4LDTA

The structure of h/ceotub1-ubiquitin aldehyde-ubch5b~ub
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
257
structure length
255
Chain Sequence
CLAYDEAIMAQQDRIQQEIAVQNPLVATLAPFSILCAEYDNETSAAFLSKATELSEVYGEIRYIRGDGNCFYRAILVGLIEIMLKDRARLEKFIASSRDWTRTLVELGFPDWTCTDFCDFFIEFLEKIHSGVHTEEAVYTILNDDGSANYILMFFRLITSAFLKQNSEEYAPFIDEGMTVAQYCEQEIEPMWKDADHLAINSLIKAAGTRVRIEYMDRTAAPNGGWHYDIPSDQIAPEITLLYRPGHYDVIYKKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase regulator
molecule keywords Ubiquitin thioesterase otubain-like
publication title E2 ubiquitin-conjugating enzymes regulate the deubiquitinating activity of OTUB1.
pubmed doi rcsb
source organism Homo sapiens
total genus 95
structure length 255
sequence length 257
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2013-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1300.20 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases 3 helical TM bundles of succinate and fumarate reductases 4ldtA02
3.30.200.60 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ldtA01
2ZFYA 4DDGA 4LDTA 4I6LA 4DHZA 4DHJA 3VONA 1TFFA 4DHIB 4DDIA 4FJVA
chains in the Genus database with same CATH superfamily
4F9AA 1Q62A 2HY81 3K54A 3O71A 2R0UA 2GQRA 2ZMCA 3FI3A 4QP7A 5CALA 4IC7A 4WNPA 1DI8A 2WQBA 4O22A 3U6HA 2OJIA 1WBPA 4K18A 4HVHA 1M2PA 1LPUA 4H58A 4J71A 1AD5A 5CNNA 4UEUA 2YEXA 5JEBA 3VRBD 4YTND 3VBQA 1FGIA 3QD0A 4U3YA 1VYZA 5LMAA 2ACZD 4YHFA 5B2MA 3TEIA 5EQYA 3VBTA 5HU3A 2WMVA 4YSMA 2WIPA 3P4SD 3DBQA 5GIOE 4M68A 2VV9A 1LP4A 3LFSA 4RLKA 2OJ9A 3B2WA 4V04A 3GCPA 4Y83A 5F95A 2RIOA 4ACDA 3MY1A 4AZSA 1ZOGA 3R7YA 2R3MA 4RVKA 2UUEA 4IWDA 3TYKA 2ITNA 4EJ7A 5HG8A 4FL2A 4AOTA 1FGKA 3QD4A 4BDFA 1PRYA 4R1YA 3A99A 5CF6A 1W7HA 1FPUA 2X8EA 4ZZMA 3HMMA 4LYNA 3TIYA 3P5KA 4BVUA 3G0FA 4E6QA 2EWAA 2ZDTA 4ANLA 2PZ5A 1G5SA 5J87A 4AGWA 4TYEA 3UNZA 3MBLA 5DT3A 1OBGA 2X2KA 2YWVA 3RK9A 2GSFA 4PF4A 3QA8A 4IAAA 4NKAA 4X2NA 5BVKA 2QG5A 3F3TA 1TQIA 3FMLA 4OTQA 3DKGA 1YOJA 2OGVA 3ALNA 1K2PA 5CAOA 2BKZA 3TUDA 3ROYA 4ACHA 3AEAD 1PYEA 4GKIA 5C4KA 3EN7A 4RVLA 2E2BA 3MFUA 1F5QA 4YTMC 3MIYA 3BIZA 4DN5A 2WU7A 3G2FA 1OITA 1WBNA 5DRBA 4AZVA 3D2KA 3AG9A 5K5XA 1GJOA 3DK7A 4FZFB 3UC4A 3VRZA 4XEYA 4U42A 4BJJB 3BEAA 4JQ8A 4E8AA 1L3RE 4YO4A 1YW2A 2QR7A 2X7OA 1XMLA 3WI6A 3V5TA 2HOGA 1TQPA 3L8XA 4DF3A 4OGRA 3AKLA 1FVTA 3PPJA 5CSWA 4ZSJA 3ORLA 3L9LA 4FNWA 3EN4A 5E8VA 4FJVA 3UZPA 4NT4A 5AP2A 4KAOA 2VGOA 4XG3A 4YZBA 3RPOA 3TZ9A 1M14A 4BDDA 3UO5A 3AC3A 3BV3A 2WQOA 1V0BA 2GTNA 3ACKA 3RM7A 5A14A 2OSCA 5JQ5A 3H9FA 3QUPA 3HEGA 3UVRA 5IDPA 3EH9A 3I5NA 2BALA 3TL8A 3AE2C 2R3NA 2HXQA 4AZTA 2H6DA 4BCFA 2YM6A 1YI3A 2FO0A 2QD9A 2CKPA 4F9WA 5JFVA 3IW5A 4YZMA 3QLGA 5DT4A 4UYNA 2R7BA 2C0IA 1B38A 3AT2A 3S1HA 1LUFA 3AE3C 5L6OA 4XBUA 4GSBA 2WD1A 5HCYA 5AP1A 5KMOA 5F94A 2R4BA 5EM6A 1L8TA 4K2RA 4RJ3A 2ERKA 2YDJA 4C2WA 3R6XA 1FOTA 3F2AA 3P0MA 2X39A 4ANBA 4G5PA 1URWA 3IS5A 5IA3A 3ORTA 4B6LA 4YTCA 5DR9A 3FYKX 5ITAA 3SOAA 3FV8A 3HMPA 3MVHA 5DHJA 5CTPA 4BCGA 3NMUF 2W1IA 3BBWA 2I40A 2NNWB 4MAOA 3UVPA 1DM2A 5KMMA 4A4LA 4YLLA 2A4LA 3P4QC 4IB1A 4C4JA 5C3JC 5KHWA 5E1EA 2G9XA 3HVCA 1H01A 2QC6A 2O8YA 2EXMA 2J9MA 1YHWA 2BDJA 3A7GA 3UDTA 3IECA 3WIGA 2W1CA 4RC3A 1OIYA 1W84A 4FE2A 4I5HA 5F1ZA 4QMSA 5HD4A 1JSVA 4G5JA 4RRVA 4MNEA 3QTQA 4ZK5A 4NW6A 4U41A 4DFUA 2PE2A 3OEZA 3PLSA 1WBOA 3DK3A 3FKNA 3SW7A 3MH0A 4QYGA 5C2TC 4N6YA 2XRUA 2VO6A 2O5KA 4BF2A 2YJRA 3R2YA 4MUQA 1KV1A 4QMNA 4L9IA 3C4CA 3SW4A 4JBOA 3OW3A 3W18A 2QOOA 3GQIA 3L8SA 1GZOA 4ID7A 4FKPA 4F7NA 3WZKA 3QC9A 3LFAA 1H0WA 4LL0A 2J0KA 1FVRA 2Z60A 4IWPA 4Q5EA 4YTFA 4FKIA 4XLVA 2FGIA 2VWZA 3DQXA 1OL5A 5I9VA 3LZBA 5IA0A 3JPVA 4KKEA 2WTDA 3KGAA 2WIHA 2WTJA 3R00A 5M09A 4U8ZA 2VO0A 4DE4A 2W5HA 4C4GA 3BYSA 4DH5A 3R2BA 1W98A 3L8PA 5CT7A 4HNIA 5E8ZA 4PTGA 1ND4A 1OIQA 3EL8A 1E1VA 2O0UA 3PJ1A 1YXVA 1CMKE 2Z7QA 3BYMA 3BRBA 3AT3A 3ZXZA 3DFAA 1WFCA 4BR3A 4O6LA 4FV9A 5IQCA 2XYUA 3UQFA 2JGZA 3UOJA 5A4TA 5HO8A 3P4PD 3O5AA 4C0TA 2ITWA 3GU6A 4FL1A 3AEGC 2XCHA 3D7TA 4FNYA 4TWOA 5DLSA 5B2LA 5HBHA 3SLSA 1REKA 4HPUE 4JG7A 5M51A 1ZLTA 4JBQA 4LGGA 1DAYA 3CIKA 3EKNA 1Y8GA 1E7PC 3AEBC 3VR9D 4AG8A 4C38A 4A9YA 3AC1A 1UWJA 3BU6A 4DA5A 2WOTA 4M97A 4YC6A 1JNKA 2IPXA 4QMYA 4CKJA 3VF9A 5KKRB 1PXIA 2GS6A 3FY0A 5J9ZA 1X8BA 2YM4A 3MVLA 3GGFA 3C4FA 2F7XE 1KF6D 2CDZA 3QD3A 4BCJA 1HCKA 4BBMA 2HW6A 3KCFA 2ETRA 3R21A 3CY3A 2WTWA 2XYNA 3AE8C 2W0JA 4QP9A 4I41A 3LCOA 5DOSA 5ANDA 4WNKA 4FTCA 3N4VA 3GU8A 4S34A 4GV1A 4O7WA 4UZDA 3SFDD 4YC8A 4QMLA 2UW5A 2VWVA 3ZMMA 4D28A 3IO7A 1YQJA 4GS6A 5HNGA 4MK0A 3FZTA 4PL5A 5FLFA 2VX0A 5AP4A 4NCTA 3QQFA 4ZSAA 2G2FA 3Q9WA 4IAKA 3ULIA 5J1VA 3U87A 3QL8A 4UZHA 2WFYA 2VWWA 4Z7HA 3NUXA 4IQ6A 4EK6A 5HG9A 2BS2C 4JDJA 4O0TA 2IZSA 3QFVA 4U43A 3QTSA 2QNJA 1GZ8A 4L00A 3CBLA 4NWMA 4RVMA 5DR2A 3EIDA 4CZTA 3R22A 3O7LB 2VO3A 2HCKA 3QCXA 3ZCLA 3MFTA 1PJKA 2VNWA 3ACJA 4OBOA 3IOPA 2OXXA 4I6BA 1YDSE 2ZV2A 3OWLA 2OJGA 2BZIB 5GNKA 4DITA 1VZOA 3LVPA 2GU8A 3PSDA 2BRMA 2X9EA 3Q6UA 2WU2C 4QNYA 4S31A 3PVBA 3RAWA 4FG8A 2C5YA 4BGGA 2WDQC 4YMJA 5AJQA 3COHA 5F9EA 2GS7A 3MFRA 3E7OA 3ORMA 5TT7A 3MVMA 5D10A 3ZDUA 5EDQA 4PP7A 3KULA 