4LDTA

The structure of h/ceotub1-ubiquitin aldehyde-ubch5b~ub
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
257
structure length
255
Chain Sequence
CLAYDEAIMAQQDRIQQEIAVQNPLVATLAPFSILCAEYDNETSAAFLSKATELSEVYGEIRYIRGDGNCFYRAILVGLIEIMLKDRARLEKFIASSRDWTRTLVELGFPDWTCTDFCDFFIEFLEKIHSGVHTEEAVYTILNDDGSANYILMFFRLITSAFLKQNSEEYAPFIDEGMTVAQYCEQEIEPMWKDADHLAINSLIKAAGTRVRIEYMDRTAAPNGGWHYDIPSDQIAPEITLLYRPGHYDVIYKKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin thioesterase otubain-like
publication title E2 ubiquitin-conjugating enzymes regulate the deubiquitinating activity of OTUB1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase regulator
total genus 95
structure length 255
sequence length 257
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2013-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1300.20 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases 3 helical TM bundles of succinate and fumarate reductases 4ldtA02
3.30.200.60 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ldtA01
4DDIA 3VONA 4FJVA 4DHZA 1TFFA 4DDGA 4LDTA 4DHIB 4DHJA 4I6LA 2ZFYA
chains in the Genus database with same CATH superfamily
4GH2A 5C1QB 4QTBA 4QNYA 4YSXC 1XQZA 3EL8A 3QYZA 1L3RE 1S9IA 4PTCA 4RVTA 4A4OA 4K1BA 4WO5A 2YJSA 3FPQA 4BCOA 5E8UA 4ACGA 1ZYDA 4IM3A 4DTKA 4C58A 3DOGA 4K18A 4LRJA 4EBWA 2WTIA 2XCKA 4IB0A 3RINA 2XZSA 1NEKD 3ORXA 3W0SA 4BTJA 3PA3A 3D0EA 1ZMWA 2AEGA 4FKOA 4O2PA 2PHKA 4TWCA 4DH5A 1LPUA 4J1RA 2WTWA 4MXCA 3FZSA 3BLAA 3RPVA 1QCFA 3BYSA 4BVUA 2PVHA 3ZOSA 4HJOA 4I6FA 3AE7D 2OXYA 1T45A 2V5QA 3QQFA 4TW9A 3A7IA 4FTTA 3UP7A 1H0WA 2BAQA 4FK6A 1L8TA 3OP5A 4JX3A 4TXCA 4HZRA 2RF9A 4IX4A 3P5JC 3AE6D 1R78A 4NYEA 4BTFA 2W1CA 2JDTA 3W2PA 5HG5A 4DGOA 1TFFA 2HZNA 2UZNA 4MWIA 5KCVA 3AC2A 4EOMA 5IG1A 3GOPA 4YTHA 4BYJA 3VJOA 1YQ3D 3GP0A 5FBNC 4F9CA 2ZM1A 2WELA 4AX8A 4L01A 3AE8C 2DS1A 5FTGA 2B76D 2VWYA 3PY1A 5E8SA 4O7ZA 3LCDA 4FE2A 2ITZA 1G8KA 3G51A 4JG6A 1GIJA 4MH7A 4YTIA 3QCXA 4MAOA 3KF4A 3E88A 2BVAA 3PWDA 2G15A 2BZKB 3BE9A 3DV3A 1JKKA 2QO2A 3PXRA 4BTMA 4O81A 3MVMA 4UBAA 3P4RD 3FZRA 4ZY4A 1FBNA 3H3CA 4GVAA 4FV4A 4YXDC 4QPAA 2QOBA 5LVPA 4ZXTA 4HVIA 3F3ZA 2Z7QA 3BI6A 2PMOX 4NJDA 3VN9A 1OPJA 2QOCA 3COHA 3V5WA 3D94A 4DE4A 2WD1A 3I4BA 3PWYA 4FZ6A 4XRJA 1SVHA 2PUPA 3E8DA 5EYKA 2W96B 5AP2A 1OM1A 2C47A 3QRJA 3WZDA 1IR3A 4CCBA 4YTMC 1OL1A 1PXMA 2B9IA 4A06A 2QLUA 5T3QA 3QWJA 4I23A 2GU8A 5DNRA 4DF3A 3GEQA 4C2WA 2EB3A 1BMKA 2WU5C 3Q52A 3MFRA 2FH9A 3QKMA 4NIFB 5JFWA 4PL3A 5IMEA 4QP7A 4MEDA 1W8CA 4UB7A 3CSVA 2R9SA 3OY1A 5J9ZA 3S00A 4Z16A 3IW4A 4D2RA 2XM8A 4YJTA 4YU2A 3O8PA 1UKHA 5ANJA 4FIJA 1DI8A 2PULA 4FTOA 3FXWA 5EQPA 3HA6A 2FUMA 2XKCA 3ANQA 2QOIA 3HLLA 3OCTA 4L52A 3SXRA 4AXDA 3Q5IA 3TUDA 2QVSE 5AP7A 5EH0A 5JH6A 4QMLA 3A2CA 4D4SA 4LRKA 1E7PC 2C1AA 4EOIA 5LVMA 4KX6C 5CY3A 3ZM4A 2VN9A 3PP0A 4AU8A 2WXVA 4S32A 1H28A 4FGRA 4BKJA 2R5TA 5KX8A 4TWPA 2WU6A 2KULA 3C4WA 3A99A 3GXLA 3NW7A 5ACKA 3CLYA 1SYKA 2WTDA 4O27B 3VW6A 4BHNA 3AGLA 1ZYSA 3CEKA 3HAVA 1KOAA 2B0QA 3DBFA 4YJVA 1JOWB 3VUDA 4RA5A 3D9VA 2Z7RA 2GNFA 3I0QA 2HXLA 1AD5A 4S30A 4BJJA 5IA1A 3LFDA 1I44A 2F7EE 3GCQA 3FLZA 4C34A 3VS2A 2KTYA 3OEFX 2BRHA 5ANDA 2WTKB 4UYAA 4E5AX 3UPZA 3BYOA 3L8SA 2QG7A 4XNEA 2VNYA 3MWUA 2YITA 3IG7A 3KMWA 3A60A 4KRCA 5CU2A 5TKDA 3S0OA 5FP5A 2Y0AA 3C9WA 3EHAA 4RG0A 4XCUA 3FI3A 4YJQA 3R7VA 3W8LA 4AE6A 1J91A 1P5EA 4EOOA 5M09A 3GU4A 4Q9SA 4HOKA 4XP0A 2WEVA 3IS5A 2ETKA 4QNAA 3P0MA 4ANBA 1XH8A 5LARA 4ONAA 5JFSA 2GNGA 2HIWA 4AT5A 2R3IA 3E64A 4AE9A 4ANQA 2UVYA 3UNJA 3FUPA 4F6UA 5CEPA 1ZYLA 5K4IA 1GIIA 1OB3A 3QA8A 3VBYA 2JITA 4AQKA 1Y57A 3LQ5A 3OVVA 4IM2A 3SX9A 4XBUA 4YTPD 5T6KA 4CG9A 2QONA 3VW8A 1MRYA 3DT1A 4E6DA 2XAMA 4D4RA 5FD2A 2VWWA 4QMWA 1BX6A 4RIXA 5AUYA 2VTOA 5AP6A 4IFGA 3ZMMA 2C6EA 2PVNA 2Z02A 2IW8A 3UTOA 1OL6A 2BUJA 3TT0A 5I9VA 3ZHPC 5BUJA 4CT1A 4IB1A 4IZ5A 4GKIA 3VRAC 3A62A 4A9SA 3FLWA 3KK8A 4EUUA 3QTWA 4O38A 5C9CA 4YUQA 3ETAA 4YJSA 4BBEA 4O86A 3V6SA 5BMMA 2CNUA 3BHYA 4FKUA 3N4TA 2C69A 4EZ3A 1M14A 2GTNA 3CBLA 3TTIA 3HDNA 2ACZD 3F3UA 3R1SA 3BZ3A 3ODYX 4BDEA 3KXHA 4CFMA 3R7EA 3PXYA 4I0SA 1UKIA 3P4SD 4LYNA 5B7VA 5JK3A 3CC6A 2XYNA 3G0FA 4YJPA 3RAKA 3B8RA 3RHKA 4L53A 5M44A 1XH7A 3VS4A 2QC6A 3AE5D 3QD3A 4M13A 4RIYB 5LMAA 4BICA 4AGCA 5LQFA 4K0YA 3GBZA 4UEUA 3R73A 2QOKA 3GVUA 3QALE 1PXIA 2A27A 3LQ3A 1PY5A 3QZHA 1PKGA 4FKLA 3VS1A 2QU5A 4AGWA 2XNPA 1P4OA 4CTBA 4EUTA 4F1MA 5AV0A 4J53A 1OI9A 5CNOA 5IDNA 2I6LA 1IA8A 4BCKA 4J99A 4EK6A 5IPJA 3C4FA 3PJ1A 5EYMA 4O7WA 3OZ6A 3U55A 1BLXA 4YT0D 4OBPA 2PZYA 2XNGA 4TN6A 3ZS5A 2B52A 3DJ5A 4APPA 4MWHA 2FO0A 4CCUA 3D2KA 4ZSLA 2B4SB 3Q6WA 3R63A 3WE8A 4H1JA 3DCVA 2HW7A 3WF7A 4PUZA 4ITIA 4C33A 2XS0A 3DY7A 4I21A 4PRJA 3F5GA 3I6UA 4RJ6A 3E3PA 4L6QA 4BGHA 3S4QA 1OPLA 2JAMA 4RX9A 3FQEA 4AZWA 2HELA 3OBGA 5HCXA 4RPVA 4IZYA 5HNIX 3GGFA 5CU6A 2IVUA 3UC4A 1R0PA 4FZAB 4LQMA 2X9FA 2JKMA 4N4SA 4ALWA 3ORLA 1KFYC 4FV6A 3VBVA 3BIZA 2VWZA 5C8NA 5HE1A 2G2FA 5HBJA 2C3KA 4EH2A 3AE3C 3W2SA 4QTCA 2ZV2A 2UZEA 3MH1A 4II5A 3IDPA 3MSSA 5FM2A 4HVSA 2YM6A 5JFVA 3FMKA 2WU2C 4AZTA 5C2TD 4FTUA 2RFNA 5CSWA 1YWRA 3O8UA 5HQ0A 2XF0A 1ZP0C 