C;  4TT3 H;  1K04 A;  2G8Y A;  2QSI A;  1YQ3 D;  4YSX D;  3AE6 D;  3CIR D;  2JO1 A;  2ZT9 D;  1KFY C;  2WU5 D;  2K9Y A;  2D2C D;  3AE8 C;  2BEZ F;  3Q3D A;  2MKV A;  5KKZ C;  2E76 D;  3G9R A;  3O6Q A;  2WU2 D;  1S5L X;  1U57 A;  1EXJ A;  1KQG B;  3P4R D;  1YQ4 C;  3GF7 A;  1OW7 A;  1ZOY C;  3GLM A;  3AEA C;  2H89 C;  3VR8 C;  2E75 D;  1S1C X;  1KF6 C;  1NEN C;  3Q5S A;  1UIX A;  1QLB C;  1YQ3 C;  3AED D;  4GDO A;  4YTN C;  1RQU A;  2IDB A;  2ZT9 C;  4PV1 C;  1Q90 D;  3AE2 D;  4KX6 D;  1KTM A;  2BS4 C;  1MKM A;  3C8V A;  2QIW A;  2B76 C;  2WDQ C;  3P4Q D;  4H0L B;  1Y9B A;  4OGQ B;  1E7P C;  3GMA A;  1KF6 D;  4YT0 C;  2WSE J;  4YXD D;  4OGQ C;  1DIP A;  3AE5 C;  4YSZ D;  1ZRT E;  2WS3 C;  2WPV B;  3P4S D;  3VR8 D;  1DD4 A;  5C3J C;  3SFE D;  3AEG C;  1KOR A;  1FDI A;  1NEN D;  2WDR D;  2ZT9 B;  2WSC J;  4R4M A;  2WDQ D;  3SFD D;  3AE9 D;  3AEB D;  1K05 A;  1JB0 J;  3AE7 D;  3RK3 E;  3H25 A;  4YTM D;  4H44 B;  1DD3 A;  3AE1 C;  3AE7 C;  2FBW C;  1TU3 F;  2D2C C;  3AE8 D;  2BS2 C;  1KFY D;  2WU5 C;  1NGM B;  3P4Q C;  2WSF J;  1ZP0 C;  3IAO A;  4H44 D;  2WP9 D;  2P10 A;  4YTP D;  3P4S C;  1KMI Z;  1YQ4 D;  3P4R C;  1RQV A;  4H0L C;  2WS3 D;  4YSY C;  1GMJ A;  2QJY C;  2E74 B;  4U7J A;  4Y28 J;  5L8R J;  1VF5 D;  1AJY A;  1FDO A;  3CIR C;  3D6Z A;  2E75 B;  1HJ0 A;  2FBW D;  4H13 B;  2ACZ C;  1PL5 A;  2E74 D;  2E75 C;  2ACZ D;  1VF5 B;  3Q1M A;  3P4P C;  3VRB C;  3B71 A;  1R8E A;  1NYH A;  4I7Z C;  4XFJ A;  3ABV C;  1NEK D;  2V7Q J;  5M1B A;  2WDV C;  1OW6 A;  2YIU C;  1VL2 A;  4IL6 X;  2WDV D;  2O01 J;  3AEF C;  3AEC D;  3AE6 C;  4H13 C;  3LW5 J;  2H88 C;  2WU2 C;  4OGQ D;  1PV3 A;  2FXP A;  4YXD C;  4YTP C;  2WP9 C;  2FYN C;  1EXI A;  1ZOY D;  3VRA C;  2YMK A;  2D2C B;  4I7Z B;  3IN6 A;  3VR9 C;  3FGA D;  3AEG D;  3AE4 D;  4Z1M H;  3Q2Y A;  1NEK C;  2G3A A;  3AE5 D;  4YSZ C;  4YSX C;  4PV1 D;  1OMI A;  3AE1 D;  2WQY D;  4YT0 D;  2E74 C;  3AEC C;  1IK7 A;  3SFD C;  3AEF D;  3Q5P A;  3AEE D;  1ZME C;  3AEB C;  3AEE C;  3R4Y A;  1KIL E;  1ZP0 D;  3VRB D;  2OQQ A;  3GF3 A;  1HF9 A;  3Q5R A;  3ABV D;  3EWK A;  3D6Y A;  3AE3 D;  3AEA D;  3VRA D;  1OW8 A;  1PIX A;  2QJK C;  3AE9 C;  3AE3 C;  4H0L D;  2E76 B;  2H88 D;  3D71 A;  4H13 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...