3FAAA 4K8AA 5DBXA 3W2SA 2GFCA 2FSOX 3HKOA 4B7TA 1J1BA 4FTAA 5DYJA 2J2IB 1SVHA 3Q32A 4RT7A 4GK4A 1ZRZA 4F9CA 4D0WA 1OUKA 2ZV9A 4USDA 2C4GA 5CU2A 2WTIA 4G3FA 3R73A 4M7IA 5FM3A 5DA3A 3AEDC 3JUHA 3PJ3A 5AP7A 2PMIA 1JQHA 2R0IA 5ANJA 5GHVA 5A46A 2H9VA 3LM5A 3O0GA 2XK4A 3OFMA 5C4LA 2JDTA 2OLCA 1PKDA 4IE9A 3CTHA 3IW7A 1XR1A 1PXPA 5CT0A 2XK6A 3K3IA 3AE9D 3G90X 3QCYA 4XHKB 3KXNA 3L9NA 4QYHA 2VTIA 3P86A 4TKSA 5FP6A 2JKMA 5FXRA 2NRYA 2VO7A 3BHUA 4FNZA 2IW9A 3TIZA 3GC7A 5AAFA 2UZTA 2WMRA 4PV0A 3HP5A 4XX9A 4AE9A 4ALUA 3GEQA 3PA5A 2IW6A 3EQRA 1F0QA 2PHKA 1NVQA 4IWOA 4FEWA 3TNPC 3HZTA 2CJMA 3NUUA 2ACZC 5J9LA 3TKHA 4RJ4A 4PNKA 4J95A 2GNHA 5I5ZA 2GCDA 1ZZ2A 3KEXA 4IAYA 4TL0A 4UX9A 1DS5A 4BCPA 2ONLA 2C5XA 1GZNA 3LHJA 3P4SC 4N0SA 4MVFA 3W2OA 4EC8A 2VTQA 3PJCA 3I4BA 3OG7A 3MESA 3FJQE 5DPVA 4O6EA 2YITA 3UBDA 5DRDA 5FTOA 3TI1A 4L53A 1JPAA 3E8EA 3HDNA 3UC3A 3WF7A 3ZONA 4JG8A 2OZOA 5M4IA 3R9DA 2V0DA 4WBOA 3AGMA 4CCUA 2JDVA 2BS4C 3IOKA 4FEUA 4A9UA 3DQWA 4BHZA 3GXLA 3VUKA 3QBNA 5K9IA 4MBLA 3PP1A 2VTOA 5M07A 4FTLA 1QMZA 2GNIA 3PUPA 1H08A 2PSQA 1JSUA 4RFZA 2E9UA 2I1MA 5JGBA 4WKQA 1MRYA 3NWWA 4NM0A 4OTHA 1R0EA 3FL4A 2BDFA 4BTJA 5AAEA 4ITJA 4F6SA 4BIEA 3ZZWA 3Q9XA 4HGEA 4C34A 2G01A 4KRDA 3ZO4A 4WG5A 5HVKA 3PXZA 4IX5A 4FTKA 4HNFA 4DG0E 5JGAA 3AECD 5KO1A 2P4IA 1OIRA 3ZC6A 4K6ZA 5EQEA 3BHVA 3I0OA 4QNAA 4WNMA 2GPHA 4X3FA 5T6KA 1OI9A 5EM8A 1JVPP 1YXUA 4GYGA 4UBAA 3RTPA 1Z5MA 3C5IA 3ZRLA 3ITZA 5C03A 4AFEA 4FG9A 4O21A 5T3QA 1TFFA 4QP1A 5JKGA 2HK5A 4USFA 3OF0A 2YCQA 4A9RA 4BC6A 5KX8A 4FSRA 4O7ZA 3WIKA 5A3XA 2FSTX 3U6IA 4JRNA 5G1XA 2C3KA 3FZSA 4WBBB 3I79A 4YJOA 2QOFA 3UDSA 3B8RA 4ARKA 2VTSA 4E4LA 4F0GA 1UKIA 4YTPC 4H36A 4OTFA 4YJUA 2OKRA 3GU4A 3OUNB 1KE6A 4U7ZA 2PVNA 5CVFA 3FPMA 3E7VA 3A8WA 4GCJA 2B9JA 4YLKA 4V05A 3MH3A 2YDIA 5CENA 1YQ4D 4LOPA 4C02A 3BU3A 2R3QA 3HRCA 3DS6A 2QG7A 5C27A 1G3NA 2VAGA 3CS9A 4YTMD 3ZSGA 2ITQA 3DXPA 3TUCA 5IQEA 3LLAA 4KKGA 4FTJA 4BCKA 3HA8A 3P79A 4FK6A 5CAPA 4F63A 2OK1A 4TYGA 3I60A 4BBEA 3QTUA 4F7SA 4RJ7A 5JZJA 4F7LA 5EI8A 3CQWA 5ETAA 4EI4A 5LJJA 3U4WA 1IAHA 2DYLA 1ZWSA 3HDMA 1NW1A 5BYYA 1Q8YA 5IPJA 1PMNA 2YISA 3QUEA 5FEQA 3ERKA 3BKBA 3KREA 5KMLA 2WMQA 4DYMA 5DGZA 5J8IA 5E90A 2UZLA 2BAQA 4YLJA 2R3FA 3G9NA 2IW8A 3GU7A 2VTHA 2YM8A 3QZFA 4AU8A 3UIXA 4RA4A 2W4KA 3T9IA 4HVDA 1KE9A 3BHTA 3O23A 2CNUA 3E3BX 2ZVAA 4R1VA 4ZOGA 4EL9A 5IF1A 3NW7A 2IWIA 3PJ8A 1CSNA 3PY3A 4FTIA 1NXKA 2QLUA 2ZB1A 1M7QA 5CSXA 3WF5A 4FIFA 4M8TA 4ZTHA 4AF3A 4ZLZA 4EYMA 3Q5IA 2J0LA 4I0SA 4HYHA 4LUDA 3O2MA 4BHNA 3KIOC 4RC2A 3S00A 4I92A 4FT7A 1DAWA 4WSYA 5EK7A 4EK5A 4O0RA 3PIYA 4DT8A 5KNJA 4RX8A 3RWQA 3ORKA 4A4XA 2VGPA 4LV8A 4X6QC 5AV0A 3ZFMA 5E9EA 4GU6A 1J91A 3ZO1A 5EYDA 4DGNA 3DB8A 3MS9A 5KUPA 3F7WA 1YI4A 4FEVA 5F4NA 3DZQA 2J5FA 5EKOA 3P4QD 5HHWA 4BCIA 5C3JD 3WARA 2CSNA 3BQCA 3PFQA 4WIHA 1RJBA 3Q4TA 5D11A 2PE1A 2PULA 2FBWD 4JS8A 3LW0A 2GHMA 3O51A 3QQGA 1OL7A 2BZKB 4JVGA 5TF9A 3MB7A 2HWOA 3MGYA 3QX4A 3QZGA 2WQMA 2RG6A 3PSCA 4FG7A 1OBDA 1XBBA 2F49A 3C51A 3DJ5A 3E3PA 3ORZA 4JIAA 3TV7A 4FYOA 2UZDA 3FKLA 2WMXA 1PYXA 3HNGA 4GW8A 4YSXD 5IUIA 3E63A 3E5AA 3QRJA 2OICA 4TYJA 4D2SA 4FTQA 3P4PC 3DFCB 3VS5A 3ET7A 4QT1A 1WVXA 3IW8A 2BRBA 2E9NA 2X7GA 4EUTA 2C1BA 5M57A 3S0OA 4F4PA 4WG4A 4DEGA 3PRFA 5EM7A 5HO7A 4NIFB 4BCNA 4O27B 4S30A 3HYHA 4P2KA 3WF8A 3F7ZA 4TYHA 4AT3A 2RGPA 4ZY6A 4GJ3A 4CFXA 3UIUA 4C3RA 4ZTLA 1KE5A 2CKOA 2WQEA 4C4EA 1UWHA 4HGSA 4EQCA 5T68A 2OIDA 5D7VA 5LCKA 3R71A 1SM2A 4X6RA 4TWNA 4AA4A 4BY9E 3HV3A 4IVAA 4S2ZA 2KTYA 4FKLA 4W4WA 5HE2A 5TR6A 4GU9A 3VS1A 4Z7GA 3ZM4A 1OMWA 3H9RA 3ORIA 1KF6C 5IA4A 5B7VA 5IU2A 3VNTA 4UWYA 3FWQA 4RSSA 4G2FA 3Q4UA 4PMTA 1YXXA 4QYYA 1STCE 4G3EA 4ZLOA 1XH8A 2CKEA 3BV2A 3OWKA 2WAJA 1LR4A 2ZOQA 5HGIA 4CFWA 3OY3A 4Q2AA 2CGUA 1B6CB 2C69A 4EHVA 3SFDC 4F0FA 3GCUA 4GMYA 1SVGA 1WBWA 2Y6MA 5KZ0A 2R3RA 3ATTA 3UIBA 3DBDA 4X2FA 5CQWA 3U8WA 3AEBD 1XH7A 2A1AB 4BZDA 3DDQA 1NT2A 3JR1A 3EWHA 4DG2E 1PMUA 3EMGA 4M14A 5HEZA 3MSSA 4MXXA 4FV8A 3E92A 4U40A 2QVSE 3KU2A 3AC8A 4J97A 2V7OA 3QHRA 4PMPA 5IQAA 4XV9A 5AUXA 1OL2A 2XIXA 3E8CA 2XF0A 5CNOA 3WZJA 5LWNA 1V0OA 4O0YA 3ANRA 4AZFA 4HVGA 3M2WA 3COKA 5BVDA 1FBNA 4NZWB 1LEZA 2PMLX 4NSTA 3RK5A 3NYVA 4G31A 4JAIA 4EOQA 3CY2A 4JNWA 4D9TA 2GNFA 4GT3A 4AFJA 4HCUA 4WNOA 3DKOA 4ZTRA 4FSTA 4AW0A 4Y5HA 2GHLA 3CJGA 4XV3A 3IONA 4XS2A 5JZNA 4IDVA 3HLLA 4BIDA 3BCEA 2QCSA 3QRKA 4NJDA 5FEEA 3TV6A 4ZY4A 3DDPA 2Z02A 3AQVA 4F1MA 4JDKA 4C62A 4CT1A 3W0NA 3RPRA 4NFNA 2G2HA 3OHTA 2PPQA 4D1XA 3BQRA 4PUZA 4FL3A 4DAWA 2VTLA 3PFYA 3W2RA 4E4NA 4IM2A 3I7CA 3PUFC 1YVJA 4LUEA 5EYCA 3V5WA 5IH5A 3PXRA 2X4ZA 4FT3A 3PY1A 3CJFA 4OUCA 3KMMA 4E4MA 2XBAA 3RGFA 1QL6A 3MN3A 4DHFA 2WTVA 4TNBA 3QC4A 3I0QA 4CEGA 1IA9A 4MQ2A 3E88A 3GFWA 3W10A 2UZBA 4O7VA 2UW6A 1ZYCA 2YM3A 3NFFB 4RQVA 4WOVA 4XP0A 5JH6A 5H8GA 3Q4CA 5HX6A 3QQKA 4FTOA 3W8QA 4G17A 4CV9A 4FUXA 2DQ7X 2WDQD 2OFVA 2XBJA 3D5UA 4E6DA 4FTNA 3KF4A 4DEIA 2HELA 4LM5A 4ACMA 3R9OA 4FIJA 4XNEA 1S9IA 4QTCA 2XKFA 4TYIA 4BJJA 4XP3A 3TG1A 4YSJA 3IDPA 3DCVA 4YNEA 3R8PA 1OVEA 1GZKA 4DGOA 3KFAA 4WHZA 3AEDD 5HKMA 4OBQA 3C5UA 3QA0A 3VS0A 2YIYA 1U54B 2WTKC 1P4OA 2ETMA 1BLXA 2PVJA 2C0TA 3IGOA 4XP2A 