1YQ4C 2B9JA 4FODA 1J1BA 3QQHA 4I94A 4QOXA 3V5JA 3LFEA 5HGIA 4ENXA 3CR0A 2J5FA 2CN5A 3T9TA 3TN8A 1W82A 5AUUA 5J7HA 3TTJA 4C37A 2PYWA 2WZJA 4ZJIA 3WZUA 2VU3A 1BUHA 3DAEA 3KXZA 2R3RA 4GK2A 3AE2C 3F6XA 4C4GA 2IWIA 4NFMA 5J95A 1A9UA 1UU3A 2Q0NA 3HUBA 3O96A 4GCJA 3F69A 1APME 2DQ7X 2YM3A 4YLKA 4AA4A 5ETIA 4FL2A 3TZMA 2C3IB 5ETAA 2XJ2A 2B55A 2X4ZA 3QXPA 3PE2A 4YNEA 3LCKA 4CMOA 4C4JA 1QLBC 3QKKA 2V7OA 3TIZA 4ACHA 3R2BA 2WMQA 1G8AA 5M4CA 3G33A 3C50A 3IK3A 3K54A 1RQQA 3EN4A 4I5HA 4G6OA 4A9RA 4EH7A 5C26A 3SDJA 3G2FA 1JNKA 2E9PA 3FL5A 4RQVA 3NGAA 3DLZA 3FZOA 3NCZA 5EW3A 1VR2A 3PIXA 3DFCB 4KRDA 4U97A 4F65A 3H0YA 4NFNA 4O82A 5DYJA 4XP2A 4M69B 1H27A 3DBCA 3JVRA 5LXMA 1KE6A 1XBBA 1SNXA 4DHFA 1M2QA 3DFAA 4BDCA 3GC7A 4FV3A 3EFKA 1JSUA 4FTAA 4QTAA 4K2RA 4UWCA 2PUIA 3TXOA 4TWNA 4LDTA 4JOAA 3KB7A 4PDOA 5E4HA 4UX9A 2ZFYA 2BR1A 4S2ZA 5L2TA 4FYNA 3QX2A 5EI2A 2YZAA 3D4QA 4XLIA 3AQVA 3U54A 3OTVA 4E6QA 2RGPA 1OMWA 5A14A 5B2MA 2PWLA 3DXQA 4XLVA 3ATTA 4D1ZA 4EBVA 1QPEA 3Q4CA 1QL6A 2UUEA 3SLSA 3FDNA 4OTFA 2WDVC 2V22A 3KVXA 2JIVA 4D0WA 3II5A 3MY5A 4RA4A 5AJQA 3WE4A 3OT3A 3MS9A 2CGUA 3LXPA 4O96A 3ERKA 3A7FA 4LMUA 4G9CA 4PDPA 3EJ1A 4P5QA 4WUNA 1WMKA 5A4LA 3AEAD 4BRXA 5HLNA 5E7RA 4S34A 2XEYA 4M14A 2C1BA 2WQNA 5IQDA 5KKRC 5KMKA 5CU3A 3ACKA 4W8EA 2VX3A 3R04A 3BHVA 4G3DA 4FNXA 2O63A 1YVJA 4RFMA 5C01A 4GYIA 3P08A 4RVLA 3UDSA 2R4BA 2YCQA 2WEIA 4WSYA 4UALA 2YA9A 1BI8A 4AACA 5FLFA 2ZV9A 4CVAA 3JVSA 4WA9A 3V01A 3G6GA 3GC9A 2H89D 3AEGD 2CKOA 4P90A 4DEEA 4RIWB 1NXKA 2QURA 4PMPA 2Y6MA 3QCQA 4EOQA 4JR3A 4BCPA 4CQEA 2JFLA 3HKOA 3PIYA 4FX3A 1CKJA 3TKIA 5IUGA 3AMYA 4I5CA 3HGKA 4DFXE 5ANIA 5DT4A 3KXGA 3ORTA 3MYGA 4YJOA 3P4PD 4Q2AA 3MFUA 4U9AA 1UWHA 2J0IA 1SVGA 3ZLSA 3BBWA 2OZAA 2JDRA 4DTBA 4APCA 3EQBA 2QODA 4QTEA 3W2OA 4LI5A 2W4OA 3D7ZA 4CFUA 3BLQA 4FTJA 4X3FB 3E7VA 3MA3A 3MH0A 4F4PA 4DYMA 3QQJA 1S9JA 4MQ2A 4JIKA 4KSPA 3CTHA 2C3JA 4GFMA 2OXDA 2VNWA 5IQEA 2ETRA 1WVXA 3R2YA 3AEDC 3IGOA 4RC3A 2X6DA 4S33A 4O0WA 2X4FA 4RFYA 4M8TA 4F7SA 4YTND 1TQIA 3OOMA 4RMZA 2ITTA 3VS6A 4X0MA 4ZTRA 3FC1X 2QR7A 2NRYA 2HYYA 4AA0A 5KMNA 3E5AA 4LUEA 4M97A 3HV6A 4RWLA 2BDWA 3NRMA 4BC6A 3F2AA 4ZS0A 4Y5QA 5TF9A 3AKJA 3WF9A 4BZOA 3PXZA 2GMXA 2J7TA 3CKWA 2VV9A 4ZSEA 5I4NA 3EQDA 3FZPA 1STCE 2XIRA 4QPSA 3R8VA 2A0CX 4TTHB 4EK8A 3GU5A 2UZTA 1NW1A 4I6HA 2CKQA 2OH4A 3ML1A 4CFFA 3REPA 4GJ3A 3P4QC 4R7IA 4UY9A 3W55A 1G5SA 1PXLA 2PMIA 3LZBA 3U6JA 3AECC 4QMTA 4PDYA 4FK3A 4MNEB 3CIRD 4GL9A 3IW8A 3MJ2A 5IQCA 3HMIA 3UZTA 3DB6A 3NUAA 3TV7A 3K3IA 2IVSA 5DT0A 2CGWA 3ZC6A 4YZNA 4N57A 5BQ0A 1U59A 3MB6A 2X1NA 1ZOHA 3QKLA 4RJ4A 5GJGA 2XNMA 3PSDA 5AX3A 2XK3A 4WKQA 3NUNA 2HOGA 1PMNA 2WMUA 4TYHA 3RPYA 3PXFA 1UNLA 2XUUA 3DQXA 3NW5A 3FC2A 3DTWA 3EMGA 2CKEA 3KRRA 4D5KA 1YOLA 4FV8A 3DK7A 3MFSA 2E9OA 2C6LA 2G1TA 2HZ4A 3FMNA 3AEEC 3GU8A 5EHYA 5CENA 2GS6A 2VGOA 1JAMA 3HX4A 3FSFA 2R3JA 3JYAA 4EHZA 1YXVA 1ZMVA 3QLGA 3VF8A 1B6CB 3KKVA 4I24A 2ITUA 3R0TA 3JY9A 2BIKB 3R9OA 3ABVD 3VBTA 3Q2JA 3W0OA 5DRBA 4DG3E 4ASXA 5A6NA 1OBGA 4DG2E 5CAPA 1K3AA 3FI8A 4QP6A 1OL2A 4EK3A 4BDIA 4RJ5A 3MPTA 5BVDA 3ROYA 3HEGA 2PVMA 2XBJA 4G3EA 1OVEA 3VNTA 5EW8A 3FLSA 4JBQA 2YIRA 4A07A 3VHEA 3AE4D 2W06A 4BBFA 2X6EA 3LMIA 4GVJA 5CSHA 3UBDA 5HZNA 3I81A 4CV9A 3IW6A 4GG5A 3C13A 4JDHA 3TUCA 3QCYA 4ZMEA 3GB2A 1FOTA 1GY3A 4GG7A 4F9AA 5BV3A 2PSQA 1ST4A 3C4ZA 3PZHA 4GIIA 4ZS4A 2WDRC 3V04A 4YMJA 2BALA 4FSUA 3R7IA 3QC9A 3PA4A 3CY2A 3EFLA 2WO6A 2VTSA 3A4PA 5CI6A 2PMNX 4IX6A 3F7WA 3UNZA 4HGTA 1E1VA 4FV7A 4J52A 4YSJA 3UIUA 3ZO4A 2HAKA 2XB7A 1CSNA 1PXJA 2GS7A 5KHWA 3Q9ZA 4GKHA 4Y83A 3GU7A 3PYYA 2HCKA 2YIXA 3V51A 2FSTX 4IB3A 5HX6A 5FRIA 2O3PA 4PDSA 4DFYA 4LV5A 2GFSA 4ANSA 5AV1A 3MPAA 3PG3A 3UDZA 2OJ9A 3ZEPA 3VR9C 5EM7A 4YZ9A 5DOSA 4G3CA 1ZYCA 3TJDA 2JC6A 1KOBA 2F2CB 4L45A 2YM4A 5LMKC 2R3LA 4KS7A 5KMJA 3ZO3A 3PA5A 1YW2A 3GOKA 5HLWA 5CSVA 4LOOA 3SW7A 2XMYA 2QO7A 3BE2A 2OGVA 3CTQA 3DBDA 3HV7A 2CNVA 3IW5A 3I7BA 4GJ2A 3SGCA 4F78A 4EQCA 3EN9A 4D4VA 5FG8A 3PJ3A 4M12A 4NM3A 5GJDA 5EM6A 4ZIMA 4BCHA 2G9XA 2ZJWA 4FG8A 3ZFXA 4AAAA 3F9NA 3H9RA 1H1WA 3EN6A 3R02A 3VHKA 4RX8A 5EYDA 3N9XA 4G9RA 4YZBA 2BFYA 4ZEGA 4Q5EA 5I9UA 4QMNA 3F3WA 4NW6A 4RQKA 3RK5A 3OCGA 3UOKA 2VWIA 4YSXD 2WGJA 4JLCA 5M4UA 2QNJA 2R3QA 3AG9A 4WD5A 3I0OA 1P14A 2AC5A 4XRLA 3ZLWA 4BDDA 3ZSGA 1U54B 5EKOA 2GHLA 4XP3A 3O50A 4RJ8A 4JL9A 4NJ3A 2PZ5A 3G0EA 4B6LA 3FYKX 1ND4A 3FHIA 4NTTA 3HVCA 4ZMFA 2WIHA 3U51A 1K9AA 5KMLA 5LMKA 4UWYA 3PRFA 4BF2A 5I9WA 5C27A 5FUTA 2PUUA 4H3BA 5CWZA 4F6SA 4NWMA 3HRBA 2W17A 5CLPA 3H9FA 3OFMA 5J87A 3TG1A 4I5PA 2CGXA 3PP1A 4R3CA 4XV2A 5J5SA 4UZHA 1H8FA 5CEOA 3TEIA 4ACMA 4O0TA 4RIYA 2XIXA 5IMXA 4FSMA 5TOZA 4QQ5A 5CX9A 4FIFA 4Y72A 4WT6A 3FLNC 4ZLZA 4EEVA 1J7UA 1XWSA 3QFVA 2BMCA 4NZWB 2GNIA 3ZLYA 4FR4A 3V8WA 2E9VA 5AV4A 4AW5A 4JR7A 4DGLC 5KBQA 5AA9A 4U43A 3OXZA 2PE0A 3FSKA 4JI9A 4KIPA 4A9TA 3GENA 3Q96A 2R64A 3R1YA 4JQEA 4NM0A 1YWVA 5IUIA 1YXXA 3KC3A 4TY1A 4IFCA 3B2WA 3DNEA 4OTDA 3AE8D 2QKRA 4XV3A 4YSMA 3V5QA 4AGDA 4EKLA 5IEYA 4V05A 3KXXA 3UDTA 4WBBB 4R78A 4IWOA 4FKVA 4U7ZA 3EQRA 4E4LA 4J96A 4GRBA 2VGPA 2VO7A 1XBAA 5E90A 3NEWA 5I9ZA 5I9XA 1ZAOA 4Z7GA 4BB4A 2ZMDA 2CJMA 4TL0A 4YXDD 5M07A 4IAFA 2WQEA 4E5BA 5A54A 5IDPA 4FSTA 4R6VA 4AXAA 5EI8A 2RG5A 4M15A 1YOMA 2XNNA 2XCHA 2C6KA 3MB7A 5H3QA 3PLAE 2C68A 3NYXA 4PMSA 5E91A 3V6RA 4BI2A 2XP2A 5HBEA 3KN5A 4O21A 4MVFA 2W1ZA 1M17A 4AWIA 3D83A 2JLDA 4N70A 2X2MA 5HU3A 3NS9A 2ZMCA 2ERZE 4YTMD 1Q62A 5T68A 3LIJA 4DFUA 5F20A 4S31A 3TNWA 1OECA 4DDGA 2O8YA 3ZUUA 2WU5D 4YHTA 4C2VA 4U40A 2PU8A 4PX6A 2ZYBA 3S95A 4AW0A 2VO0A 3RZBA 1H25A 4DG0E 4LV7A 5DIAA 3UOLA 2WOTA 3QBNA 4JVGA 4BY9E 3NUPA 5CTPA 3CQUA 4RJ3A 2P2IA 4QEBA 3M42A 3FAAA 1VEBA 1PMUA 3NFGB 5M55A 2PVFA 3MI9A 1GIHA 1FVRA 3LAUA 2LGCA 4RFZA 3RGFA 4AG8A 1XO2B 1DAYA 3PIZA 2QLQA 3UNKA 4UV0A 3QD2B 4ARKA 5E8WA 4ZTLA 4FTLA 4YBJA 3R8ZA 4CV8A 3JUHA 3MVLA 4KX6D 4QMXA 5EKNA 4L67A 3KK9A 2FGIA 5EHOA 5AIKA 3DS6A 1YWNA 3UPXA 4F63A 1WCCA 1H0VA 2IZTA 1Q3DA 4FNYA 3CQWA 1R3CA 2X7FA 3DTCA 5M08A 1Q8TA 3BWFA 4A7CA 1YQJA 4B7TA 1UWJA 5L2IA 3OROA 4FNZA 4I0RA 3FHRA 4FT9A 1Q8WA 3VQUA 3VULA 4N6ZA 2XKFA 4MX9A 5HTBA 1IASA 2C30A 1JBPE 3AE9C 2WQBA 3QL8A 2OIBA 3HRFA 1MQBA 5AWMA 4I6QA 1SNUA 3TCPA 5AUWA 3V8TA 1XH4A 1RDQE 4K9YA 3NLBA 4H3PA 2HZ0A 3IONA 4FEWA 4QDEA 2QOOA 2PZIA 4Y95A 4MQ1A 4LRMA 4O0VA 2OH0E 5DN3A 4IHPA 4LFIA 3FXXA 4EONA 3GCSA 4FT3A 3BYMA 3ORKA 4MXXA 2VWXA 4MBIA 4O2ZA 2P0CA 1Q3WA 3PJ8A 1FINA 4BCMA 3QQLA 5HNGA 3UG1A 3G90X 4BBMA 4H58A 1FGKA 3ELJA 5IQHA 4K6ZA 3QTUA 2Z60A 4MTAA 3I5ZA 3U8WA 4IVDA 4DCEA 4QYEA 3OUKA 2IW6A 4DEIA 5HD7A 2XEZA 4PL5A 5HLPA 4NM7A 1KE7A 4UZDA 2ITNA 4WG3A 4CGAA 5TT7A 4C4IA 3T9IA 4AXCA 4PP9A 5CSPA 4GT5A 3F3TA 4QDVA 2OBJA 2H9VA 3BX5A 3OWPA 4RT7A 2C4GA 4HYSA 4ALUA 1WBOA 2WKMA 4D4YA 4OBQA 3F7ZA 5JSMA 3VRAD 4QMQA 4NM5A 3SKCA 5F94A 4ASZA 5GIOE 2FVDA 2Y4IB 3WF5A 5EDRA 4DH8A 4NTSA 1E9HA 2G2IA 3C5IA 3MIAA 2OFUA 5CS6A 5AP3A 3W18A 3ZUTA 4E20A 4FTQA 3OWKA 3TKUA 4FKWA 4DH1A 2WMAA 2JGZA 4O6LA 3GC0A 1ZWSA 3RMFA 4FSRA 4KABA 3QGWA 5D11A 3WILA 4X2GA 1W98A 1URCA 5DI1A 4JQ8A 2JKKA 2BS3C 2BPMA 4JS8A 3OY3A 2OF2A 5FXQA 3ZZEA 1RW8A 5GHVA 4QP3A 1YDSE 2NPQA 2CNQA 2VWUA 2YDKA 5DH3A 3ZUVA 1VLRA 2ONLA 2WAJA 3ID6C 3QWKA 3QQKA 4C35A 5L8KA 5CF8A 2J51A 1YXSA 4J71A 2Y7JA 2IVTA 2FSMX 2JKOA 3RK9A 3TNQB 2IZUA 2PVYA 3KF7A 4F1TA 5HO7A 2ERKA 2XAOA 3E8NA 2GSFA 5BYYA 4F0GA 1F3MC 3W2RA 4YHFA 2VTPA 4KKEA 3WZEA 5ANGA 4FL1A 4X6QC 4L7FA 5E8TA 2GHGA 4BTKA 4MD7E 4PMTA 2UW9A 5EG3A 3Q4ZA 1H01A 4EJNA 5JMSA 4JG7A 3GU6A 3LJ1A 4J98A 1YI4A 2J0MB 3OW3A 4FV9A 4C7TA 4FIGA 4OTRA 4O0YA 2ITOA 4C59A 4DFZE 3SFDC 4YO4A 4C4HA 5JFXA 4O7TA 2WFYA 4USDA 4FUXA 1OUKA 2CN8A 3O51A 3JPVA 5LCKA 2X8EA 1RE8A 2E9UA 4TYGA 3W8QA 4AXFA 5TO8A 3LCOA 3WIGA 4IWPA 5M4IA 3HMNA 1ZOYC 4DHIB 2VTQA 4IIRA 4QT1A 5I0BA 2PE2A 4FGBA 2XH5A 3BU3A 3DXNA 3KFAA 3KCFA 5JT2A 3F5XA 3SA0A 3NUYA 2DUVA 4IC7A 4JDIA 3D14A 4O7SA 4U81A 5E8XA 3ZLXA 3TNPC 4ERWA 1KFYD 5K3YA 3V5LA 2VTHA 4XH6A 4KD1A 3RCJA 5BUIA 2O64A 5AAGA 2UW7A 4FSQA 4ZK5A 1F0QA 3AE3D 4OLIA 3MFTA 5CQUA 4CNHA 3ZDIA 2BTRA 4NK9A 4AFJA 4M67A 1X8BA 4CTCA 2WU2D 3IPHA 1ZRZA 3R9HA 1PHKA 3HA8A 4ZOGA 5AP0A 3UIXA 1ZP0D 2OK1A 4HNFA 2R3HA 1YQ4D 2PZPA 3NNWA 5JRSA 3KCKA 3PSCA 1VYWA 3UOJA 2YWVA 5EOLA 5B2KA 3BGQA 4WRGA 1OIUA 3OCBA 4F09A 3D7TB 4DEBA 4JBVA 3O8TA 4O0XA 3FPMA 4QYFA 5LMBA 1SM2A 4XV9A 3VS0A 4RBLA 4M84A 3AC8A 1H1PA 3SHEA 3Q4TA 4GYGA 1MRUA 3THBA 4FT7A 3AEBC 3AE2D 4W4WA 2XKEA 2SRCA 3NAYA 5FXRA 5FM3A 4YJRA 4I22A 4WRSA 3PG1A 4RVMA 4W8DA 3V5PA 3S3IA 4U6RA 2W99B 3AKKA 4C0TA 2I0VA 2YAAA 3P7CA 5DG5A 4BDHA 3AE1C 1J1CA 4FOBA 3RWPA 5EM5A 5HD4A 5HIEA 2F9GA 3BWJA 1M7QA 4YLJA 4O0SA 4GSBA 5AUXA 4BCFA 4TNBA 4BDAA 2BHEA 1KUTA 1Q8YA 2C6TA 4EHGA 3NR9A 5I9YA 2WMRA 5CALA 3COIA 4ALVA 5A4QA 4CXAA 3ET7A 3RK7A 4FV0A 4O22A 1PJKA 2WOUA 5HTCA 3EYHA 1H26A 2W1EA 4C38A 5G1XA 4EYJA 4PL4A 1PYEA 1NENC 2QU6A 3F3VA 4HGLA 3KVWA 3R83A 4YZDA 4DBNA 1ZZ2A 5JGDA 1BL7A 1PMEA 2AUHA 5J9LA 2F4JA 3FMHA 1XMMA 4XG9A 2WMXA 3HMPA 2CPKE 3O2MA 4JX7A 4N6YA 4E4NA 2PK9A 5FDXA 4RSSA 3WZKA 3DAKA 3I79A 1M2RA 3CQEA 1YDRE 2PVKA 3EQGA 4R1YA 5AP5A 3RVGA 3SW4A 4MBJA 2GQRA 4FTKA 3B2TA 4TZRA 2W1IA 3GUBA 4ZZMA 4EOLA 2CMWA 2ITXA 3FMJA 5CQWA 1M2PA 5JGAA 3NW6A 3WARA 4BGQA 2WDVD 2C0IA 5HE0A 4GUBA 4XEYA 3WI6A 3TMOA 5ANKA 2YM7A 4EOJA 5GNKA 2FB8A 4I92A 1JKTA 2DYLA 3DKOA 4B99A 3G5DA 3PY3A 2QOLA 3ZBFA 3R22A 2WS3C 3C5UA 2C6OA 2B7AA 2Q0BA 4GEOA 1B38A 1V0PA 2RFDA 3ZRMA 1KV2A 4YURA 3KL8A 4DDIA 3K5UA 3LMGA 3NUSA 5CXHA 3QHRA 4DFNA 3VUIA 4M0ZA 3BEGA 4I4EA 1MP8A 4OTQA 3EQCA 1NVQA 2RFEA 4EJ7A 3DXPA 3A8WA 4XG8A 4TYIA 2VWVA 3N4UA 4IX5A 2BS2C 1ZOEA 2IN6A 3OEZA 1YKRA 2OU7A 2GTMA 4ID7A 3O23A 4EI4A 3F61A 2GS2A 3ZO1A 5DFPA 1ZY5A 3I1AA 4PQNA 5JKGA 3L9MA 4KAOA 2EUFB 3ZU7A 3NVKI 3VONA 5I5ZA 4IVCA 1K2PA 4J95A 2VAGA 2VX0A 3OT8A 4W4YA 1PYXA 4LV8A 5DBXA 3B8QA 3UMWA 4F7JA 2X39A 4L43A 3EFWA 2BDJA 4KKGA 3ZSHA 4FUYA 4F99A 4PWNA 4CD0A 3ANRA 4EZ7A 2BAKA 4U5JA 4J7BA 4Y5HA 3DZOA 4BYIA 2OIQA 5DPVA 1U54A 4F0FA 3MIYA 3LQ8A 3PE1A 4HYIA 4O0UA 4M0YA 2QHNA 3EYGA 5H8GA 2UVXA 3GT8A 4FSZA 5IEVA 3C7QA 4IAKA 2QHMA 2XKDA 3AEDD 2Y4PA 3K3JA 3W0RA 5CAQA 2XIYA 5E8YA 4HZSA 3CCNA 3HV4A 5TR6A 1W84A 3TWJA 3C0IA 4FTRA 1REJA 2YZLA 3AGMA 2XK9A 3PDTA 2VO3A 2Z7SA 3CY3A 4U79A 5D1JA 3R7YA 5CAUA 2WTCA 2X0GA 4G3FA 3EQIA 3R00A 1WZYA 5CZIA 4I20A 4ANMA 5IU2A 2PVLA 5JRQA 4WIHA 2C5NA 1DAWA 