3CXWA 5M06A 1O6YA 2X1NA 2OIBA 1ZOYD 1G8KA 3AC2A 3NX8A 4FKSA 3OCGA 3FI4A 4EUUA 2W1HA 3QRTA 4RWIA 4UWCA 4M67A 4BDIA 1W0XC 3NUSA 4JOAA 3FXXA 4I6QA 2PZYA 3DT1A 4O86A 3UJGA 3PXKA 4O0SA 1Y91A 3MJ1A 2PVMA 3QZIA 1QPEA 2XIZA 3G6HA 1XHAA 4NTTA 2WTCA 4RIWB 2JKOA 3S95A 2OJFE 3OWJA 4XCUA 1T46A 3AECC 2VTNA 4RIOA 3LFNA 2PZIA 1A9UA 2YA9A 3FC1X 4AW5A 4DG3E 3Q9YA 2CN5A 4IAFA 1R78A 4QMUA 3ZM9A 4AXEA 5JFXA 1V1KA 3FLQA 4L46A 4D4YA 1Z9XA 3BZ3A 3QQUA 4GH2A 3NGAA 3WBLA 3KN6A 4BCQA 2PE0A 2W9ZB 3C0HA 3EOCA 3ZOSA 5CEQA 4EK8A 3GOKA 4G1WA 4AXFA 3W32A 1YHSA 4J98A 2WQYD 3W0PA 1T45A 3ODZX 4EQMA 2IJMA 5JMSA 4R3PA 4DT9A 2F2UA 2WS3D 2W1GA 3AXWA 2REIA 4NKSA 4QTBA 5CVGA 3FMJA 4JR3A 1MRVA 2B0QA 3P1AA 2WMAA 5CEKA 3UDZA 3FI8A 2GTMA 4RX9A 2GDOA 3U51A 4FSUA 3P5JC 3U9CA 4AX8A 2EUFB 4AW1A 2J4ZA 4IJ9A 1YQ4C 3TJCA 3R8VA 2PUPA 4MX9A 3V6RA 5LMBA 4APPA 1Q8TA 3FL5A 5EW3A 4FV5A 2UZEA 4EZ5A 2XNBA 4EJNA 3EQCA 2VWIA 4E7WA 5ANEA 4YTIA 5D9HA 5AMNA 3BHHA 3ZLXA 3FLSA 4IFGA 4JXFA 5ANGA 3SKCA 4RMZA 1YQ3D 1TQMA 2YIWA 3EN9A 2OF2A 4FGRA 5E91A 4AGUA 3LJ1A 4DEHA 2QOIA 2P33A 4FSZA 3AD5A 5CS6A 2X6DA 5E1SA 3U6JA 3VW6A 3LKMA 2C68A 5IMXA 3Q53A 1J3HA 3NIEA 5HTBA 2QOLA 4R78A 4W8DA 2WDRD 5EFQA 4CLIA 5AV1A 2ZJWA 4H3BA 1R3CA 5HD7A 4IB0A 4YTPD 3LMGA 2J50A 4FKTA 3C9WA 4NH1A 2VTMA 5M53A 4BDKA 4FK3A 2BIYA 3CLYA 3LMHA 2F57A 2NO3A 4PL4A 5C8NA 4PRJA 5IA2A 3EJ1A 2VWYA 2XIKA 3P7CA 5A6NA 3QWJA 2I0HA 3R0TA 2UZWE 3Q9ZA 4GFGA 5A4EA 5LVOA 4L6QA 5D7AA 5HE0A 1B39A 4FVPA 3FMEA 3VUIA 5J7HA 5IQIA 1OM1A 2XUUA 2XP2A 2Z7RA 1OB3A 3QUDA 4M84A 4ITHA 4NFMA 1CKJA 4DH1A 3TTIA 1BKXA 1QPCA 2O2UA 4XMOA 2OXDA 3W0RA 2WB8A 1GIHA 5CAQA 5JQ8A 4QP6A 2ITVA 2PYWA 2R64A 1KWPA 2R3OA 3BLRA 2RF9A 3R9RA 4I6HA 5L8LA 3UPZA 3I81A 2H89D 4FKOA 2VTTA 5KBRA 2YACA 2PUIA 2VTRA 3FYJX 4WG3A 1PHKA 1H1SA 1OGYA 3NR9A 1J7LA 3O17A 3PWDA 5DE2A 3NIZA 4CVAA 5I9WA 1UVRA 4L52A 3NW5A 3HECA 2BPMA 2W7XA 2WHBA 5IUHA 5EHLA 1KOBA 3D5VA 4FTMA 4E73A 2BHHA 3MFSA 5ACBC 4IVCA 1WAKA 3C1XA 2IG7A 5E8WA 5ETFA 4F09A 1WBVA 4GFOA 4HZRA 3UIMA 4R3CA 4O7LA 4EHGA 2C1AA 3PXQA 3CP9A 3EZRA 4KIQA 1SMHA 1OL6A 3IQ7A 4WT6A 2FBWC 3R8UA 4DINA 3ORPA 5HBJA 4W4VA 3AT4A 4UYAA 3V04A 1JLUE 3FQHA 4LGHA 2DUVA 3G9LX 4C36A 3D2IA 5JRSA 5LARA 3GCQA 4EH3A 2JFMA 3KRWA 2JDOA 4YSXC 4AA0A 1REJA 5CF8A 4QMQA 4IB3A 5HCZA 3NYNA 4AS0A 5KE0A 2XARA 3LMIA 3TKUA 3C4EA 3KRRA 3BL9A 3BWFA 2B53A 2BFXA 4R77A 1M17A 3IW4A 5L2IA 4ZSLA 1G8SA 5KMJA 3TACA 3R30A 2XIRA 3Q2JA 4DH7A 5H8BA 1SNXA 2YFXA 4N4SA 2GMXA 4IVBA 5FM2A 3BL7A 3HX4A 3QGYA 4C33A 3PVGA 4I1ZA 4I24A 4YZCA 3TT0A 3OP5A 3OZ6A 4C3PA 4DHJA 2CN8A 3CGFA 1KE8A 2QKWB 2VWBA 3D7ZA 3D94A 2BCJA 3OBGA 4KNBA 4DCAA 2IVVA 2UW7A 2R3KA 4AOIA 1JKLA 2VNYA 3VUMA 5BUIA 4A06A 2CCHA 4RG0A 1J7UA 4E1ZA 3KXHA 4BYJA 3NYOA 3CE3A 3A8XA 2C6IA 5AUWA 5ACKA 3MPAA 3NPCA 3KC3A 4FSMA 1V0PA 4J8MA 2G1TA 2YM7A 3F6XA 1Q8ZA 4QYEA 2LAVA 2QO9A 3BBTB 5HCXA 4M12A 3DAJA 3EQPA 3SG8A 3D0EA 3RK7A 3F88A 4DH8A 4J52A 4ZTMA 1ZYDA 3ZRKA 2BRNA 2JKQA 4JDIA 3PVUA 3VS4A 4CMTA 5IEVA 2JFLA 3UOHA 2EB2A 4C61A 4A7CA 4ZJVA 3F9NA 1OUYA 4RIYB 4UV0A 2VTPA 1XQZA 3LXNA 4C2VA 2W9FB 4FZDB 1FMOE 4L42A 3L9PA 2VTAA 3NUYA 1O6KA 3PA3A 3VS3A 4E6AA 2Q83A 4IACA 2I0EA 3DLSA 5DT0A 4F64A 3SOCA 5BVNA 4K77A 1UNHA 5IISA 2J51A 2WMSA 4HGTA 3UGCA 3ZS5A 4ASDA 4AAYA 1ZOHA 4XG8A 4BTMA 2WZJA 4F78A 4RLLA 1Q3WA 3FQEA 3G15A 5JRQA 3MPMA 2XZSA 3V8TA 2BILB 2F7EE 3JVSA 4ASEA 3DNDA 3A62A 4FX3A 4V0GB 5AP6A 5JK3A 4I6FA 4L3PA 3EQHA 2X81A 5BMMA 4IM0A 2ZV8A 3HV7A 4GUEA 2ITXA 3ZDIA 1K3AA 2XKEA 4AZEA 4QP4A 4F6WA 1ZYJA 3OXIA 3AE6D 1XKKA 3ANQA 3U54A 4AXAA 2YN8A 3NVMB 3PWYA 1PXKA 2O3PA 3DBCA 4X7QA 4AN9A 2HZ4A 3H10A 4ZZNA 1CM8A 2W5BA 2WU6A 2XEZA 4OTRA 5HLWA 3FHRA 5DFPA 3KK8A 4YJVA 3EL7A 4QMXA 4AA5A 2UV2A 4BTKA 3NCGA 2XKDA 1M52A 3I1AA 5CAVA 1VR2A 3PDTA 4U79A 3T3UA 3VWAA 5BVFA 3AOXA 4Q9ZA 1NVSA 3LQ5A 4ALVA 4M13A 5IA1A 4EK3A 4DEEA 5BYZA 4YSZD 2AC5A 2XK8A 4QO9A 2XNPA 2IZUA 4PX6A 2JBPA 4AN2A 3VQUA 4MD7E 2R2PA 3E93A 5AIKA 5FBOA 3NYXA 3WF6A 2BZJA 4ZTSA 2Y4PA 2XM8A 4FSQA 2WTKB 2CGWA 3ZUUA 3VRAD 4BCMA 5IMEA 4JL9A 4MH7A 5DEWA 2C3IB 4RX7A 2V5QA 3C0IA 3EFJA 4FR4A 3FKOA 3QKLA 3GCVA 1Q97A 3HP2A 3PP0A 3R1NA 5G6VA 5GJFA 3D14A 2UW9A 3LE6A 5AAGA 4JMQA 3NAYA 3K2LA 4FEQA 1U46A 4D4SA 5CZHA 2YAKA 4RC4A 3HA6A 2OWBA 4EH4A 2XJ2A 3QRUA 4QOXA 4FZAB 1ZY5A 3V5LA 3ZBXA 4Y5QA 3FXWA 1ZYSA 4DGGA 5HE3A 2B55A 4MXAA 1OKWA 3QKMA 4D5KA 4TTHB 4K1BA 2B52A 2QHNA 1UKHA 5K5NA 1EH4A 3O8TA 2O65A 3N51A 5CEMA 5IH4A 3SHEA 4CCBA 4GVJA 5ANOA 3KXMA 3SC1A 4YSYC 2OXYA 1ZOYC 2JAMA 3TDWA 4FOBA 2RFEA 2UZNA 3TV4A 1XBCA 3LCKA 3MJ2A 4CFFA 1CTPE 2CLQA 3I6UA 4E20A 4IH8A 4YXDD 2PVKA 4IC8A 4I0TA 3NUAA 3D15A 4BGQA 4AZWA 3PXFA 2QU6A 4TW9A 4KA3A 1SNUA 3FLNC 4H39A 2H34A 3GUBA 5GJDA 5GINE 4U3ZA 1RE8A 3EFWA 2WGJA 2XALA 3QTIA 3R7IA 4QMOA 1U5QA 5ICPA 3GI3A 4G6OA 1H0VA 3IK3A 3A7IA 4UWBA 4QYFA 4AACA 5KMKA 3SVVA 5BPYA 4CMUA 3ORNA 4JBPA 1MUOA 5IEYA 5J1WA 4WUAA 3BLHA 5EM5A 2WQYC 4CFMA 3NLBA 4FV1A 1BYGA 2J6MA 4L01A 3KRJA 3MV5A 3S3IA 2F7ZE 2WS3C 5E8XA 4HPTE 2C30A 3VS6A 2FYSA 1DI9A 3QF9A 4P5QA 4N57A 3U9NA 5I0BA 4QPSA 3F66A 5H3QA 4BICA 4JJRA 4R7BA 3LCTA 3AE4D 1XH4A 2PVHA 2GNJA 3NDMA 2B9HA 2AEGA 4FMQA 4EORA 4RWLA 3ZYAA 4LRMA 2YZLA 