4XOYA 4DLJA 2R3NA 1ZY4A 2WMBA 2X7GA 3ORNA 4IC8A 4JIAA 4LOPA 4U8ZA 4V0GB 3KRWA 4K77A 4DH7A 3TL8A 3BL7A 3PVUA 3QUDA 2XNOA 5CT7A 1I09A 5DHJA 3G15A 3FE3A 2ZV7A 3KMMA 3PJCA 4G3GA 1YXUA 4FIIA 2GFCA 4U0IA 4WBOA 2YCSA 2OO8X 5DVRA 5IQIA 5K5XA 3P4QD 4F9BA 2H34A 4BJJB 3D15A 3AECD 4PNKA 3FQHA 1Y8YA 4G5JA 4HGSA 1U5RA 5D41A 1JKSA 2JAVA 1R0EA 3D5XA 3QGYA 2VWBA 2C3LA 2VTNA 3H0ZA 2UZBA 2QR8A 5D12A 1IA9A 3UIMA 5ICPA 4QQTA 2J0LA 3VRBD 3KN6A 5IA4A 3EN7A 5K4JA 3HV5A 4DLIA 3JY0A 5DEWA 4BZNA 4QYGA 3PFYA 5A6OA 2VTTA 4IB5A 3HAMA 4X2NA 5DRDA 5CU0A 5DA3A 3NYVA 3UG2A 4F08A 4JAIA 4GFOA 3EWHA 4ZY6A 3VUGA 4QMVA 4EOSA 3W33A 3Q32A 4FYOA 3DKCA 3DDQA 4O83A 1PF8A 3NNUA 4QMZA 3VJNA 3MBLA 5AAEA 1L0VC 2C6MA 3CKXA 3MVHA 4PY1A 3RNYA 1HCKA 3VVHA 5C3JD 3NWWA 4IH8A 1ATPE 3LVPA 5AAFA 2I40A 5AM6A 2JEDA 3VBQA 3ZONA 1VJYA 1M7NA 3KULB 2P4IA 4BR3A 2HY0A 3D5UA 5IH5A 5LVNA 4DFBA 1OUYA 2JDSA 5M53A 5CEMA 1Y91A 1UV5A 1DM2A 1FVTA 5FEDA 1TKIA 3TJCA 2WP9C 1REKA 2OWBA 2RIOA 3AXWA 5DGZA 3DJ6A 2VTLA 4B9DA 3ZSIA 4WG5A 4IDTA 4BN1A 2YDJA 3C0HA 2W5HA 2C0OA 1H1SA 3ATSA 2UV2A 2WDRD 3BU6A 4FC0A 4U41A 3NNXA 5ETFA 3W2CA 2Q83A 5M57A 2IO6A 4FKGA 3V8SA 2YACA 3FEGA 3HRCA 4FKPA 2ITWA 3GCPA 1BL6A 5HO8A 3W2QA 4MD9E 2UZWE 1JSTA 3IOKA 3VO3A 4D9UA 4TPTA 2RL5A 3ZRLA 1HCLA 4YSZC 4EH6A 2CLQA 3CP9A 3W0NA 3PJ2A 3FKNA 5L3AA 2ZAZA 3BQRA 3ULIA 3QQGA 1XR1A 2UVZA 1RJBA 4C4EA 1XHAA 5F1ZA 2PPQA 2XIKA 4YGAA 3SD0A 3OCSA 3ZXZA 2W5AA 2XRUA 2WMTA 4QQCA 3VR9D 3SOCA 4BDKA 1FMKA 4FA2A 2ITPA 4UXLA 5HHWA 3SG9A 2WMWA 1IAJA 3ZRKA 4TKSA 4BZDA 4FKTA 2EWAA 5FEEA 3C1XA 4BDGA 4EHEA 4EK4A 4YLLA 4EZ5A 3DAJA 1CKPA 3OW4A 5BVNA 2FSOX 2YM5A 2WTKC 4E4XA 2A1AB 3CTJA 3VF9A 3QXOA 2YDIA 4FKIA 4YP8A 3QTRA 4H05A 5IQGA 1JLUE 4PTGA 3LFQA 5CF6A 2H88C 4AZFA 4IZ7A 4UXQA 4ZSAA 4R1VA 4I41A 2CSNA 3QQUA 1PMVA 2BAJA 1PXKA 2YCRA 4FT0A 3AC3A 5AEPA 2UW4A 4Z9LA 1ZZLA 2H8HA 3DNDA 4R5SA 2FBWC 3PUPA 2C5YA 5CYIA 5E1EA 3IKAA 2WQMA 3NX8A 1CMKE 4QRCA 4L3PA 3SV0A 4BI0A 4LGHA 4H3QA 5AP4A 2WMVA 3RJCA 1URWA 3C4EA 4AZVA 2EXCX 4CFXA 4OTWA 4D55A 1Q99A 3O5AA 5LCJA 2EB2A 5BVFA 1WFCA 3BV2A 4IAIA 4N0SA 4DN5A 4HCVA 3SXFA 2RG6A 2EXMA 1XKKA 4KBCA 4LOQA 4OT6A 4IACA 4AAYA 3NZ0A 3MH2A 3MTFA 1NVSA 4XX9A 5EI6A 4WOVA 3VR8C 4K8AA 2IW9A 3SVVA 1WBTA 4Y73A 3DBEA 3TV6A 3LXLA 2C5VA 4DEHA 3CGOA 1WBPA 1UVRA 2OJFE 2R0IA 2YM8A 2W4JA 4FTCA 4IE9A 3RNIA 3RPOA 3WZJA 4BCGA 4EH5A 2VTAA 1W7HA 2XM9A 4IDVA 2WQYD 3FMEA 3VQHA 4AUAA 1MUOA 4XV1A 5L8LA 2Z8CA 1XH6A 5KMMA 3VRYA 4EH8A 4XHKB 3A4OX 3Q6UA 1TQPA 2NRUA 3VUKA 3NNVA 2X8DA 4FVRA 3KXNA 3ORZA 4EHVA 3D5WA 5AX9A 3R9RA 3F2RA 1T46A 4EKKA 4GT4A 5K9IA 1OKZA 5KMIA 4FSYA 3RI1A 4U3YA 5GINE 2WDQC 5L6OA 3P4KA 4I0TA 5CEQA 1ZXEA 3LLAA 4MXZA 2C6IA 5CVFA 4G34A 3K2LA 1PW2A 4FG9A 3MPMA 5DT3A 2XRWA 4NSTA 4YO6A 5BVEA 1YHWA 2OJGA 4F1OA 4EH9A 3Q2MA 3Q5ZA 3OG7A 4MNFA 4MXYA 3TKHA 5DWRA 5CEIA 3NPCA 1OITA 1NA7A 2OFVA 3CXWA 1XBCA 3HMMA 2WU7A 4TRLA 1OIYA 4D28A 2YERA 3BV3A 4FBXA 4IX3A 5FTOA 4E5WA 3V5TA 2UW3A 3HMOA 4ZTSA 5IISA 4HPUE 1A48A 2GDOA 3LFFA 3PSBA 5KNJA 4EWQA 5A9UA 2ZDTA 3BHTA 3FMDA 5CVGA 4BHZA 1NY3A 4JBOA 3BRBA 4E93A 3UQFA 4ORKA 3UOHA 2P55A 3SFEC 2X7OA 4XYFA 1LP4A 4YZMA 5IQBA 1U5QA 2ACXA 4KIOA 5CASA 3L9NA 4I93A 5KZIA 3VBXA 1GAGA 4G5PA 4AN3A 3JXWA 2R3KA 3KREA 4KWPA 1KWPA 3QLFA 3F5PA 4F0IA 4KA3A 2J2IB 2ETMA 1WBSA 3HP2A 1ZYJA 1JPAA 1LEWA 3AEFC 2ITVA 4LUDA 4OT5A 3NYOA 1OL7A 5CT0A 3CD3A 2I7QA 1G8JA 2OKRA 3FXZA 5A4EA 4FNWA 4U44A 4YTFA 4ZJVA 4RWIA 1H00A 2R7BA 1A06A 3DK3A 2W9FB 2W7XA 3C4XA 3Q9XA 4HYHA 3TZ8A 2GCDA 4YR8A 2YCFA 4QYYA 3ZFYA 2O65A 5ITAA 3QD0A 4C61A 4X6RA 1YHVA 2HY81 2W05A 3FKLA 4NT4A 2Y6OA 4QMMA 5ANOA 3LHJA 4BDFA 1GNGA 3QAME 3EKNA 4GV1A 3UP2A 3W16A 3A7HA 4DBXA 1XH9A 2F7XE 3ENMA 3I5NA 2FSLX 3MN3A 3PFQA 3QF9A 4LL0A 4IADA 4KINA 5HG8A 3UO4A 4FT5A 2VZ6A 4ASDA 4EQMA 2NNWB 2XARA 3FI2A 3KMUA 4A9UA 5IEXA 3E8CA 1XH5A 3DBQA 3ALNA 4USEA 4CZTA 4ENYA 3BYVA 4YSYC 3RCDA 2WHBA 3AE9D 3R7UA 1VZOA 5AUVA 1PXNA 2HZIA 3A7GA 3CJFA 4GS6A 2R3PA 4RIOA 5HICA 3R7OA 4BCJA 1WAKA 5J1VA 3P9JA 5CNNA 2Y8OA 3EH9A 4D58A 4BDBA 3DDPA 4DHZA 4AN2A 2OZAB 3E62A 4M3QA 5AP1A 2OJJA 1O6YA 4QP2A 4ZZOA 5HI2A 2RFSA 3TDVA 4GK3A 5GJFA 2O5KA 2OIDA 4JAJA 4KBKA 4D9TA 5KKRB 4HPTE 4V01A 3R71A 3U6HA 5IQAA 5HBHA 4OR5A 2B9FA 4IAZA 5JQ8A 3F82A 2W1HA 2BRBA 1CDKA 1FVVA 3QZGA 1OIQA 4AN9A 2IG7A 1CM8A 3AD5A 2A19B 1BI7A 3ZZWA 3LPBA 3QTSA 1GOLA 5HCZA 3R9NA 1KF6C 2REIA 4MXAA 3VBWA 5BNJA 5C4LA 2BS4C 4AT4A 3U4UA 3TNIA 3D2IA 4E73A 1SVEA 2BIYA 4E8AA 3RM7A 2YABA 4KBAA 4KSQA 3TZ9A 3VIDA 3NUUA 1Y8GA 4U45A 3ZDUA 5FQDC 2P2HA 4G6LA 4MHAA 3UGCA 3HNGA 5IA2A 2DWBA 2R3MA 4KIQA 1Q24A 4IANA 2GPHA 3FYJX 3C4CA 5EQEA 4Z3VA 2BZHB 2JDOA 3PLSA 4FEVA 4TT7A 5HE3A 3R28A 4JNWA 1V0OA 5L8JA 2X2KA 3E63A 2E9NA 5M51A 4UWBA 4R7BA 3BLRA 2XJ0A 4YPDA 4EK5A 3VC4A 1WBNA 2YAKA 3ITZA 5EK7A 4TYEA 2B53A 5A4TA 4I6BA 4PF4A 4PTEA 5AV3A 5D10A 4HVDA 3QA0A 3UQCA 4FIEA 2JKQA 4PMMA 3EN5A 4MKCA 4RGJA 2Z2WA 2OG8A 4U3ZA 3O71A 4MYGA 4TYHB 3O0GA 5EOBA 4I5MA 3LKMA 4CKIA 4AS0A 3PPKA 4AW2A 3PY0A 1NEKC 3SRVB 1PXOA 4FKRA 3FY0A 4FTNA 4H39A 1P4FA 4BCIA 1KE9A 2ONLC 5G6VA 3P78A 3F5UA 3OD6X 2GNLA 3S2PA 2I0HA 4L68A 4EQUA 5IH6A 1M52A 3DB8A 2HXQA 3OUNB 3KA0A 2FYSA 5D7AA 3UVQA 3AE7C 3SFDD 3ZFMA 2YIQA 4FI1A 4FKJA 5HKMA 2YIWA 5LVOA 3ORIA 1LR4A 2BRNA 4QP4A 1Z5MA 4I4FA 2QD9A 3DGKA 4RVKA 2WB8A 5DLSA 4DEAA 3AE6C 4B8LA 3NAXA 3IOPA 4L00A 4A4XA 5AM7A 5IA0A 2QOFA 4O91A 2QCSA 2VTJA 2YHVA 3M11A 5LWNA 2X8IA 4MK0A 4ZP5A 2BRMA 5IA3A 3MW1A 1ZOYD 3T3UA 1U4DA 4CKRA 3RPSA 3OTUA 4FVQA 1Q8ZA 5BVWA 2YEXA 1YQ3C 3EFJA 1OGUA 3LCSA 1H24A 1JQHA 5J1WA 2WTJA 5A4CA 2J5EA 4X3FC 4P7EA 3VRZA 3R8LA 4CFWA 1OKVA 2B76C 2R7IA 4E6CA 5BX0A 3W32A 2UW6A 4XG7A 4E1ZA 1JVPP 1R1WA 3W0PA 4XOZA 2R3OA 4F7NA 3Q60A 3N51A 2YJRA 4FSWA 4QMPA 4V0GA 5H9BA 3WYXA 4IEBA 2BZIB 3ZH8A 3TNHA 3SC1A 3P4RC 4L9IA 1KSWA 4BDJA 5HU9A 3WF6A 4OGRA 3NMUF 2YWPA 4O6EA 4FZDB 4RIWA 5BYLA 4EL9A 5FBOA 3RAWA 4W4VA 2R3GA 3VAPA 4C3FA 5L6PA 1H1QA 4L8MA 4YPSA 5D7VA 4DTAA 1V1KA 3M1SA 5EQYA 3ZYAA 4QQJA 1UNGA 1FGIA 4WNKA 5HIBA 1OGYA 2RKUA 3L9PA 4NU1A 2Y9QA 4ITJA 3CJGA 3RTPA 2CLXA 3E93A 4DCAA 5CEKA 3LFCA 4L44A 4JJRA 5C4KA 2B1PA 2XALA 3FQSA 3BL9A 1IAHA 4IMYA 3CPBA 4P4CA 2E2BA 3U6IA 2IZRA 4R3RA 4CRLA 4OBOA 4HVGA 4X3FA 3N4VA 2ITQA 2ZVAA 3AEBD 3IO7A 3L8VA 1YI3A 4X3JA 5CAVA 4MF1A 3GFWA 3BLHA 3KU2A 4L3LA 5LJJA 3A61A 4GT3A 4Y46A 3U9NA 4YJUA 1GJOA 2F7ZE 3GQLA 5DR9A 4FV2A 4IAAA 4OTGA 5BYZA 3VUHA 2NYAA 2PY3A 5HVYA 3AE1D 3BKBA 3F2NA 3UC3A 4FJVA 3UMXA 2XYUA 2PL0A 5EM8A 1UU9A 4EC9A 3P86A 4CRSA 3LOKA 4IJ9A 5F95A 2OF4A 2HENA 3PXKA 3VWAA 4LM5A 3Q4UA 5H8BA 3O7LB 3UE4A 2JD5A 3NYNA 3LXNA 3TI1A 3NFFB 3U4WA 1KE8A 2XANA 2J4ZA 3FKOA 3W0QA 3EIDA 4Z7HA 3HECA 2PMLX 4QMUA 3F88A 3AT2A 2W4KA 3KULA 4DT8A 4DC2A 2VD5A 5C03A 3QZFA 2XIZA 2UZUE 3MTLA 2UZVA 3QCSA 4LL5A 1NEND 3NVMB 4RJ7A 2A2AA 2F49A 1YHSA 3DKGA 3KRLA 5EDPA 4ACDA 4RZVA 3BGZA 3E8EA 3GQIA 1SZMA 5CSXA 4G16A 1W83A 3FLQA 4IW0A 3QTZA 4MNEA 4QP8A 3BU5A 3R8UA 5HVKA 2R3FA 2O0UA 4CSVA 4QP9A 5A46A 2F2UA 3G6HA 3LCTA 4YNOA 4PV0A 5KBRA 2XK8A 4GU9A 3FJQE 3C0GA 2XVDA 3R30A 4R77A 3T8OA 4FL3A 4C36A 3QRIA 3PUFC 3QC4A 3PXQA 4XG6A 1XJDA 3L8PA 2C5OA 4FSNA 2OW3A 4O7NA 2VTMA 1YRPA 2HWPA 2UW5A 3Q3BA 4DHJA 4YTCA 1B39A 2WS3D 3UODA 4O7LA 4GFGA 3QX4A 4IQ6A 2J90A 3RP9A 3BGPA 4YTPC 2C0TA 3UVRA 1LUFA 2GNHA 1WBVA 3DA6A 2HK5A 1NT2A 3TV4A 1R39A 1JSVA 3WF8A 5M56A 3R9DA 1DS5A 2R2PA 3RHXA 3TIYA 4NL0A 5M06A 3W10A 5HCYA 3ZTXA 2H96A 4G2FA 3FV8A 4YZCA 1KV1A 3MJ1A 3ORPA 3KXMA 3W0MA 3Q53A 1XMLA 3EQPA 4RX5A 5FEQA 5IQFA 5EFQA 3ZO2A 2EVAA 1GZKA 2QI8A 3BEAA 5FTQA 1PRYA 4AOIA 5AUTA 2ACZC 1UNHA 5ACBC 3OBJA 4DFLA 3H10A 3LFNA 3ACJA 1GZOA 2O2UA 3IQ7A 3MESA 4Y8DA 4GIHA 4ASEA 2J6MA 3AD6A 1QPDA 2HWOA 4M7IA 3PPJA 3P4SC 3Q9YA 3VUMA 2V0DA 3V3VA 2G2HA 2WPAA 4ZZNA 4XJ0A 3EZVA 3AE5C 3IGGA 3AC1A 3IDCA 2OXXA 4G31A 4IM0A 2JDVA 5CF5A 3AOXA 5E8ZA 2ZOQA 3C51A 4D0XA 4QTDA 3ZM9A 5HG9A 3T3VA 5ETCA 1G8SA 5BMSA 3ORMA 3ZC5A 4R7HA 4DITA 4TNDA 2BKKA 3A7JA 1J7IA 4IWDA 5FXSA 4F9YA 5AMNA 4H1MA 1WVWA 5J8IA 1OBDA 3P23A 4MD8E 1Z9XA 5M4FA 5HIDA 1BKXA 4YT0C 4K11A 3CGFA 5BVOA 4Q9ZA 3TM0A 5HG7A 2XK7A 3LW0A 4U80A 1OZ1A 4P5ZA 1PKDA 2JFMA 1P2AA 2PVJA 3IECA 3KGAA 3L1SA 3R21A 3QUPA 4EOKA 3BQCA 3P79A 2H6DA 4JBPA 3CE3A 3QHWA 3UDBA 5CI7A 4R3PA 5HORA 2W0JA 3I60A 3GNIB 3BCEA 4X7QA 5HE2A 2CCIA 3UO5A 1F5QA 5JQ5A 3BHHA 4KNBA 2XA4A 4A4LA 2PZRA 3HDMA 5BVKA 4J8NA 2I0EA 4K33A 2XBAA 3HYHA 2J50A 2FA2A 3R1QA 4FG7A 5KZ0A 4ZLYA 3DU8A 4CG8A 2YISA 4JXFA 4XG4A 1OIRA 5LVLA 2JBOA 5CVHA 4I3ZA 4RLKA 3E92A 3Q9WA 5GIPE 3L8XA 1BYGA 5ANEA 2GNJA 3CPCA 4USFA 1YI6A 2QKWB 5DR6A 5C2TC 4FEQA 3MGYA 4FZFB 3WBLA 3M2WA 1JWHA 3EL7A 3ZXTA 2VUWA 4AZSA 2ZB0A 5HEZA 4KS8A 4LGGA 2JBPA 3P7BA 4RRVA 3QUEA 3QTXA 3S1HA 3QRKA 4DINA 5KE0A 3UVPA 4FTMA 2XK6A 3NDMA 4RZWA 4ZTNA 5IF1A 2IZSA 3AKLA 3TZ7A 3DPKA 4FVPA 4IVBA 1OPKA 3BBTB 4GK4A 4F6WA 1L0VD 2QG5A 4OW8A 3RKBA 2UZOA 3QYWA 4JQ7A 2V62A 3P1AA 4C3PA 1H07A 2QQ7A 4O7VA 4I6LA 1PXPA 5EW9A 2AYPA 4AF3A 4KB8A 2W5BA 3WIKA 4OTHA 4FOCA 2P3GX 2ZB1A 3OHTA 2UW8A 2OSCA 2JIIA 4NUSA 4AW1A 1J7LA 3RALA 4DA5A 4F70A 2IVVA 2BTSA 3HZTA 4ZSJA 2P33A 4G1WA 4ZTMA 5C8MA 3AD4A 3I7CA 3MVJA 2WP9D 3PPZA 3UYTA 1YXTA 3AMAA 3H4JA 5IA5A 3DK6A 4JT3A 2XNEA 3R1NA 3HV3A 1OKWA 4RC4A 5CAOA 5K5NA 1JKLA 3HP5A 2BHHA 2XJ1A 2QOQA 2YN8A 5IH4A 3R8PA 4TYJA 2GHMA 4W4XA 4IWQA 1E1XA 2ZM4A 2XNBA 3MY0A 3PRIA 2W1GA 5E1SA 3Q04A 3UIBA 3UZRA 3FI4A 3NIZA 4NKSA 4QO9A 5AIRA 3AT3A 4ZSGA 4AOTA 4O84A 4HW7A 4YSZD 4V04A 3EKKA 5BUEA 4O7YA 3RM6A 1ZARA 2BDFA 4FEUA 4M68A 3QTQA 4NCTC 4UN0C 3GCVA 4CKJA 4B8MA 4IBMA 3AEED 3D5VA 1UU7A 5LWMA 1YOJA 4RWJA 2LAVA 5KO1A 4J8MA 5CZHA 2ZM3A 2J0KA 3H30A 3LFAA 4HCTA 2UW0A 3ALOA 4YBKA 1MQ4A 4J97A 1U46A 2B54A 4L46A 5DEYA 4RIXB 3ULZA 4D5HA 4KUJA 4FTIA 4OTIA 4AP7A 3QRTA 1LEZA 1VYZA 2IPXA 3CS9A 3FL4A 2BILB 3OMVA 2C6DA 2OZOA 3I6WA 3K5VA 4FKQA 4ZAUA 4ZY5A 2CKPA 3FMLA 4B4LA 4Z55A 3R01A 3NCGA 2HW6A 2H88D 2PE1A 2PUNA 1GZ8A 2G01A 3DJ7A 4MCVA 4O0RA 4BI1A 4PP7A 1EH4A 4DEGA 5FDPA 5F9EA 3AEAC 2BRGA 3EOCA 5KMOA 3LM0A 4YJNA 5BPYA 4H36A 4E4MA 3FZ1A 2R0UA 1ST0A 3PTGA 5D9HA 4HVHA 4NCTA 4YC3A 2ZV8A 3OXTA 5FGKA 2FBWD 3DQWA 4DAWA 2X2LA 3UZPA 3GC8A 3FLYA 4D1XA 3VS3A 2OI4X 2I1MA 2JIUA 1WVYA 3LJ2A 3VS7A 2B9HA 4MBLA 4EH3A 2H89C 3AEGC 3O7LD 2GQGA 2V7AA 4FMQA 5JZNA 3QTIA 5AUZA 3SAYA 4F9WA 4OUCA 4Y85A 3E87A 4QP1A 2AC3A 1GZNA 3VR8D 3LM5A 1Q41A 3ROCA 1TVOA 3OC1A 4G17A 1ZLTA 4EWHA 