5I9YA 2YERA 5AEPA 3EHAA 2VU3A 3LM0A 1A06A 4B4LA 4DFZE 2YJSA 5D1JA 4LV5A 1IEPA 4MQ1A 2B7AA 5L2WA 3KRXA 1YQ3C 4U97A 4FT9A 2AUHA 3M11A 2EU9A 3RAKA 3UP2A 3PG1A 3NUPA 3QYZA 3ZRMA 4GK3A 3UPXA 1JWHA 1ATPE 2PU8A 2WMWA 4YPSA 4I94A 2QOQA 2XM9A 4YBKA 2WDRC 3P4KA 3F5XA 4HYIA 5DNRA 1UA2A 3DTCA 3SX9A 1ERKA 3KN5A 2GNGA 2HY0A 3VW8A 5A6OA 4IVDA 2O64A 2BUJA 2OJJA 3LJ0A 2BTRA 3DXNA 2JDRA 2J5EA 1I44A 3CSVA 3FZOA 3GC8A 2XNGA 4FKGA 2C3LA 3AE7C 3F3VA 3QGWA 3P9JA 2JLDA 3H0YA 4HCTA 2CHLA 4GYIA 4I5CA 5AX9A 4MTAA 3NSZA 3PA4A 4C35A 2CKQA 3ABVD 4QMPA 4Y73A 3OTUA 5E8SA 2RKUA 4BDEA 4KX6C 4LOQA 4YURA 2PUNA 4M69B 3O50A 4Q5HA 2RFNA 2BAJA 4ACCA 1ZZLA 4FVQA 5CI6A 5EOLA 4EH2A 2H89C 3PE2A 5M08A 1PW2A 4EZ3A 2P2IA 3LQ3A 3LFFA 1YWNA 1XWSA 3F5UA 2BVAA 2PK9A 3OXZA 5HBEA 3D5WA 2X0GA 3T9TA 1BUHA 4GIIA 3LCSA 2BRGA 2UW0A 5CSPA 2J0JA 3PZEA 4BGHA 5A4CA 5LMKC 4FIIA 3LQ8A 3IDCA 4G3GA 4LMNA 3RINA 2B9IA 4AQKA 1M7NA 4EC9A 3UG1A 4F1TA 2JD5A 4UXLA 4X0MA 2C6EA 4W4XA 4HVSA 4UN0C 1KUTA 4MHAA 4Y72A 5ETIA 3UODA 3IKAA 2V7AA 3PSBA 3UQGA 3E62A 3OOGA 4DGMA 3KF7A 3UNKA 4ZJJA 4RZVA 2UVYA 2JIUA 1A48A 5FD2A 3CD3A 2Y0AA 1Y57A 3PIXA 4P4CA 5H9BA 1L0VD 5HU9A 3DY7A 4QTEA 3GC0A 2NPQA 4II5A 4OTWA 3R8MA 3FSFA 3ZEWA 3TNWA 2ESMA 3KRLA 2CCIA 1YDRE 4MXZA 4AWIA 4EHZA 1IASA 2ITUA 4EH9A 2HENA 3PVWA 2H88C 5AUVA 5L6WL 4FA2A 4GG5A 1FMKA 5M56A 5IA5A 2ZM1A 2C3JA 3QTXA 1PY5A 5TOZA 3HV4A 4GIHA 3QU0A 5I9XA 4RJ6A 3LFQA 3GOPA 5ANIA 4O7SA 3ORXA 3BE2A 4H3QA 2A0CX 4XG2A 3R04A 3SGCA 4L3JA 3RAIA 2ZB0A 3R1SA 4G9CA 2C5VA 3DLZA 3II5A 4LRKA 5EQPA 3OS3A 4WO5A 4PMSA 4TWPA 4IHPA 4JT3A 4FUYA 1JBPE 4IWQA 1Q8UA 4QMMA 4D1ZA 4FTRA 4L67A 3OD6X 1H4LA 5DH3A 3MW1A 1H8FA 2GFSA 3HRFA 2Y7JA 4HGLA 2KULA 3GBZA 3QXPA 4YNOA 4EOMA 2QOKA 2QOHA 3K5VA 2BR1A 3NNXA 3PXYA 3ETAA 4FSYA 4GT4A 4PDYA 4FC0A 4DEAA 3RPSA 2WEVA 2CPKE 3F5PA 1H1RA 2OFUA 2W4JA 2YCRA 4NL0A 3AC5A 2VD5A 4IB5A 5AUUA 2UZVA 4LI5A 3V5QA 4OTDA 5HLNA 3MIAA 5AP3A 2FB8A 3PZHA 1UU3A 5HVJA 4CTCA 4BDBA 2QOBA 3QTZA 1H1QA 4QP8A 3MA6A 1Q4LA 4KIOA 4YU2A 1WMKA 3O8PA 5AM7A 5J5SA 3A61A 5M55A 4ENXA 2HIWA 4IX6A 3OXTA 3TJDA 2BIKB 4X2KA 4IM3A 4O91A 3VC4A 1VYWA 4OT6A 4BB4A 4CKIA 1E1XA 3O96A 1ZY4A 4RVTA 3IPHA 5EW8A 3IW6A 3RHXA 3DXQA 3QWKA 4L7FA 3SXFA 2XS0A 3MTLA 1IA8A 2JIVA 2WKMA 3A7HA 1S9JA 2QHMA 5HNBA 5EG3A 4TNDA 4DFXE 1SYKA 4KRCA 3ZLYA 4JDHA 4DH3A 3SFED 2C6OA 2GHGA 4LMUA 3SDJA 2RFSA 3T3VA 1U54A 3AE6C 1UV5A 2PVFA 4AP7A 4IAIA 1O6LA 2A2AA 1KSWA 2FSMX 4FBXA 4QEBA 2Z7LA 4KBAA 4QDVA 3UG2A 3QTWA 1PXJA 3A7FA 4YP8A 3PE1A 1XBAA 2P55A 4PNIA 3C4ZA 1IRKA 4K11A 2V62A 2W1EA 4UXQA 5CXHA 3OCBA 4C58A 4EWQA 2PWLA 4ALWA 5CU0A 5L2SA 1Q99A 2BDWA 3EQIA 4IBMA 3ZXTA 4BN1A 4S33A 4O7TA 4K0YA 2P2HA 4YSZC 3BE9A 4RIWA 4RZWA 2C0OA 2YHVA 2ZDUA 5J95A 4RGJA 1PXNA 3VS7A 4F65A 3GNIB 3ATSA 3R9HA 2CGXA 3CPCA 2IVUA 1PMEA 3I5ZA 3POZA 4F9BA 5M4UA 3RI1A 4FIHA 4FTTA 3VRAC 5CEOA 4DLJA 3JY0A 3GFEA 3GVUA 1XH5A 4Z9LA 1TVOA 3R8LA 4EOSA 2XANA 4IZAA 3R7EA 4AXCA 4X2GA 5EYKA 5DN3A 2XMYA 4O84A 5EH0A 5KZIA 4ITIA 2OBJA 2R3IA 4YHTA 3VULA 2OF4A 3FE3A 3Q4ZA 2ZMDA 3VO3A 3MYGA 4OTIA 5KHXA 5L8KA 4J99A 3QCSA 5EYMA 3L1SA 3R9NA 1ZP0D 3BYOA 3UTOA 4ORKA 2WNTA 2ACXA 3S2PA 4XLIA 4Y95A 4D55A 4EWHA 3UVQA 4IMYA 3UMWA 2PVYA 3P78A 4NM7A 2WMUA 3VR8C 1YWRA 2YIRA 5ANKA 3VBXA 4EOJA 3R1QA 4BCOA 4G16A 1XO2B 2XNMA 4GVAA 4RQKA 5HE1A 4XG9A 3BWJA 2VTJA 5BMSA 2NRUA 3KCKA 4YXDC 4IANA 2DS1A 2R3HA 4O7RA 2ZM3A 3VHEA 5AP0A 1M2RA 1KFYC 4TWCA 1H28A 3DTWA 3P7BA 4OBPA 3TTJA 3DZOA 3OBJA 3QYWA 4FZ7A 3QD2B 5C1QB 1CKPA 5CF5A 3TUBA 2W17A 4ANQA 2B9FA 3IG7A 2JDSA 4FV3A 3FLYA 2W99B 4D2RA 4I23A 4DBNA 1F3MC 3TN8A 4RIXB 4E5AX 1OPKA 3FLZA 2WPAA 2Q0NA 3MTFA 1GIJA 1QPDA 3DPKA 2X9FA 4X3JA 3TCPA 3HV6A 1ST0A 3BX5A 4FT0A 2QLQA 5A54A 4EH8A 3AMBA 4YSYD 4IADA 2ZFYA 3EN6A 3EQDA 3AD4A 3V3VA 4CMOA 5IQDA 3F5GA 1OPJA 3A2CA 3LIJA 4MCVA 3RKBA 4OW8A 5AUYA 2BROA 4B99A 3C0GA 5JSMA 1OKVA 2OZAB 4YBJA 3AE4C 2XK7A 4I20A 3WYXA 5CX9A 4BKJA 5I9UA 5IQGA 4R5YA 3AKKA 1NEKD 4FKWA 3NW6A 5CU4A 3RMFA 3CCNA 5HVYA 3VAPA 5FXSA 3DOGA 5LVMA 1WCCA 3CPBA 5CF4A 3SA0A 3DB6A 2ZYBA 3W0OA 4XG7A 4CG8A 1QLBC 4XOZA 2VZ6A 2CNQA 2C47A 5DG5A 3C4WA 3GP0A 4LDTA 3BGZA 4MWIA 3AEED 2H96A 5LVNA 4AXDA 3H0ZA 3HAMA 1RQQA 3KA0A 3W0MA 5C9CA 5JT2A 3VIDA 5HIDA 2NYAA 2UW8A 1WVWA 4NUSA 4HYSA 1MRUA 1YOMA 4MXOA 2QI8A 3SAYA 2WEIA 3AE5C 2JC6A 5AFVA 1GOLA 3ZO2A 3V01A 4CGAA 1OKYA 4BDJA 3SD0A 4KS8A 2OU7A 3ZFXA 2QQ7A 5FGKA 3UNJA 3ZC5A 4NTSA 2W96B 4L45A 4XV2A 2BHEA 4P5ZA 4Y8DA 5JFSA 4PP9A 2QO7A 3FZ1A 4KBKA 4K9YA 4E4XA 5EDRA 4EOPA 2W1ZA 3W8LA 4YHJA 2OW3A 3PIZA 3ABVC 2XJ1A 2ETKA 4B8LA 1U4DA 3NRMA 3FZRA 3RAHA 1BL6A 1H26A 1YOLA 5GJGA 2CLXA 2ITYA 4JG6A 4F7JA 4U5JA 4QQTA 2X2MA 4ASXA 4RX5A 3PPKA 4FSNA 3NFGB 4I5MA 4LFIA 1NY3A 2GNLA 4C7TA 4LOOA 3HV5A 3VN9A 2W05A 5AM6A 1JKSA 2BTSA 3DJ6A 1BI8A 3CIRD 1H25A 1PF8A 1R0PA 4ZMFA 5A4LA 5C8KA 4YJQA 2UW3A 3PLAE 5DR6A 2C6MA 3CC6A 4R7IA 2P3GX 2EB3A 4NCTC 2VX3A 3SRVB 3E8DA 3OTVA 4MF1A 1Q3DA 2IO6A 4D58A 3F3ZA 3VUGA 3DJ7A 3VVHA 3ZHPC 3AE7D 2X2LA 1FVVA 3ROCA 2EVAA 4CG9A 4DTAA 1W8CA 1UNLA 3POOA 4IX3A 2HZ0A 3WZDA 3NNVA 5K4JA 3F69A 4YJNA 1XH9A 3UYTA 1YWVA 3W16A 4RFMA 2WMBA 4KX6D 3FMKA 3RPVA 4YTHA 5DEYA 4O7YA 3OEFX 4CSVA 3EYHA 