3R8MA 2Y4IC 5EHLA 4LG4A 4WG4A 2CHLA 3P4PC 4DGNA 1UA2A 2IJMA 4C4FA 1FQ1B 4C3RA 1IG1A 3TYKA 4C02A 4QMOA 5CXZA 3BHUA 3DZQA 1ZMUA 4QYHA 3ZBXA 4MXOA 2ESMA 1WBWA 3AC4A 3IW7A 3R6XA 3VRBC 2WQOA 4CFNA 5JGBA 2X81A 1MRVA 4O7RA 3G9NA 4AOJA 2CDZA 5IZFA 1G3NA 3SRVA 4CFVA 4CMUA 2PVRA 3IDBA 4BGGA 4XBRA 4JG8A 1TQMA 4RWKA 3TACA 4YTNC 1O9UA 4HGEA 3LLTA 4AA5A 2CCHA 1QPCA 4FV1A 3KEXA 2WDQD 2BFXA 3EZRA 4GW8A 1O6KA 4HYUA 4BIDA 1KE5A 4X21A 1NVRA 2BKZA 5L2SA 3POZA 2J9MA 5JN2A 5C3JC 4XUFA 4AGUA 4AZEA 4GUEA 1SMHA 4ERKA 1ERKA 1Y6BA 4E6AA 2F57A 5KUPA 3ODZX 3AMBA 3LXKA 3SXSA 5CANA 3UJGA 2QO9A 3FMMA 1H1RA 3DLSA 5H2UA 3CD8A 3SOAA 4YC8A 4G6NA 4DEDA 2V55A 3UYSA 2EU9A 2NP8A 3OOGA 1AGWA 3JR1A 2CGVA 4X2FA 5FP6A 3L9LA 4FKSA 4DGMA 5JEBA 4WUAA 2BZJA 1Q5KA 3LJ0A 5B0XA 4ZTQA 4A9YA 3CIRC 3PVWA 4GMYA 1Y6AA 3W1FA 3KQ7A 4WHZA 3SFED 1Q61A 3WYYA 2GQSA 5EYCA 3ZEWA 2OLCA 4JRVA 3WOWA 2W1DA 3POOA 4NKAA 4EYMA 5AV2A 3PVBA 2XK4A 4R5YA 2WMSA 1Q97A 3BELA 5J9YA 2A4LA 3NUXA 3TUBA 3RWQA 4JDJA 4LMNA 2WTVA 5IUHA 4WNPA 5DE2A 3AEFD 1ZOGA 3LFSA 2YFXA 5AA8A 4U42A 3OF0A 3P5KA 4DGGA 3HL7A 2ZDUA 4FV5A 5HVJA 4L42A 3NSZA 2W1FA 5DR2A 5B2LA 4HNIA 4Q5HA 5JZJA 1OL5A 1CKIA 4RLLA 3UO6A 4CMTA 3ABVC 3FBVA 1QPJA 3VS5A 4QMYA 3RAHA 4CEGA 3LFBA 5E8VA 1FPUA 2VO6A 4X2JA 3RPRA 3AT4A 5L6WL 2C5XA 2OJIA 2VRXA 3OS3A 4AQCA 3MV5A 3TDWA 3FY2A 4CLJA 3E3BX 4FEXA 2VTRA 4WNOA 5A3XA 4F7LA 3HUCA 2YIYA 3JS2A 3KY2A 1W0XC 3U9CA 4BIBA 4CLIA 3A8XA 5HESA 2UZDA 4AXEA 4BCQA 3AE4C 4WNMA 4YSYD 4DH3A 4D2SA 2Z7LA 4ZLOA 4MUQA 4DT9A 2W9ZB 3ZCLA 5AADA 1Q4LA 4XG3A 4ZTHA 1UU8A 4FICA 5CU4A 4E7WA 2VTIA 4IAYA 4KKHA 4NH1A 3LMHA 3GCUA 4RC2A 3KRJA 4ANLA 3LE6A 3AC5A 4D1SA 5HNBA 3SQQA 4NW5A 5L2WA 1OKYA 3NIEA 4ACCA 1QMZA 3F66A 1IRKA 4FIHA 2UZLA 1CTPE 3SG8A 1AQ1A 1O6LA 3U87A 3EB0A 4PNIA 3DKFA 3BPRA 3EQFA 2WNTA 4EH4A 3CIKA 4RX7A 4BCNA 4QMSA 3O17A 4XMOA 3G9LX 5AFVA 1HOWA 2WIPA 1Z57A 3COKA 4I1ZA 4B0GA 4UYNA 3MDYA 4IZAA 4BIEA 5CF4A 3QU0A 2NO3A 3D7TA 3QRUA 2BROA 4C62A 1KF6D 5LOHA 4EORA 3FZTA 4IVAA 2WQYC 2PTKA 4F64A 4AFEA 4JRNA 1DI9A 2VX1A 3FWQA 1IEPA 3QZIA 4XG2A 3COMA 1V0BA 3PZEA 3KRXA 2BCJA 3BYUA 4JDKA 4YHJA 4AT3A 5HX8A 3MA6A 4YC6A 4JMQA 3MH3A 2I0YA 4ZJJA 1YDTE 4L3JA 4E26A 4EC8A 1Q8UA 3GFEA 4CT2A 4TWOA 5KHXA 3EQHA 5E92A 4ITHA 3OWJA 4GU6A 1FMOE 2J0JA 3MY1A 3KIOC 3OWLA 1H4LA 3QD4A 4L7SA 3RAIA 5C8KA 3P7AA 5EDQA 5H8EA 1H08A 4EOPA 5E9EA 3E7OA 2ITYA 3H9OA 3OXIA 3ENHA 4HCUA 4P2KA 4FZ7A 4X2KA 5F4NA 2OICA 3PVGA 3UQGA 1J3HA 4XS2A 4CZUA 3GI3A 2QOHA 4IJPA 2X9EA
chains in the Genus database with same CATH topology
4GH2A 5C1QB 4QTBA 4QNYA 1XQZA 3EL8A 3QYZA 1L3RE 1S9IA 4PTCA 4RVTA 4A4OA 4K1BA 4WO5A 2YJSA 3FPQA 4BCOA 5E8UA 4ACGA 1ZYDA 4IM3A 4DTKA 4C58A 3DOGA 4K18A 4LRJA 4EBWA 2WTIA 2XCKA 4IB0A 3RINA 2XZSA 3W0SA 3ORXA 4BTJA 3PA3A 3D0EA 1ZMWA 2AEGA 4FKOA 4O2PA 2PHKA 4TWCA 4DH5A 1LPUA 4J1RA 2WTWA 4MXCA 3FZSA 3BLAA 3RPVA 1QCFA 3BYSA 4BVUA 2PVHA 4HJOA 4I6FA 2OXYA 1T45A 2V5QA 3QQFA 4TW9A 3A7IA 4FTTA 3UP7A 1H0WA 2BAQA 4FK6A 1L8TA 3OP5A 4JX3A 4TXCA 4HZRA 2RF9A 4IX4A 3P5JC 1R78A 4NYEA 4BTFA 2W1CA 2JDTA 3W2PA 5HG5A 4DGOA 1TFFA 2HZNA 2UZNA 4MWIA 5KCVA 3AC2A 4EOMA 5IG1A 3GOPA 4YTHA 4BYJA 3VJOA 3GP0A 5FBNC 4F9CA 2ZM1A 2WELA 4AX8A 4L01A 2DS1A 5FTGA 2VWYA 3PY1A 5E8SA 4O7ZA 3LCDA 4FE2A 2ITZA 1G8KA 3G51A 4JG6A 1GIJA 4MH7A 4YTIA 3QCXA 4MAOA 3KF4A 3E88A 2BVAA 3PWDA 2G15A 2BZKB 3BE9A 3DV3A 1JKKA 2QO2A 3PXRA 4BTMA 4O81A 3MVMA 4UBAA 3FZRA 4ZY4A 1FBNA 3H3CA 4GVAA 4FV4A 4QPAA 2QOBA 5LVPA 4ZXTA 4HVIA 3F3ZA 2Z7QA 3BI6A 2PMOX 4NJDA 3VN9A 1OPJA 2QOCA 3COHA 3V5WA 3D94A 4DE4A 2WD1A 3I4BA 3PWYA 4FZ6A 4XRJA 1SVHA 2PUPA 3E8DA 5EYKA 2W96B 5AP2A 1OM1A 2C47A 3QRJA 3WZDA 1IR3A 4CCBA 1PXMA 1OL1A 2B9IA 4A06A 2QLUA 5T3QA 3QWJA 4I23A 2GU8A 5DNRA 4DF3A 3GEQA 4C2WA 2EB3A 1BMKA 3Q52A 3MFRA 2FH9A 3QKMA 4NIFB 4PL3A 5IMEA 4QP7A 4MEDA 1W8CA 4UB7A 3CSVA 2R9SA 3OY1A 5J9ZA 3S00A 4Z16A 3IW4A 4D2RA 2XM8A 4YJTA 4YU2A 3O8PA 1UKHA 5ANJA 4FIJA 1DI8A 2PULA 4FTOA 3FXWA 5EQPA 3HA6A 2FUMA 2XKCA 3ANQA 2QOIA 3HLLA 3OCTA 4L52A 3SXRA 4AXDA 3Q5IA 3TUDA 2QVSE 5AP7A 5EH0A 5JH6A 4QMLA 3A2CA 4D4SA 4LRKA 2C1AA 4EOIA 5LVMA 5CY3A 3ZM4A 2VN9A 3PP0A 4AU8A 2WXVA 4S32A 1H28A 4FGRA 4BKJA 2R5TA 5KX8A 4TWPA 2WU6A 2KULA 3C4WA 3A99A 3GXLA 3NW7A 5ACKA 3CLYA 1SYKA 2WTDA 4O27B 3VW6A 4BHNA 3AGLA 1ZYSA 3CEKA 3HAVA 1KOAA 2B0QA 3DBFA 4YJVA 1JOWB 3VUDA 4RA5A 3D9VA 2Z7RA 2GNFA 3I0QA 2HXLA 1AD5A 4S30A 4BJJA 5IA1A 3LFDA 1I44A 2F7EE 3GCQA 3FLZA 4C34A 3VS2A 2KTYA 3OEFX 2BRHA 5ANDA 2WTKB 4UYAA 4E5AX 3UPZA 3BYOA 3L8SA 2QG7A 4XNEA 2VNYA 3MWUA 2YITA 3IG7A 3KMWA 3A60A 4KRCA 5CU2A 5TKDA 3S0OA 5FP5A 2Y0AA 3C9WA 3EHAA 4RG0A 4XCUA 3FI3A 4YJQA 3R7VA 3W8LA 4AE6A 1J91A 1P5EA 4EOOA 5M09A 3GU4A 4Q9SA 4HOKA 4XP0A 2WEVA 3IS5A 2ETKA 4QNAA 3P0MA 4ANBA 1XH8A 5LARA 4ONAA 5JFSA 2GNGA 2HIWA 4AT5A 2R3IA 3E64A 4AE9A 4ANQA 2UVYA 3UNJA 3FUPA 4F6UA 1ZYLA 5K4IA 1GIIA 1OB3A 3QA8A 3VBYA 2JITA 4AQKA 1Y57A 3LQ5A 3OVVA 4IM2A 3SX9A 4XBUA 5T6KA 4CG9A 2QONA 3VW8A 1MRYA 3DT1A 4E6DA 2XAMA 4D4RA 5FD2A 2VWWA 4QMWA 1BX6A 4RIXA 5AUYA 2VTOA 5AP6A 4IFGA 3ZMMA 2C6EA 2PVNA 2Z02A 2IW8A 3UTOA 1OL6A 2BUJA 3TT0A 5I9VA 3ZHPC 5BUJA 4CT1A 4IB1A 4IZ5A 4GKIA 3A62A 4A9SA 3FLWA 3KK8A 4EUUA 3QTWA 4O38A 5C9CA 4YUQA 3ETAA 4YJSA 4BBEA 4O86A 3V6SA 5BMMA 2CNUA 3BHYA 4FKUA 3N4TA 2C69A 4EZ3A 1M14A 2GTNA 3CBLA 3TTIA 3HDNA 3R1SA 3F3UA 4BDEA 3BZ3A 3ODYX 3KXHA 4CFMA 3R7EA 3PXYA 4I0SA 1UKIA 4LYNA 5B7VA 5JK3A 3CC6A 2XYNA 3G0FA 4YJPA 3RAKA 3B8RA 3RHKA 4L53A 5M44A 1XH7A 3VS4A 2QC6A 4M13A 3QD3A 4RIYB 5LMAA 4BICA 4AGCA 5LQFA 4K0YA 3GBZA 4UEUA 3R73A 2QOKA 3GVUA 3QALE 1PXIA 2A27A 3LQ3A 1PY5A 3QZHA 1PKGA 4FKLA 3VS1A 2QU5A 4AGWA 2XNPA 1P4OA 4CTBA 4EUTA 4F1MA 5AV0A 4J53A 1OI9A 5CNOA 5IDNA 2I6LA 1IA8A 4BCKA 4J99A 4EK6A 5IPJA 3C4FA 3PJ1A 5EYMA 4O7WA 3OZ6A 3U55A 1BLXA 4OBPA 2PZYA 2XNGA 4TN6A 3ZS5A 2B52A 3DJ5A 4APPA 4MWHA 2FO0A 4CCUA 3D2KA 4ZSLA 2B4SB 3Q6WA 3R63A 3WE8A 4H1JA 3DCVA 2HW7A 3WF7A 4PUZA 4ITIA 4C33A 2XS0A 3DY7A 4I21A 4PRJA 3F5GA 3I6UA 4RJ6A 3E3PA 4L6QA 4BGHA 3S4QA 1OPLA 2JAMA 4RX9A 3FQEA 4AZWA 2HELA 3OBGA 5HCXA 4RPVA 4IZYA 5HNIX 3GGFA 5CU6A 2IVUA 3UC4A 1R0PA 4FZAB 4LQMA 2X9FA 2JKMA 4N4SA 4ALWA 3ORLA 4FV6A 3VBVA 3BIZA 2VWZA 5C8NA 5HE1A 2G2FA 5HBJA 2C3KA 4EH2A 3W2SA 4QTCA 2ZV2A 2UZEA 3MH1A 4II5A 3IDPA 3MSSA 5FM2A 4HVSA 2YM6A 5JFVA 3FMKA 4AZTA 4FTUA 2RFNA 5CSWA 1YWRA 3O8UA 5HQ0A 2XF0A 2B9JA 4FODA 1J1BA 3QQHA 4I94A 4QOXA 3V5JA 3LFEA 5HGIA 4ENXA 3CR0A 2J5FA 2CN5A 3T9TA 3TN8A 1W82A 5AUUA 5J7HA 3TTJA 4C37A 2PYWA 2WZJA 4ZJIA 3WZUA 1BUHA 2VU3A 3DAEA 3KXZA 2R3RA 4GK2A 3F6XA 5JFWA 4C4GA 2IWIA 4NFMA 5J95A 1A9UA 1UU3A 2Q0NA 3HUBA 3O96A 4GCJA 3F69A 1APME 2DQ7X 2YM3A 4YLKA 4AA4A 5ETIA 4FL2A 3TZMA 2C3IB 5ETAA 2XJ2A 2B55A 2X4ZA 3QXPA 3PE2A 4YNEA 3LCKA 4CMOA 4C4JA 3QKKA 2V7OA 3TIZA 4ACHA 3R2BA 2WMQA 1G8AA 5M4CA 3G33A 3C50A 3IK3A 3K54A 1RQQA 3EN4A 4EH7A 4G6OA 4A9RA 5C26A 3SDJA 3G2FA 1JNKA 2E9PA 3FL5A 4RQVA 3NGAA 3DLZA 3FZOA 3NCZA 5EW3A 1VR2A 3PIXA 3DFCB 4KRDA 4U97A 4F65A 3H0YA 4NFNA 4O82A 5DYJA 4XP2A 4M69B 1H27A 3DBCA 3JVRA 5LXMA 1KE6A 1XBBA 1SNXA 4DHFA 1M2QA 3DFAA 4BDCA 3GC7A 4FV3A 3EFKA 1JSUA 4FTAA 4QTAA 4K2RA 4UWCA 2PUIA 3TXOA 4TWNA 4LDTA 4JOAA 3KB7A 4PDOA 5E4HA 4UX9A 2ZFYA 2BR1A 4S2ZA 5L2TA 4FYNA 3QX2A 5EI2A 2YZAA 3D4QA 4XLIA 3AQVA 3U54A 3OTVA 4E6QA 2RGPA 1OMWA 5A14A 5B2MA 2PWLA 3DXQA 4XLVA 3ATTA 4D1ZA 4EBVA 1QPEA 3Q4CA 1QL6A 2UUEA 3SLSA 3FDNA 4OTFA 2V22A 3KVXA 2JIVA 4D0WA 3II5A 3MY5A 4RA4A 5AJQA 3WE4A 3OT3A 3MS9A 2CGUA 3LXPA 4O96A 3ERKA 3A7FA 4LMUA 4G9CA 4PDPA 3EJ1A 4P5QA 4WUNA 1WMKA 5A4LA 4BRXA 5HLNA 5E7RA 4S34A 2XEYA 4M14A 2C1BA 2WQNA 5IQDA 5KKRC 5KMKA 5CU3A 3ACKA 4W8EA 2VX3A 3R04A 3BHVA 4G3DA 4FNXA 2O63A 1YVJA 4RFMA 5C01A 4GYIA 3P08A 4RVLA 3UDSA 2R4BA 2YCQA 2WEIA 4WSYA 4UALA 2YA9A 1BI8A 4AACA 5FLFA 2ZV9A 4CVAA 3JVSA 4WA9A 3V01A 3G6GA 3GC9A 2CKOA 4P90A 4DEEA 4RIWB 1NXKA 2QURA 4PMPA 2Y6MA 3QCQA 4EOQA 4JR3A 4BCPA 4CQEA 2JFLA 3HKOA 3PIYA 4FX3A 1CKJA 3TKIA 5IUGA 3AMYA 4I5CA 3HGKA 4DFXE 5ANIA 5DT4A 3KXGA 3ORTA 3MYGA 4YJOA 4Q2AA 3MFUA 4U9AA 1UWHA 2J0IA 1SVGA 3ZLSA 3BBWA 2OZAA 2JDRA 4DTBA 4APCA 3EQBA 2QODA 4QTEA 3W2OA 4LI5A 2W4OA 3D7ZA 4CFUA 3BLQA 4FTJA 4X3FB 3E7VA 3MA3A 3MH0A 4F4PA 4DYMA 3QQJA 1S9JA 4MQ2A 4JIKA 4KSPA 3CTHA 2C3JA 4GFMA 2OXDA 2VNWA 5IQEA 2ETRA 1WVXA 3R2YA 3IGOA 4RC3A 2X6DA 4S33A 4O0WA 2X4FA 4RFYA 4M8TA 4F7SA 1TQIA 3OOMA 4RMZA 2ITTA 3VS6A 4X0MA 4ZTRA 3FC1X 2QR7A 2NRYA 2HYYA 4AA0A 5KMNA 3E5AA 4LUEA 4M97A 3HV6A 4RWLA 2BDWA 3NRMA 4BC6A 3F2AA 4ZS0A 4Y5QA 5TF9A 3AKJA 3WF9A 4BZOA 3PXZA 2GMXA 2J7TA 3CKWA 2VV9A 4ZSEA 5I4NA 3EQDA 3FZPA 1STCE 2XIRA 4QPSA 3R8VA 2A0CX 4TTHB 4EK8A 3GU5A 2UZTA 1NW1A 4I6HA 2CKQA 2OH4A 3ML1A 4CFFA 3REPA 4GJ3A 4R7IA 4UY9A 3W55A 1G5SA 1PXLA 2PMIA 3LZBA 3U6JA 4QMTA 4PDYA 4FK3A 4MNEB 4GL9A 3IW8A 3MJ2A 5IQCA 3HMIA 3UZTA 3DB6A 3NUAA 3TV7A 3K3IA 2IVSA 5DT0A 2CGWA 3ZC6A 4YZNA 4N57A 5BQ0A 1U59A 3MB6A 2X1NA 1ZOHA 3QKLA 4RJ4A 5GJGA 2XNMA 3PSDA 5AX3A 2XK3A 4WKQA 3NUNA 2HOGA 1PMNA 2WMUA 4TYHA 3RPYA 3PXFA 1UNLA 2XUUA 3DQXA 3NW5A 3FC2A 3DTWA 3EMGA 2CKEA 3KRRA 4D5KA 1YOLA 4FV8A 3DK7A 3MFSA 2E9OA 2C6LA 2G1TA 2HZ4A 3FMNA 3GU8A 5EHYA 5CENA 2GS6A 2VGOA 1JAMA 3HX4A 3FSFA 2R3JA 3JYAA 4EHZA 1YXVA 1ZMVA 3QLGA 3VF8A 1B6CB 3KKVA 4I24A 2ITUA 3R0TA 3JY9A 2BIKB 3R9OA 3VBTA 3Q2JA 3W0OA 5DRBA 4DG3E 4ASXA 5A6NA 1OBGA 4DG2E 5CAPA 1K3AA 3FI8A 4QP6A 1OL2A 4EK3A 4BDIA 4RJ5A 3MPTA 5BVDA 3ROYA 3HEGA 2PVMA 2XBJA 4G3EA 1OVEA 3VNTA 5EW8A 3FLSA 4JBQA 2YIRA 4A07A 3VHEA 2W06A 4BBFA 2X6EA 3LMIA 4GVJA 5CSHA 3UBDA 5HZNA 3I81A 4CV9A 3IW6A 4GG5A 3C13A 4JDHA 3TUCA 3QCYA 4ZMEA 3GB2A 1FOTA 1GY3A 4GG7A 4F9AA 5BV3A 2PSQA 1ST4A 3C4ZA 3PZHA 4GIIA 4ZS4A 3V04A 4YMJA 2BALA 4FSUA 3R7IA 3QC9A 3PA4A 3CY2A 3EFLA 2WO6A 2VTSA 3A4PA 5CI6A 2PMNX 4IX6A 3F7WA 3UNZA 4HGTA 1E1VA 4FV7A 4J52A 4YSJA 3UIUA 3ZO4A 2HAKA 2XB7A 1CSNA 1PXJA 2GS7A 5KHWA 3Q9ZA 4GKHA 4Y83A 3GU7A 3PYYA 2HCKA 2YIXA 3V51A 2FSTX 4IB3A 5HX6A 5FRIA 2O3PA 4PDSA 4DFYA 4LV5A 2GFSA 4ANSA 5AV1A 3MPAA 3PG3A 3UDZA 2OJ9A 3ZEPA 5EM7A 4YZ9A 5DOSA 4G3CA 1ZYCA 3TJDA 2JC6A 1KOBA 2F2CB 4L45A 2YM4A 5LMKC 2R3LA 4KS7A 5KMJA 3ZO3A 3PA5A 1YW2A 3GOKA 5HLWA 5CSVA 4LOOA 3SW7A 2XMYA 2QO7A 3BE2A 2OGVA 3CTQA 3DBDA 3HV7A 2CNVA 3IW5A 3I7BA 4GJ2A 3SGCA 4F78A 4EQCA 3EN9A 4D4VA 5FG8A 3PJ3A 4M12A 4NM3A 5GJDA 5EM6A 4ZIMA 4BCHA 2G9XA 2ZJWA 4FG8A 3ZFXA 4AAAA 3F9NA 3H9RA 1H1WA 3EN6A 3R02A 3VHKA 4RX8A 5EYDA 3N9XA 