4QMTA 5HIBA 3COMA 2YIQA 1Q5KA 3FPQA 2WQNA 3DBFA 2XRWA 2WELA 3HL7A 1ZMWA 2GQGA 3FZPA 3P08A 1L0VC 4RIYA 2IZTA 2PZRA 2ITTA 5DI1A 4XOYA 5HG7A 3WOWA 5AUTA 1NEND 3KL8A 3W2CA 5D12A 5JGDA 4CNHA 3F3WA 4XUFA 1TKIA 5I4NA 2B54A 2J0MB 2JKKA 2P0CA 3K3JA 3LFEA 5CYIA 4E26A 2XCKA 4FIEA 1I09A 3LOKA 3Q3BA 3C7QA 4GG7A 1Y8YA 2WP9D 5M4CA 1LEWA 5HI2A 4L7SA 1ZARA 3RNYA 3UMXA 4EH6A 5CXZA 4B0GA 3LAUA 3VUHA 4XJ0A 2BZHB 3FMHA 4EOKA 3OMVA 4V0GA 4E5BA 1NVRA 4GUBA 1APME 4O81A 3TZ8A 1ZXEA 4G6NA 4ONAA 3BYUA 2XIYA 3QX2A 4QP3A 4D5HA 3H9OA 3E87A 3V8WA 3R7UA 3AEFD 3BI6A 5E8TA 3UZTA 3A4OX 2R3PA 3LLTA 3LXPA 4FZ6A 3Q60A 1H00A 4JLCA 4RBLA 4DTBA 4HJOA 4ZY5A 1H07A 4XH6A 4M3QA 4N6ZA 5IDNA 3F3UA 2R5TA 2Y8OA 3QQJA 4W8EA 2WOUA 3SG9A 4DHZA 2XAOA 4LG4A 1PXOA 3UYSA 1BL7A 4IIRA 4MD9E 2H88D 4L43A 3EFKA 3VS2A 4BIBA 5E92A 2XNNA 4G3CA 4FVRA 4A4OA 2ONLC 2J7TA 2C6DA 2ERZE 4H1MA 5LVLA 4FEXA 4BZNA 4ANSA 4G9RA 3HAVA 4IAZA 3UOKA 4AGDA 2PVRA 4FKUA 4JX7A 4X21A 4CFNA 4EOLA 2RFDA 2CNVA 2A27A 4MXYA 4FKRA 1WZYA 4EK4A 3BELA 3DNEA 3AE1D 4WRGA 3SV0A 4FT5A 4W4YA 4CFVA 3EN5A 2RL5A 1J1CA 4U9AA 3QXOA 1OECA 4PDPA 4ZLYA 5FTGA 4UALA 5E8UA 1JAMA 3PTGA 3F2RA 2OH4A 2B1PA 5K3YA 4ERKA 4FODA 2YCFA 2UZUE 3DKFA 5CY3A 5KMNA 4EEVA 3SFEC 2G2IA 1MQ4A 2UVZA 4KS7A 4O0WA 4AW2A 4JQ7A 4D4VA 5A4QA 4I6LA 3THBA 3EQBA 4KSQA 5IG1A 4IW0A 3AD6A 4YJTA 3R7VA 2Y4IC 3NZ0A 4X3FC 3FI2A 4PY1A 3HMOA 3R1YA 2PUUA 2HZIA 3BGQA 4NM3A 4QQCA 5CU6A 4YT0D 3KXXA 1OPLA 3NNWA 4CT2A 2WDVD 4XRJA 4Y85A 3FMDA 3FXZA 4HVIA 4MD8E 5CQUA 3LFCA 3DAKA 4ZEGA 4A9TA 2Z8CA 3T8OA 4E6CA 3GENA 5HTCA 3NVKI 3VHKA 3LPBA 3RHKA 1UU8A 3N9XA 2QOCA 2W5AA 3R01A 3KB7A 2WU5D 4DEBA 4LRJA 4RFYA 4R7HA 2YDKA 4KABA 4FSWA 4ZP5A 3MDYA 4YZDA 4RWKA 4HZSA 5AA8A 2VWUA 5FQDC 4PDOA 3OCTA 4JIKA 5CWZA 3Q6WA 5CZIA 1UU7A 2E9VA 3RJCA 3GQLA 4BTFA 1OGUA 4MWHA 4R5SA 1UU9A 5EHOA 4DFBA 3K5UA 4FI1A 4D4RA 2PY3A 4JBVA 3HRBA 4FKJA 5AUZA 4F9YA 1ZP0C 5CSVA 1OZ1A 2PZPA 4CXAA 4BBFA 1KE7A 5H8EA 4J96A 4WRSA 1H24A 3REPA 4HCVA 2YIXA 4I21A 1R39A 2DWBA 3PG3A 4GRBA 2XNEA 3G0EA 4BRXA 5BV3A 4EH5A 2ZV7A 4FKVA 3RCJA 5IEXA 3P4RC 4TT7A 4MNEB 3ZLWA 4O0VA 5JN2A 1Q8WA 1FINA 5C8MA 2JEDA 4I93A 4OT5A 3DAEA 3MY0A 4J53A 4FICA 1H1PA 4JI9A 4RPVA 3OROA 3VF8A 4KSPA 4BZOA 4GT5A 4N70A 1OIUA 2XEYA 4J1RA 2OG8A 4E5WA 4E93A 3F61A 3B8QA 1H1WA 3GT8A 5EKNA 4LL5A 3W2PA 1MP8A 3JYAA 2A19B 1YKRA 3LJ2A 2WXVA 4O7NA 4BI1A 1JOWB 2F4JA 2B76D 2YWPA 3RWPA 3BPRA 1AGWA 3DK6A 1ST4A 5CAUA 1WVYA 1YHVA 3QKKA 3V6SA 4F08A 2IN6A 5DIAA 5A9UA 1FQ1B 1BI7A 2YAAA 3W0QA 5LWMA 3FEGA 3VR8D 5FUTA 4I4EA 1IR3A 2VN9A 4DGLC 4HOKA 4O0XA 3SXRA 4GFMA 2BMCA 4QRCA 3JXWA 3Q5ZA 3OCSA 1ZAOA 4FV6A 1P4FA 2O63A 2X4FA 4HYUA 3FUPA 4OR5A 4U45A 3ZUTA 4Z3VA 5DWRA 4EYJA 4TY1A 5IQFA 3UO6A 2B4SB 4FV2A 3PJ2A 2PMNX 4PTCA 1KFYD 4O0UA 2QURA 4DDGA 3D7TB 5HIEA 1NEKC 4WA9A 4ZSEA 2NP8A 2VUWA 3M42A 5CVHA 4M0ZA 3I6WA 4MXCA 3GCSA 3OC1A 4G34A 2YABA 1J7IA 3H30A 2PL0A 1OL1A 4K33A 3OY1A 1Q24A 4I4FA 2GS2A 3EZVA 3N4TA 3MWUA 4YR8A 5CASA 2IZRA 3ZEPA 3GC9A 3ZU7A 3AEEC 5AADA 2C6TA 4WD5A 3H4JA 4YTNC 3VRBC 4MYGA 4QQJA 4A07A 1ZOEA 1Q41A 4PTEA 5HNIX 2C5NA 2XK3A 3O7LD 5LCJA 1U59A 3OT8A 4PMMA 4PQNA 5H2UA 4GEOA 2R3JA 1WBTA 3LXLA 5L2TA 5JFWA 5AV3A 1RDQE 1U5RA 4H05A 2JIIA 4JR7A 3W1FA 3TWJA 1W83A 3AMYA 3HGKA 5ETCA 3PPZA 2UVXA 4YO6A 3ZSIA 2CGVA 3EB0A 2OH0E 5AV2A 4C4IA 4I0RA 3S4QA 3VONA 5IQHA 1NA7A 4DDIA 2I0VA 5K4IA 3TNIA 2XJ0A 3N4UA 4EKLA 1XH6A 5BUEA 4S32A 3MPTA 4IZYA 1RW8A 4OTGA 1ZYLA 2BFYA 3F82A 4YC3A 5M4FA 2FA2A 4DFLA 3A4PA 2UZOA 2W06A 3BU5A 2X6EA 2XAMA 4CKRA 3CKXA 4YZ9A 4AT5A 1YRPA 3ELJA 3ML1A 2R9SA 3NEWA 2FVDA 1P14A 3LFBA 3Q96A 3ZO3A 4U80A 3WYYA 5TKDA 3RALA 3ENHA 4O38A 4F1OA 3CEKA 1GY3A 3CIRC 1QPJA 3A7JA 4GKHA 2QKRA 3ZH8A 2PMOX 4G3DA 4KUJA 4YJRA 4DBXA 3FMNA 3Q04A 5HICA 3AE5D 4YPDA 5EI6A 3NAXA 3V5PA 3W33A 5J9YA 2J90A 3M1SA 3ZUVA 3AEAC 2JAVA 3QQLA 4DFNA 5BVEA 3ZLSA 4EH7A 2X8IA 2X7FA 4P90A 4L3LA 4ERWA 2OO8X 3RZBA 3EQFA 5FXQA 2F2CB 4O2PA 3V8SA 3UZRA 4AT4A 4IFCA 4EONA 4KD1A 4USEA 5CSHA 4QP2A 1XMMA 2ITPA 4EZ7A 3HMIA 2I6LA 4XRLA 3KULB 2HXLA 3QAME 2FSLX 4FV0A 4PL3A 4EQUA 3UQCA 3DA6A 4IX4A 4WUNA 3LCDA 5EHYA 1CDKA 3ZFYA 4UB7A 4EOIA 2VX1A 2CMWA 3MVJA 3UP7A 4DCEA 5AV4A 4CLJA 4IZ5A 4L8MA 5AIRA 4AN3A 4ACGA 3AKJA 4L44A 4IEBA 2R3GA 3JS2A 4RJ8A 1NENC 4B9DA 3D83A 5AX3A 3KVWA 3L9MA 4FV7A 5LVPA 3CQUA 5HESA 2VWXA 2XH5A 5F20A 4DEDA 2I7QA 5AWMA 2WP9C 4KB8A 3PY0A 4MBIA 4AE6A 4U81A 4FIGA 2W1DA 3TXOA 2C5OA 3R63A 2PTKA 3D4QA 1JSTA 4F70A 3UO4A 3V5JA 4BDHA 1QCFA 4EHEA 5FG8A 2IVSA 3ID6C 4JX3A 2YZAA 3UOLA 2F9GA 5CEPA 3IDBA 4FYNA 1SVEA 4O83A 3KKVA 5FDPA 4ZIMA 4GJ2A 4J8NA 3OVVA 4F99A 2XK9A 4C59A 3AEFC 4D1SA 3DBEA 4KWPA 4QMZA 5HQ0A 2HWPA 2BS3C 4IDTA 4IJPA 4TXCA 5E8YA 3DKCA 3U55A 4APCA 3OW4A 4P7EA 2C6KA 4I3ZA 3G6GA 2SRCA 4CRLA 1URCA 3R7OA 3ZTXA 5C26A 1BMKA 3SXSA 1VJYA 3BLAA 3CQEA 4BI2A 4XBRA 4QPAA 1MQBA 3DGKA 4AOJA 1GNGA 2LGCA 3HUCA 4H3PA 3AE2D 3DV3A 4NW5A 3UDBA 4LQMA 3HUBA 5DVRA 4BI0A 1ZMUA 4TZRA 3BHYA 2Z7SA 4XV1A 1W82A 2ITOA 3ENMA 1PMVA 3MH2A 4FTUA 5KMIA 3VBYA 4V01A 3TKIA 4D9UA 3AE3D 3ALOA 5FEDA 4CFUA 3BGPA 3ZSHA 3QLFA 4QMVA 3QRIA 2BAKA 5FDXA 4DLIA 4ZAUA 4ZMEA 4YJPA 2G15A 2XNOA 2FUMA 3BLQA 3E64A 3AE1C 1GIIA 1YI6A 3KXZA 2Y4IB 5BYLA 2Y6OA 4X3FB 5AA9A 4TPTA 3EQGA 3KK9A 3LFDA 2HZNA 5KCVA 3MH1A 2BKKA 3ODYX 2WO6A 1O9UA 2XB7A 4Y46A 4YGAA 1PXMA 4AQCA 4A9SA 1YDTE 4O82A 5IH6A 1WBSA 3QZHA 5TO8A 2BRHA 3WZEA 3VJOA 4QQ5A 2OI4X 4EKKA 2QO2A 4FOCA 4JAJA 5AP5A 3MY5A 4CZUA 3Q2MA 5I9ZA 2ZAZA 4TRLA 2ITZA 4PWNA 3LXKA 2H8HA 4KIPA 4UY9A 1HOWA 3A60A 3CTQA 3E8NA 5BQ0A 3VRYA 1JKTA 3TM0A 4NK9A 1Y6BA 4C4HA 4GL9A 3UE4A 3PRIA 3EKKA 4YT0C 5C2TD 2RG5A 1AQ1A 2WDVC 3G33A 4QMWA 3FSKA 4FV4A 4Z55A 2QODA 4O2ZA 3R8ZA 4CD0A 4IZ7A 3ZZEA 5IQBA 3MA3A 4CV8A 4HW7A 4FGBA 1PXLA 4ZTQA 5CEIA 2QR8A 2HW7A 2WU5C 4AAAA 3BEGA 3Q52A 1KV2A 4FNXA 5D41A 3RM6A 3VR9C 1KOAA 3KMUA 4NJ3A 4FKQA 5FP5A 3W0SA 3WILA 3QTRA 1G8JA 3TNQB 4KINA 4RIXA 2HYYA 4I22A 4ZSGA 3C50A 3FLWA 3P7AA 5CI7A 3U4UA 3EYGA 2QONA 3FC2A 4NM5A 3WE4A 5GIPE 3ZBFA 4NU1A 3TZMA 3RVGA 2E9OA 1BX6A 4ZS4A 3CGOA 5BVOA 3KXGA 3D9VA 3FBVA 3QHWA 1CKIA 2FH9A 2QU5A 4C4FA 1XJDA 4XG4A 4ENYA 5B2KA 3OT3A 4MKCA 3CTJA 2WMTA 3P23A 4I5PA 4QDEA 3G5DA 2I0YA 2OZAA 2VRXA 3BYVA 3D5XA 3KMWA 2XKCA 1VLRA 4M15A 4U44A 4CQEA 4ZZOA 3NCZA 3QQHA 3AEGD 3RCDA 5E7RA 4EOOA 3QCQA 4XG6A 3I7BA 3CD8A 3IGGA 4R6VA 5HX8A 1P2AA 5L3AA 3C4XA 1YXTA 4G6LA 3TMOA 3CKWA 5LQFA 4TN6A 5HG5A 1VEBA 4F6UA 3COIA 4X2JA 5HLPA 4ZS0A 3VQHA 5E4HA 3NS9A 3VJNA 3QALE 2UW4A 2YCSA 3TDVA 4ASZA 1HCLA 4QTAA 3ULZA 2AYPA 5M44A 3MI9A 1R1WA 4QTDA 3OWPA 2HAKA 3V51A 1JKKA 1OKZA 3L8VA 5FBNC 4CTBA 4DFYA 2E9PA 4U0IA 5LOHA 3MB6A 3R28A 1M2QA 3VUDA 5IZFA 4OLIA 3G51A 2GQSA 4PDSA 2R7IA 4MEDA 5L8JA 2B76C 3RPYA 4DTKA 3AE8D 5LXMA 5FTQA 3FMMA 3FY2A 4GK2A 1H27A 4O96A 2XA4A 4ZTNA 3HMNA 5CANA 4ANMA 2Q0BA 3AGLA 2AC3A 3WF9A 4D0XA 2J0IA 3JVRA 3P4RD 5EI2A 5BX0A 5KKRC 2C6LA 4YJSA 4RJ5A 4C37A 1Q61A 3NUNA 5LMKA 2V22A 2W1FA 4Z16A 4XYFA 3VBWA 4JQEA 2JBOA 3RNIA 4JRVA 2W4OA 2PVLA 3PYYA 2OIQA 5C01A 3CR0A 1E9HA 1SZMA 2IVTA 4L68A 4BDCA 5BUJA 4KBCA 3AMAA 2Y9QA 3SQQA 3TNHA 4YZNA 1Z57A 5EW9A 2X8DA 4BYIA 4CRSA 4YUQA 4EBVA 3W2QA 5CU3A 5BNJA 3TZ7A 1P5EA 3OOMA 3C13A 5IUGA 1IAJA 1IG1A 4AUAA 3GU5A 4B8MA 3KVXA 5KBQA 5CLPA 2YM5A 4Q9SA 4TYHB 5L6PA 4ZJIA 3GB2A 3AE9C 3FQSA 3W55A 3JY9A 3SRVA 3KY2A 4NYEA 1YXSA 2JITA 1ZMVA 4BCHA 4C3FA 1UNGA 4R3RA 3FHIA 5BVWA 5FRIA 4MNFA 2EXCX 4KKHA 4AGCA 2WU2D 4J7BA 1K9AA 2V55A 4M0YA 2R3LA 3AC4A 5EDPA 3VBVA 3O8UA 3NNUA 4EBWA 4F0IA 5HZNA 1GAGA 3WZUA 3EFLA 3FDNA 3RP9A 2XVDA 2Z2WA 4DHIB 5B0XA 3R83A 5HORA 3WE8A 1PKGA 4DC2A 3F2NA 4LV7A 3KQ7A 4BDAA 1Y6AA 3H3CA 3R02A 4U6RA 4ZXTA 1G8AA 4H1JA 2ZM4A 4MBJA 3DU8A 4BDGA 4RWJA 5EOBA 3OUKA 4RA5A 3B2TA
chains in the Genus database with same CATH topology
4F9AA 1Q62A 2HY81 3K54A 3O71A 2R0UA 2GQRA 2ZMCA 3FI3A 4QP7A 5CALA 4IC7A 4WNPA 1DI8A 2WQBA 4O22A 3U6HA 2OJIA 1WBPA 4K18A 4HVHA 1M2PA 1LPUA 4H58A 4J71A 1AD5A 5CNNA 4UEUA 2YEXA 5JEBA 3VBQA 1FGIA 3QD0A 4U3YA 1VYZA 5LMAA 4YHFA 5B2MA 3TEIA 5EQYA 3VBTA 5HU3A 2WMVA 4YSMA 2WIPA 3DBQA 5GIOE 4M68A 2VV9A 1LP4A 3LFSA 4RLKA 2OJ9A 3B2WA 4V04A 3GCPA 4Y83A 5F95A 2RIOA 4ACDA 3MY1A 4AZSA 1ZOGA 3R7YA 2R3MA 4RVKA 2UUEA 4IWDA 3TYKA 2ITNA 4EJ7A 5HG8A 4FL2A 4AOTA 1FGKA 3QD4A 4BDFA 1PRYA 4R1YA 3A99A 5CF6A 1W7HA 1FPUA 2X8EA 4ZZMA 3HMMA 4LYNA 3TIYA 3P5KA 4BVUA 3G0FA 4E6QA 2EWAA 2ZDTA 4ANLA 2PZ5A 1G5SA 5J87A 4AGWA 4TYEA 3UNZA 3MBLA 5DT3A 1OBGA 2X2KA 2YWVA 3RK9A 2GSFA 4PF4A 3QA8A 4IAAA 4NKAA 4X2NA 5BVKA 2QG5A 3F3TA 1TQIA 3FMLA 4OTQA 3DKGA 1YOJA 2OGVA 3ALNA 1K2PA 5CAOA 2BKZA 3TUDA 3ROYA 4ACHA 1PYEA 4GKIA 5C4KA 3EN7A 4RVLA 2E2BA 3MFUA 1F5QA 3MIYA 3BIZA 4DN5A 2WU7A 3G2FA 1OITA 1WBNA 5DRBA 4AZVA 3D2KA 3AG9A 5K5XA 1GJOA 3DK7A 4FZFB 3UC4A 3VRZA 4XEYA 4U42A 4BJJB 3BEAA 4JQ8A 4E8AA 1L3RE 4YO4A 1YW2A 2QR7A 2X7OA 1XMLA 3WI6A 3V5TA 2HOGA 1TQPA 3L8XA 4DF3A 4OGRA 3AKLA 1FVTA 3PPJA 5CSWA 4ZSJA 3ORLA 3L9LA 4FNWA 3EN4A 5E8VA 4FJVA 3UZPA 4NT4A 5AP2A 4KAOA 2VGOA 4XG3A 4YZBA 3RPOA 3TZ9A 1M14A 4BDDA 3UO5A 3AC3A 3BV3A 2WQOA 1V0BA 2GTNA 3ACKA 3RM7A 5A14A 2OSCA 5JQ5A 3H9FA 3QUPA 3HEGA 3UVRA 5IDPA 3EH9A 3I5NA 2BALA 3TL8A 2R3NA 2HXQA 4AZTA 2H6DA 4BCFA 2YM6A 1YI3A 2FO0A 2QD9A 2CKPA 4F9WA 5JFVA 3IW5A 4YZMA 3QLGA 5DT4A 4UYNA 2R7BA 2C0IA 1B38A 3AT2A 3S1HA 1LUFA 5L6OA 4XBUA 4GSBA 2WD1A 5HCYA 5AP1A 5KMOA 5F94A 2R4BA 5EM6A 1L8TA 4K2RA 4RJ3A 2ERKA 2YDJA 4C2WA 3R6XA 1FOTA 3F2AA 3P0MA 2X39A 4ANBA 4G5PA 1URWA 3IS5A 5IA3A 3ORTA 4B6LA 4YTCA 5DR9A 3FYKX 5ITAA 3SOAA 3FV8A 3HMPA 3MVHA 5DHJA 5CTPA 4BCGA 3NMUF 2W1IA 3BBWA 2I40A 2NNWB 4MAOA 3UVPA 1DM2A 5KMMA 4A4LA 4YLLA 2A4LA 5KHWA 4IB1A 4C4JA 5E1EA 2G9XA 3HVCA 1H01A 2QC6A 2O8YA 2EXMA 2J9MA 1YHWA 2BDJA 3A7GA 3UDTA 3IECA 3WIGA 2W1CA 4RC3A 1OIYA 1W84A 4FE2A 4I5HA 5F1ZA 4QMSA 5HD4A 1JSVA 4G5JA 4RRVA 4MNEA 3QTQA 4ZK5A 4NW6A 4U41A 4DFUA 2PE2A 3OEZA 3PLSA 1WBOA 3DK3A 3FKNA 3SW7A 3MH0A 4QYGA 4N6YA 2XRUA 2VO6A 2O5KA 4BF2A 2YJRA 3R2YA 4MUQA 1KV1A 4QMNA 4L9IA 3C4CA 3SW4A 4JBOA 3OW3A 3W18A 2QOOA 3GQIA 3L8SA 1GZOA 4ID7A 4FKPA 4F7NA 3WZKA 3QC9A 3LFAA 1H0WA 4LL0A 2J0KA 1FVRA 2Z60A 4IWPA 4Q5EA 4YTFA 4FKIA 4XLVA 2FGIA 2VWZA 3DQXA 1OL5A 5I9VA 3LZBA 5IA0A 3JPVA 4KKEA 2WTDA 3KGAA 2WIHA 2WTJA 3R00A 5M09A 4U8ZA 2VO0A 4DE4A 2W5HA 4C4GA 3BYSA 4DH5A 3R2BA 1W98A 3L8PA 5CT7A 4HNIA 5E8ZA 4PTGA 1ND4A 1OIQA 3EL8A 1E1VA 2O0UA 3PJ1A 1YXVA 1CMKE 2Z7QA 3BYMA 3BRBA 3AT3A 