4G9RA 4YZBA 2BFYA 4ZEGA 4Q5EA 5I9UA 4QMNA 3F3WA 4NW6A 4RQKA 3RK5A 3OCGA 3UOKA 2VWIA 2WGJA 4JLCA 5M4UA 2QNJA 2R3QA 3AG9A 4WD5A 3I0OA 1P14A 2AC5A 4XRLA 3ZLWA 4BDDA 3ZSGA 1U54B 5EKOA 2GHLA 4XP3A 3O50A 4RJ8A 4JL9A 4NJ3A 2PZ5A 3G0EA 4B6LA 3FYKX 1ND4A 3FHIA 4NTTA 3HVCA 4ZMFA 2WIHA 3U51A 1K9AA 5KMLA 5LMKA 4UWYA 3PRFA 4BF2A 5I9WA 5C27A 5FUTA 2PUUA 4H3BA 5CWZA 4F6SA 4NWMA 3HRBA 2W17A 5CLPA 3H9FA 3OFMA 5J87A 3TG1A 4I5PA 2CGXA 3PP1A 4R3CA 4XV2A 5J5SA 4UZHA 1H8FA 5CEOA 3TEIA 4ACMA 4O0TA 4RIYA 2XIXA 5IMXA 4FSMA 5TOZA 4QQ5A 5CX9A 4FIFA 4Y72A 4WT6A 3FLNC 4ZLZA 4EEVA 1J7UA 1XWSA 3QFVA 2BMCA 4NZWB 2GNIA 3ZLYA 4FR4A 3V8WA 2E9VA 5AV4A 4AW5A 4JR7A 4DGLC 5KBQA 5AA9A 4U43A 3OXZA 2PE0A 3FSKA 4JI9A 4KIPA 4A9TA 3GENA 3Q96A 2R64A 3R1YA 4JQEA 4NM0A 1YWVA 5IUIA 1YXXA 3KC3A 4TY1A 4IFCA 3B2WA 3DNEA 4OTDA 2QKRA 4XV3A 4YSMA 3V5QA 4AGDA 4EKLA 5IEYA 4V05A 3KXXA 3UDTA 4WBBB 4R78A 4IWOA 4FKVA 4U7ZA 3EQRA 4E4LA 4J96A 4GRBA 2VGPA 2VO7A 1XBAA 5E90A 3NEWA 5I9ZA 5I9XA 1ZAOA 4Z7GA 4BB4A 2ZMDA 2CJMA 4TL0A 5M07A 4IAFA 2WQEA 4E5BA 5A54A 5IDPA 4FSTA 4R6VA 4AXAA 5EI8A 2RG5A 4M15A 1YOMA 2XNNA 2XCHA 2C6KA 3MB7A 5H3QA 3PLAE 2C68A 3NYXA 4PMSA 5E91A 3V6RA 4BI2A 2XP2A 5HBEA 3KN5A 4O21A 4MVFA 2W1ZA 1M17A 4AWIA 3D83A 2JLDA 4N70A 2X2MA 5HU3A 3NS9A 2ZMCA 2ERZE 1Q62A 4DFUA 5T68A 3LIJA 5F20A 4S31A 3TNWA 1OECA 4DDGA 2O8YA 3ZUUA 4YHTA 4C2VA 4U40A 2PU8A 4PX6A 2ZYBA 3S95A 4AW0A 2VO0A 3RZBA 1H25A 4DG0E 4LV7A 5DIAA 3UOLA 2WOTA 3QBNA 4JVGA 4BY9E 3NUPA 5CTPA 3CQUA 4RJ3A 2P2IA 4QEBA 3M42A 3FAAA 1VEBA 1PMUA 3NFGB 5M55A 2PVFA 3MI9A 1GIHA 1FVRA 3LAUA 2LGCA 4RFZA 3RGFA 4AG8A 1XO2B 1DAYA 3PIZA 2QLQA 3UNKA 4UV0A 3QD2B 4ARKA 5E8WA 4ZTLA 4FTLA 4YBJA 3R8ZA 4CV8A 3JUHA 3MVLA 4QMXA 5EKNA 4L67A 3KK9A 2FGIA 5EHOA 5AIKA 3DS6A 1YWNA 3UPXA 4F63A 1WCCA 1H0VA 2IZTA 1Q3DA 4FNYA 3CQWA 1R3CA 2X7FA 3DTCA 5M08A 1Q8TA 3BWFA 4A7CA 1YQJA 4B7TA 1UWJA 5L2IA 3OROA 4FNZA 4I0RA 3FHRA 4FT9A 1Q8WA 3VQUA 3VULA 4N6ZA 2XKFA 4MX9A 5HTBA 1IASA 2C30A 1JBPE 2WQBA 3QL8A 2OIBA 3HRFA 1MQBA 5AWMA 4I6QA 1SNUA 3TCPA 5AUWA 3V8TA 1XH4A 1RDQE 4K9YA 3NLBA 4H3PA 2HZ0A 3IONA 4FEWA 4QDEA 2QOOA 2PZIA 4Y95A 4MQ1A 4LRMA 4O0VA 2OH0E 5DN3A 4IHPA 4LFIA 3FXXA 4EONA 3GCSA 4FT3A 3BYMA 3ORKA 4MXXA 2VWXA 4MBIA 4O2ZA 2P0CA 1Q3WA 3PJ8A 1FINA 4BCMA 3QQLA 5HNGA 3UG1A 3G90X 4BBMA 4H58A 1FGKA 3ELJA 5IQHA 4K6ZA 3QTUA 2Z60A 4MTAA 3I5ZA 3U8WA 4IVDA 4DCEA 4QYEA 3OUKA 2IW6A 4DEIA 5HD7A 2XEZA 4PL5A 5HLPA 4NM7A 1KE7A 4UZDA 2ITNA 4WG3A 4CGAA 5TT7A 4C4IA 3T9IA 4AXCA 4PP9A 5CSPA 4GT5A 3F3TA 4QDVA 2OBJA 2H9VA 3BX5A 3OWPA 4RT7A 2C4GA 4HYSA 4ALUA 1WBOA 2WKMA 4D4YA 4OBQA 3F7ZA 5JSMA 4QMQA 4NM5A 3SKCA 5F94A 4ASZA 5GIOE 2FVDA 2Y4IB 3WF5A 5EDRA 4DH8A 4NTSA 1E9HA 2G2IA 3C5IA 3MIAA 2OFUA 5CS6A 5AP3A 3W18A 3ZUTA 4E20A 4FTQA 3OWKA 3TKUA 4FKWA 4DH1A 2WMAA 2JGZA 4O6LA 3GC0A 1ZWSA 3RMFA 4FSRA 4KABA 3QGWA 5D11A 3WILA 4X2GA 1W98A 1URCA 5DI1A 4JQ8A 2JKKA 2BPMA 4JS8A 5FXQA 3OY3A 2OF2A 3ZZEA 1RW8A 5GHVA 4QP3A 1YDSE 2NPQA 2YDKA 2CNQA 2VWUA 5DH3A 3ZUVA 1VLRA 2ONLA 2WAJA 3ID6C 3QWKA 3QQKA 4C35A 5L8KA 5CF8A 2J51A 1YXSA 4J71A 2Y7JA 2IVTA 2FSMX 2JKOA 3RK9A 3TNQB 2IZUA 2PVYA 3KF7A 4F1TA 5HO7A 2ERKA 2XAOA 3E8NA 2GSFA 5BYYA 4F0GA 1F3MC 3W2RA 4YHFA 2VTPA 4KKEA 3WZEA 5ANGA 4FL1A 4X6QC 4L7FA 5E8TA 2GHGA 4BTKA 4MD7E 4PMTA 2UW9A 5EG3A 3Q4ZA 1H01A 4EJNA 5JMSA 4JG7A 3GU6A 3LJ1A 4J98A 1YI4A 2J0MB 3OW3A 4FV9A 4C7TA 4FIGA 4OTRA 4O0YA 2ITOA 4C59A 4DFZE 4YO4A 5JFXA 4C4HA 4O7TA 2WFYA 4USDA 4FUXA 1OUKA 2CN8A 3O51A 3JPVA 5LCKA 2X8EA 1RE8A 2E9UA 4TYGA 3W8QA 4AXFA 5TO8A 3LCOA 3WIGA 4IWPA 5M4IA 3HMNA 4DHIB 2VTQA 4IIRA 4QT1A 5I0BA 2PE2A 4FGBA 2XH5A 3BU3A 3DXNA 3KFAA 3KCFA 5JT2A 3F5XA 3SA0A 3NUYA 2DUVA 4IC7A 4JDIA 3D14A 4O7SA 4U81A 5E8XA 3ZLXA 3TNPC 4ERWA 5K3YA 3V5LA 2VTHA 4XH6A 4KD1A 3RCJA 5BUIA 2O64A 5AAGA 2UW7A 4FSQA 4ZK5A 1F0QA 4OLIA 3MFTA 5CQUA 4CNHA 3ZDIA 2BTRA 4NK9A 4AFJA 4M67A 1X8BA 4CTCA 3IPHA 1ZRZA 3R9HA 1PHKA 3HA8A 4ZOGA 5AP0A 3UIXA 2OK1A 4HNFA 2R3HA 2PZPA 3NNWA 5JRSA 3KCKA 3PSCA 1VYWA 3UOJA 2YWVA 5EOLA 5B2KA 3BGQA 4WRGA 1OIUA 3OCBA 4F09A 3D7TB 4DEBA 4JBVA 3O8TA 4O0XA 3FPMA 4QYFA 5LMBA 1SM2A 4XV9A 3VS0A 4RBLA 4M84A 3AC8A 1H1PA 3SHEA 3Q4TA 4GYGA 1MRUA 3THBA 4FT7A 4W4WA 2XKEA 2SRCA 3NAYA 5FXRA 5FM3A 4YJRA 4I22A 4WRSA 3PG1A 4RVMA 4W8DA 3V5PA 3S3IA 4U6RA 2W99B 3AKKA 4C0TA 2I0VA 2YAAA 3P7CA 5DG5A 4BDHA 1J1CA 4FOBA 3RWPA 5EM5A 5HD4A 5HIEA 2F9GA 3BWJA 1M7QA 4YLJA 4O0SA 4GSBA 5AUXA 4BCFA 4TNBA 4BDAA 2BHEA 1KUTA 1Q8YA 2C6TA 4EHGA 3NR9A 5I9YA 2WMRA 5CALA 3COIA 4ALVA 5A4QA 4CXAA 3ET7A 3RK7A 4FV0A 4O22A 1PJKA 2WOUA 5HTCA 3EYHA 1H26A 2W1EA 4C38A 5G1XA 4EYJA 4PL4A 1PYEA 2QU6A 3F3VA 4HGLA 3KVWA 3R83A 4YZDA 4DBNA 1ZZ2A 5JGDA 1BL7A 1PMEA 2AUHA 5J9LA 2F4JA 3FMHA 1XMMA 4XG9A 2WMXA 3HMPA 2CPKE 3O2MA 4JX7A 4N6YA 4E4NA 2PK9A 5FDXA 4RSSA 3WZKA 3DAKA 3I79A 1M2RA 3CQEA 1YDRE 2PVKA 3EQGA 4R1YA 5AP5A 3RVGA 3SW4A 4MBJA 2GQRA 4FTKA 3B2TA 4TZRA 2W1IA 3GUBA 4ZZMA 4EOLA 2CMWA 2ITXA 3FMJA 5CQWA 1M2PA 5JGAA 3NW6A 3WARA 4BGQA 2C0IA 5HE0A 4GUBA 4XEYA 3WI6A 3TMOA 5ANKA 2YM7A 4EOJA 5GNKA 2FB8A 4I92A 1JKTA 2DYLA 3DKOA 4B99A 3G5DA 3PY3A 2QOLA 3ZBFA 3R22A 3C5UA 2C6OA 2B7AA 2Q0BA 4GEOA 1B38A 1V0PA 2RFDA 3ZRMA 1KV2A 4YUR