3ZXZA 3DFAA 1WFCA 4BR3A 4O6LA 4FV9A 5IQCA 2XYUA 3UQFA 2JGZA 3UOJA 5A4TA 5HO8A 3O5AA 4C0TA 2ITWA 3GU6A 4FL1A 4FNYA 2XCHA 3D7TA 4TWOA 5DLSA 5B2LA 5HBHA 3SLSA 1REKA 4HPUE 4JG7A 5M51A 1ZLTA 4JBQA 4LGGA 1DAYA 3CIKA 3EKNA 1Y8GA 4C38A 4AG8A 4A9YA 3AC1A 1UWJA 3BU6A 4DA5A 2WOTA 4M97A 4YC6A 1JNKA 2IPXA 4QMYA 4CKJA 3VF9A 5KKRB 1PXIA 2GS6A 3FY0A 5J9ZA 1X8BA 2YM4A 3MVLA 3GGFA 3C4FA 2F7XE 2CDZA 3QD3A 4BCJA 1HCKA 4BBMA 2HW6A 3KCFA 2ETRA 3R21A 3CY3A 2WTWA 2XYNA 2W0JA 4QP9A 4I41A 3LCOA 5DOSA 5ANDA 4WNKA 4FTCA 3N4VA 3GU8A 4S34A 4GV1A 4O7WA 4UZDA 4YC8A 4QMLA 2UW5A 2VWVA 3ZMMA 4D28A 3IO7A 1YQJA 4GS6A 5HNGA 4MK0A 3FZTA 4PL5A 5FLFA 2VX0A 5AP4A 4NCTA 3QQFA 4ZSAA 2G2FA 3Q9WA 4IAKA 3ULIA 5J1VA 3U87A 3QL8A 4UZHA 2WFYA 2VWWA 4Z7HA 3NUXA 4IQ6A 4EK6A 5HG9A 4JDJA 4O0TA 2IZSA 3QFVA 4U43A 3QTSA 2QNJA 1GZ8A 4L00A 3CBLA 4NWMA 4RVMA 5DR2A 3EIDA 4CZTA 3R22A 3O7LB 2VO3A 2HCKA 3QCXA 3ZCLA 3MFTA 1PJKA 2VNWA 3ACJA 4OBOA 3IOPA 2OXXA 4I6BA 1YDSE 2ZV2A 3OWLA 2OJGA 2BZIB 5GNKA 4DITA 1VZOA 3LVPA 2GU8A 3PSDA 2BRMA 2X9EA 3Q6UA 4S31A 4QNYA 3RAWA 3PVBA 4BGGA 4FG8A 2C5YA 4YMJA 5F9EA 5AJQA 3COHA 2GS7A 3MFRA 3E7OA 3ORMA 5TT7A 3MVMA 5D10A 3ZDUA 5EDQA 4PP7A 3KULA 3FAAA 4K8AA 5DBXA 3W2SA 2GFCA 2FSOX 3HKOA 4B7TA 1J1BA 4FTAA 5DYJA 2J2IB 1SVHA 3Q32A 4RT7A 4GK4A 1ZRZA 4F9CA 4D0WA 1OUKA 2ZV9A 4USDA 2C4GA 5CU2A 2WTIA 4G3FA 3R73A 4M7IA 5FM3A 5DA3A 3JUHA 3PJ3A 5AP7A 2PMIA 1JQHA 2R0IA 5ANJA 5GHVA 5A46A 2H9VA 3LM5A 3O0GA 2XK4A 3OFMA 5C4LA 2JDTA 2OLCA 1PKDA 4IE9A 3CTHA 3IW7A 1XR1A 1PXPA 5CT0A 2XK6A 3K3IA 3G90X 3QCYA 4XHKB 3KXNA 3L9NA 4QYHA 2VTIA 3P86A 4TKSA 5FP6A 2JKMA 5FXRA 2NRYA 2VO7A 3BHUA 4FNZA 2IW9A 3TIZA 3GC7A 5AAFA 2UZTA 2WMRA 4PV0A 3HP5A 4XX9A 4AE9A 4ALUA 3GEQA 3PA5A 2IW6A 3EQRA 1F0QA 2PHKA 1NVQA 4IWOA 4FEWA 3TNPC 3HZTA 2CJMA 3NUUA 3TKHA 4RJ4A 4PNKA 4J95A 2GNHA 5I5ZA 2GCDA 1ZZ2A 3KEXA 4IAYA 4TL0A 4UX9A 1DS5A 4BCPA 2ONLA 2C5XA 1GZNA 3LHJA 4N0SA 4MVFA 3W2OA 4EC8A 2VTQA 3PJCA 3I4BA 3OG7A 3MESA 3FJQE 5DPVA 4O6EA 2YITA 3UBDA 5DRDA 5FTOA 3TI1A 4L53A 1JPAA 3E8EA 3HDNA 3UC3A 3WF7A 3ZONA 4JG8A 2OZOA 5M4IA 3R9DA 2V0DA 4WBOA 3AGMA 4CCUA 2JDVA 3IOKA 4FEUA 4A9UA 3DQWA 4BHZA 3GXLA 3VUKA 3QBNA 4MBLA 3PP1A 2VTOA 5M07A 4FTLA 1QMZA 2GNIA 3PUPA 1H08A 2PSQA 1JSUA 4RFZA 2E9UA 2I1MA 5JGBA 4WKQA 1MRYA 3NWWA 4NM0A 4OTHA 1R0EA 3FL4A 2BDFA 4BTJA 5AAEA 4ITJA 4F6SA 4BIEA 3ZZWA 3Q9XA 4HGEA 4C34A 2G01A 4KRDA 3ZO4A 4WG5A 5HVKA 3PXZA 4IX5A 4FTKA 4HNFA 4DG0E 5JGAA 5KO1A 2P4IA 1OIRA 3ZC6A 4K6ZA 5EQEA 3BHVA 3I0OA 4QNAA 4WNMA 2GPHA 4X3FA 5T6KA 1OI9A 5EM8A 1JVPP 1YXUA 4GYGA 4UBAA 3RTPA 1Z5MA 3C5IA 3ZRLA 3ITZA 5C03A 4AFEA 4FG9A 4O21A 5T3QA 1TFFA 4QP1A 5JKGA 2HK5A 4USFA 3OF0A 2YCQA 4A9RA 4BC6A 5KX8A 4FSRA 4O7ZA 3WIKA 5A3XA 2FSTX 3U6IA 4JRNA 5G1XA 2C3KA 3FZSA 4WBBB 3I79A 4YJOA 2QOFA 3UDSA 3B8RA 4ARKA 2VTSA 4E4LA 4F0GA 1UKIA 4H36A 4OTFA 4YJUA 2OKRA 3GU4A 3OUNB 1KE6A 4U7ZA 2PVNA 5CVFA 3FPMA 3E7VA 3A8WA 4GCJA 2B9JA 4YLKA 4V05A 3MH3A 2YDIA 5CENA 4LOPA 4C02A 3BU3A 2R3QA 3HRCA 3DS6A 2QG7A 5C27A 1G3NA 2VAGA 3CS9A 3ZSGA 2ITQA 3DXPA 3TUCA 5IQEA 3LLAA 4KKGA 4FTJA 4BCKA 3HA8A 3P79A 4FK6A 5CAPA 4F63A 2OK1A 4TYGA 3I60A 4BBEA 3QTUA 4F7SA 4RJ7A 5JZJA 4F7LA 5EI8A 3CQWA 5ETAA 4EI4A 5LJJA 3U4WA 1IAHA 2DYLA 1ZWSA 3HDMA 1NW1A 5BYYA 1Q8YA 5IPJA 1PMNA 2YISA 3QUEA 5FEQA 3ERKA 3BKBA 3KREA 5KMLA 2WMQA 4DYMA 5DGZA 5J8IA 5E90A 2UZLA 2BAQA 4YLJA 2R3FA 3G9NA 2IW8A 3GU7A 2VTHA 2YM8A 3QZFA 4AU8A 3UIXA 4RA4A 2W4KA 3T9IA 4HVDA 1KE9A 3BHTA 3O23A 2CNUA 3E3BX 2ZVAA 4R1VA 4ZOGA 4EL9A 5IF1A 3NW7A 2IWIA 3PJ8A 1CSNA 3PY3A 4FTIA 1NXKA 2QLUA 2ZB1A 1M7QA 5CSXA 3WF5A 4FIFA 4M8TA 4ZTHA 4AF3A 4ZLZA 4EYMA 3Q5IA 2J0LA 4I0SA 4HYHA 4LUDA 3O2MA 4BHNA 3KIOC 4RC2A 3S00A 4I92A 4FT7A 1DAWA 4WSYA 5EK7A 4EK5A 4O0RA 3PIYA 4DT8A 5KNJA 4RX8A 3RWQA 3ORKA 4A4XA 2VGPA 4LV8A 4X6QC 5AV0A 3ZFMA 5E9EA 4GU6A 1J91A 3ZO1A 5EYDA 4DGNA 3DB8A 3MS9A 5KUPA 3F7WA 1YI4A 4FEVA 5F4NA 3DZQA 2J5FA 5EKOA 5HHWA 4BCIA 5HX8A 3WARA 2CSNA 3BQCA 3PFQA 4WIHA 1RJBA 3Q4TA 5D11A 2PE1A 2PULA 4JS8A 3LW0A 2GHMA 3O51A 3QQGA 1OL7A 2BZKB 4JVGA 5TF9A 3MB7A 2HWOA 3MGYA 3QX4A 3QZGA 2WQMA 2RG6A 3PSCA 4FG7A 1OBDA 1XBBA 2F49A 3C51A 3DJ5A 3E3PA 3ORZA 4JIAA 3TV7A 4FYOA 2UZDA 3FKLA 2WMXA 1PYXA 3HNGA 4GW8A 5IUIA 3E63A 3E5AA 3QRJA 2OICA 4TYJA 4D2SA 4FTQA 3DFCB 3VS5A 3ET7A 4QT1A 1WVXA 3IW8A 2BRBA 2E9NA 2X7GA 4EUTA 2C1BA 5M57A 3S0OA 4F4PA 4WG4A 4DEGA 3PRFA 5EM7A 5HO7A 4NIFB 4BCNA 4O27B 4S30A 3HYHA 4P2KA 3WF8A 3F7ZA 4TYHA 4AT3A 2RGPA 4ZY6A 4GJ3A 4CFXA 3UIUA 4C3RA 4ZTLA 1KE5A 2CKOA 2WQEA 4C4EA 1UWHA 4HGSA 4EQCA 5T68A 2OIDA 5D7VA 5LCKA 3R71A 1SM2A 4X6RA 4TWNA 4AA4A 4BY9E 3HV3A 4IVAA 4S2ZA 2KTYA 4FKLA 4W4WA 5HE2A 5TR6A 4GU9A 3VS1A 4Z7GA 3ZM4A 1OMWA 3H9RA 3ORIA 5IA4A 5B7VA 5IU2A 3VNTA 4UWYA 3FWQA 4RSSA 4G2FA 3Q4UA 4PMTA 1YXXA 4QYYA 1STCE 4G3EA 4ZLOA 1XH8A 2CKEA 3BV2A 3OWKA 2WAJA 1LR4A 2ZOQA 5HGIA 4CFWA 3OY3A 4Q2AA 2CGUA 1B6CB 2C69A 4EHVA 4F0FA 3GCUA 4GMYA 1SVGA 1WBWA 2Y6MA 5KZ0A 2R3RA 3ATTA 3UIBA 3DBDA 4X2FA 5CQWA 3U8WA 1XH7A 2A1AB 4BZDA 3DDQA 1NT2A 3JR1A 3EWHA 4DG2E 1PMUA 3EMGA 4M14A 5HEZA 3MSSA 4MXXA 4FV8A 3E92A 4U40A 2QVSE 3KU2A 3AC8A 4J97A 2V7OA 3QHRA 4PMPA 5IQAA 4XV9A 5AUXA 1OL2A 2XIXA 3E8CA 2XF0A 5CNOA 3WZJA 5LWNA 1V0OA 4O0YA 3ANRA 4AZFA 4HVGA 3M2WA 3COKA 5BVDA 1FBNA 4NZWB 1LEZA 2PMLX 4NSTA 3RK5A 3NYVA 4G31A 4JAIA 4EOQA 3CY2A 4JNWA 4D9TA 2GNFA 4GT3A 4AFJA 4HCUA 4WNOA 3DKOA 4ZTRA 4FSTA 4AW0A 4Y5HA 2GHLA 3CJGA 4XV3A 3IONA 4XS2A 5JZNA 4IDVA 3HLLA 4BIDA 3BCEA 2QCSA 3QRKA 4NJDA 5FEEA 3TV6A 4ZY4A 3DDPA 2Z02A 3AQVA 4F1MA 4JDKA 4C62A 4CT1A 3W0NA 3RPRA 4NFNA 2G2HA 3OHTA 2PPQA 4D1XA 3BQRA 4PUZA 4FL3A 4DAWA 2VTLA 3PFYA 3W2RA 4E4NA 4IM2A 3I7CA 3PUFC 1YVJA 4LUEA 5EYCA 3V5WA 5IH5A 3PXRA 2X4ZA 4FT3A 3PY1A 3CJFA 4OUCA 3KMMA 4E4MA 2XBAA 3RGFA 1QL6A 3MN3A 4DHFA 2WTVA 4TNBA 3QC4A 3I0QA 4CEGA 1IA9A 4MQ2A 3E88A 3GFWA 3W10A 2UZBA 4O7VA 2UW6A 1ZYCA 2YM3A 3NFFB 4RQVA 4WOVA 4XP0A 5JH6A 5H8GA 3Q4CA 5HX6A 3QQKA 4FTOA 3W8QA 4G17A 4CV9A 4FUXA 2DQ7X 2OFVA 2XBJA 3D5UA 4E6DA 4FTNA 3KF4A 4DEIA 2HELA 4LM5A 4ACMA 3R9OA 4FIJA 4XNEA 1S9IA 4QTCA 2XKFA 4TYIA 4BJJA 4XP3A 3TG1A 4YSJA 3IDPA 3DCVA 4YNEA 3R8PA 1OVEA 1GZKA 4DGOA 3KFAA 4WHZA 5HKMA 4OBQA 3C5UA 3QA0A 3VS0A 2YIYA 1U54B 2WTKC 1P4OA 2ETMA 1BLXA 2PVJA 2C0TA 3IGOA 4XP2A 3CXWA 5M06A 1O6YA 2X1NA 2OIBA 1G8KA 3AC2A 3NX8A 4FKSA 3OCGA 3FI4A 4EUUA 2W1HA 3QRTA 4RWIA 4UWCA 4M67A 4BDIA 1W0XC 3NUSA 4JOAA 3FXXA 4I6QA 2PZYA 3DT1A 4O86A 3UJGA 3PXKA 4O0SA 1Y91A 3MJ1A 2PVMA 3QZIA 1QPEA 2XIZA 3G6HA 1XHAA 4NTTA 2WTCA 4RIWB 2JKOA 3S95A 2OJFE 3OWJA 4XCUA 1T46A 2VTNA 4RIOA 3LFNA 2PZIA 1A9UA 2YA9A 3FC1X 4AW5A 4DG3E 3Q9YA 2CN5A 4IAFA 1R78A 4QMUA 3ZM9A 4AXEA 5JFXA 1V1KA 3FLQA 4L46A 4D4YA 1Z9XA 3BZ3A 3QQUA 4GH2A 3NGAA 3WBLA 3KN6A 4BCQA 2PE0A 2W9ZB 3C0HA 3EOCA 3ZOSA 5CEQA 4EK8A 3GOKA 4G1WA 4AXFA 3W32A 1YHSA 4J98A 3W0PA 1T45A 3ODZX 4EQMA 2IJMA 5JMSA 4R3PA 4DT9A 2F2UA 2W1GA 3AXWA 4NKSA 2REIA 4QTBA 5CVGA 3FMJA 4JR3A 1MRVA 2B0QA 3P1AA 2WMAA 5CEKA 3UDZA 3FI8A 2GTMA 4RX9A 2GDOA 3U51A 4FSUA 3P5JC 3U9CA 4AX8A 2EUFB 4AW1A 2J4ZA 4IJ9A 5LMBA 3TJCA 3R8VA 2PUPA 4MX9A 3V6RA 4APPA 1Q8TA 3FL5A 5EW3A 4FV5A 2UZEA 4EZ5A 2XNBA 4EJNA 3EQCA 2VWIA 4E7WA 5ANEA 4YTIA 5D9HA 5AMNA 3BHHA 3ZLXA 3FLSA 4IFGA 4JXFA 5ANGA 3SKCA 4RMZA 1TQMA 2YIWA 3EN9A 2OF2A 4FGRA 5E91A 4AGUA 3LJ1A 4DEHA 2QOIA 2P33A 4FSZA 3AD5A 5CS6A 2X6DA 5E1SA 3U6JA 3VW6A 3LKMA 2C68A 5IMXA 3Q53A 1J3HA 3NIEA 5HTBA 2QOLA 4R78A 4W8DA 5EFQA 4CLIA 5AV1A 2ZJWA 4H3BA 1R3CA 5HD7A 4IB0A 3LMGA 2J50A 4FKTA 3C9WA 4NH1A 2VTMA 5M53A 4BDKA 4FK3A 2BIYA 3CLYA 3LMHA 2F57A 2NO3A 4PL4A 5C8NA 4PRJA 5IA2A 3EJ1A 2VWYA 2XIKA 3P7CA 5A6NA 3QWJA 2I0HA 3R0TA 2UZWE 3Q9ZA 4GFGA 5A4EA 5LVOA 4L6QA 5D7AA 5HE0A 1B39A 4FVPA 3FMEA 3VUIA 5J7HA 5IQIA 1OM1A 2XUUA 2XP2A 2Z7RA 1OB3A 3QUDA 4M84A 4ITHA 4NFMA 1CKJA 4DH1A 3TTIA 1BKXA 1QPCA 2O2UA 4XMOA 2OXDA 3W0RA 2WB8A 1GIHA 5CAQA 5JQ8A 4QP6A 2ITVA 2PYWA 2R64A 1KWPA 2R3OA 3BLRA 2RF9A 3R9RA 4I6HA 5L8LA 3UPZA 3I81A 4FKOA 2VTTA 5KBRA 2YACA 2PUIA 2VTRA 3FYJX 4WG3A 1PHKA 1H1SA 1OGYA 3NR9A 1J7LA 3O17A 3PWDA 5DE2A 3NIZA 4CVAA 5I9WA 1UVRA 4L52A 3NW5A 3HECA 2BPMA 2W7XA 2WHBA 5IUHA 5EHLA 1KOBA 3D5VA 4FTMA 4E73A 2BHHA 3MFSA 5ACBC 4IVCA 1WAKA 3C1XA 2IG7A 5E8WA 5ETFA 4F09A 1WBVA 4GFOA 4HZRA 3UIMA 4R3CA 4O7LA 4EHGA 2C1AA 3PXQA 3CP9A 3EZRA 4KIQA 1SMHA 1OL6A 3IQ7A 4WT6A 4DINA 3R8UA 5HBJA 3ORPA 4W4VA 3AT4A 4UYAA 3V04A 1JLUE 3FQHA 4LGHA 2DUVA 3G9LX 4C36A 3D2IA 5JRSA 5LARA 3GCQA 4EH3A 2JFMA 3KRWA 2JDOA 4AA0A 1REJA 5CF8A 4QMQA 4IB3A 5HCZA 3NYNA 4AS0A 5KE0A 2XARA 3LMIA 3TKUA 3C4EA 3KRRA 3BL9A 3BWFA 2B53A 2BFXA 4R77A 1M17A 3IW4A 5L2IA 4ZSLA 1G8SA 5KMJA 3TACA 3R30A 2XIRA 3Q2JA 4DH7A 5H8BA 1SNXA 2YFXA 4N4SA 2GMXA 4IVBA 5FM2A 3BL7A 3HX4A 3QGYA 4C33A 3PVGA 4I1ZA 4I24A 4YZCA 3TT0A 3OP5A 3OZ6A 4C3PA 4DHJA 2CN8A 3CGFA 1KE8A 2QKWB 2VWBA 3D7ZA 3D94A 2BCJA 3OBGA 4KNBA 4DCAA 2IVVA 2UW7A 2R3KA 4AOIA 1JKLA 2VNYA 3VUMA 5BUIA 4A06A 2CCHA 4RG0A 1J7UA 4E1ZA 3KXHA 4BYJA 3NYOA 3CE3A 3A8XA 2C6IA 5AUWA 5ACKA 3MPAA 3NPCA 3KC3A 4FSMA 1V0PA 4J8MA 2G1TA 2YM7A 3F6XA 1Q8ZA 4QYEA 2LAVA 2QO9A 3BBTB 5HCXA 4M12A 3DAJA 3EQPA 3SG8A 3D0EA 3RK7A 3F88A 4DH8A 4J52A 4ZTMA 1ZYDA 3ZRKA 2BRNA 2JKQA 4JDIA 3PVUA 3VS4A 4CMTA 5IEVA 2JFLA 3UOHA 2EB2A 4C61A 4A7CA 4ZJVA 3F9NA 1OUYA 4RIYB 4UV0A 2VTPA 1XQZA 3LXNA 4C2VA 2W9FB 4FZDB 1FMOE 4L42A 3L9PA 2VTAA 3NUYA 1O6KA 3PA3A 3VS3A 4E6AA 2Q83A 4IACA 2I0EA 3DLSA 5DT0A 4F64A 3SOCA 5BVNA 4K77A 1UNHA 5IISA 2J51A 2WMSA 4HGTA 3UGCA 3ZS5A 4ASDA 4AAYA 1ZOHA 4XG8A 4BTMA 2WZJA 4F78A 4RLLA 1Q3WA 3FQEA 3G15A 5JRQA 3MPMA 2XZSA 3V8TA 2BILB 2F7EE 3JVSA 4ASEA 3DNDA 3A62A 4FX3A 4V0GB 5AP6A 5JK3A 4I6FA 4L3PA 3EQHA 2X81A 5BMMA 4IM0A 2ZV8A 3HV7A 4GUEA 2ITXA 3ZDIA 1K3AA 2XKEA 4AZEA 4QP4A 4F6WA 1ZYJA 3OXIA 1XKKA 3ANQA 3U54A 4AXAA 2YN8A 3NVMB 3PWYA 1PXKA 2O3PA 3DBCA 4X7QA 4AN9A 2HZ4A 3H10A 4ZZNA 1CM8A 2W5BA 2WU6A 2XEZA 4OTRA 5HLWA 3FHRA 5DFPA 3KK8A 4YJVA 3EL7A 4QMXA 4AA5A 2UV2A 4BTKA 3NCGA 2XKDA 1M52A 3I1AA 5CAVA 1VR2A 3PDTA 4U79A 3T3UA 3VWAA 5BVFA 3AOXA 4Q9ZA 1NVSA 3LQ5A 4ALVA 4M13A 5IA1A 4EK3A 4DEEA 5BYZA 2AC5A 2XK8A 4QO9A 2XNPA 2IZUA 4PX6A 2JBPA 4AN2A 3VQUA 4MD7E 2R2PA 3E93A 5AIKA 5FBOA 3NYXA 3WF6A 2BZJA 4ZTSA 2Y4PA 2XM8A 4FSQA 2WTKB 2CGWA 3ZUUA 4BCMA 5IMEA 5K9IA 4JL9A 4MH7A 5DEWA 2C3IB 4RX7A 2V5QA 3C0IA 3EFJA 4FR4A 3FKOA 3QKLA 3GCVA 1Q97A 3HP2A 3PP0A 3R1NA 5G6VA 5GJFA 3D14A 2UW9A 3LE6A 5AAGA 4JMQA 3NAYA