4LDTA

The structure of h/ceotub1-ubiquitin aldehyde-ubch5b~ub
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
257
structure length
255
Chain Sequence
CLAYDEAIMAQQDRIQQEIAVQNPLVATLAPFSILCAEYDNETSAAFLSKATELSEVYGEIRYIRGDGNCFYRAILVGLIEIMLKDRARLEKFIASSRDWTRTLVELGFPDWTCTDFCDFFIEFLEKIHSGVHTEEAVYTILNDDGSANYILMFFRLITSAFLKQNSEEYAPFIDEGMTVAQYCEQEIEPMWKDADHLAINSLIKAAGTRVRIEYMDRTAAPNGGWHYDIPSDQIAPEITLLYRPGHYDVIYKKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin thioesterase otubain-like
publication title E2 ubiquitin-conjugating enzymes regulate the deubiquitinating activity of OTUB1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase regulator
total genus 95
structure length 255
sequence length 257
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2013-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1300.20 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases 3 helical TM bundles of succinate and fumarate reductases 4ldtA02
3.30.200.60 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ldtA01
3VONA 4DHJA 4DHIB 4I6LA 4FJVA 4DDGA 4DHZA 4LDTA 4DDIA 2ZFYA 1TFFA
chains in the Genus database with same CATH superfamily
3NYVA 1OPKA 2IVTA 4IFCA 4R5SA 5HESA 3LE6A 4BTJA 3ULZA 3WE8A 5AUXA 3D2IA 4BRXA 3R7OA 2HW7A 4RIXB 5AFVA 4ID7A 5B0XA 4P5QA 5LWMA 4W8EA 3ZYAA 3MA3A 4IX5A 3HP5A 3QC4A 4JBQA 3TEIA 1SYKA 4FEWA 3ATSA 3G51A 4BYJA 4L45A 1XH9A 3D5WA 4LV5A 3ZEWA 2B76C 5CY3A 4IWDA 2UVZA 3ZUTA 4V0GB 5CT7A 4MD9E 4B6LA 3NW7A 3Q60A 2J0IA 4AWIA 5A54A 3D7TB 4YHFA 4D4YA 2F2UA 2G2IA 1R0EA 2IN6A 1URCA 3DNEA 4RJ4A 4LL5A 3V6SA 5BV3A 2ITUA 4NK9A 5BPYA 1UWHA 4ANMA 4DC2A 5KO1A 3RAIA 4BDIA 4A9RA 2PSQA 3V01A 5FP6A 4EH5A 5DRBA 3R28A 4HZSA 3KULB 4QNYA 4IBMA 3MW1A 3NPCA 4XX9A 4JQEA 2Q83A 5HTCA 3DB6A 2VWIA 3QALE 4FIGA 4H36A 4RZVA 3MFTA 3AT3A 1SZMA 3OBGA 2C6TA 4F7SA 3RWPA 3VO3A 3CQWA 3PRFA 3ZZEA 4FBXA 4IH8A 4L67A 4LRJA 4K1BA 3EQRA 4GYGA 5IEYA 2EUFB 3FI3A 3NWWA 2QONA 1GNGA 4S31A 3FQSA 3AE9D 5E8ZA 2VWVA 4O7ZA 3F82A 5JRQA 2HAKA 4KS7A 3F3ZA 3BU6A 4G5JA 3JXWA 4BDJA 3PJ8A 3TDWA 3TUCA 3KRJA 2YHVA 2W5HA 3U9NA 1ZYJA 2W7XA 2X8EA 4XOZA 4EWHA 4FL1A 2X2LA 4IEBA 5C27A 3OXZA 4XBRA 4C34A 1R0PA 4EUTA 2CKEA 4ZTRA 1VJYA 3W1FA 2VU3A 4PNKA 3PXKA 4FYNA 3SAYA 3BYMA 2UZEA 3DFAA 5IDPA 4WBBB 1U59A 3JR1A 5T6KA 4CV8A 3P9JA 2JFLA 3GCSA 4GH2A 3VR9C 2BHHA 4W4XA 4ZAUA 3FZPA 4O6EA 4E8AA 4X2KA 3ORPA 3P5KA 2AC5A 5KKRC 4IADA 3DDPA 1NEND 4ZIMA 2WU6A 4QDEA 4A4OA 4O96A 5GNKA 2R3OA 2I7QA 3EN9A 1M52A 4RC2A 1WBWA 4BIDA 2H34A 5CSWA 1XBBA 3W8LA 3F5PA 3NNXA 4JLCA 3FE3A 3NFFB 1XHAA 2J4ZA 2XIXA 4YXDC 3W2SA 4CT1A 5BX0A 1JQHA 3R9OA 3BGZA 4XG7A 3AE4C 3FQHA 3EIDA 3G15A 2ERKA 5IA2A 4B8MA 3N4VA 4QYYA 4PDSA 3R9HA 2WMBA 5IA4A 4GU9A 4UEUA 4O2PA 3HKOA 3DBFA 4AZEA 3S95A 3B2WA 3C1XA 4H1MA 2UZOA 5KUPA 5M57A 4I22A 3Q9YA 3TUBA 2WTIA 4YJUA 3T3UA 3ZXTA 3CSVA 3QQJA 3D9VA 4FV3A 1ZXEA 2W1HA 3GU6A 3HNGA 3ORIA 5CU6A 4C58A 3EZRA 5ETFA 3FYJX 2CLXA 4F99A 4HVIA 3NCZA 1YHWA 4HYIA 4ZSAA 4DA5A 2VWXA 3QAME 3KXNA 4AAAA 4JRVA 3OT3A 4AE9A 1NA7A 2BS2C 1XKKA 5KKRB 4C4FA 2PMOX 4IX4A 5EHOA 2UVXA 3ID6C 3VN9A 5EFQA 4ENYA 2Z8CA 2GTNA 1O9UA 2FSTX 5HD4A 1DAWA 1U54A 2CN5A 4JAIA 3EKNA 4QYEA 5B2KA 5DN3A 4X2FA 4O7TA 2BRHA 2WPAA 2XK9A 3FXXA 4OR5A 3VONA 5HKMA 5TR6A 4BI2A 4ZY6A 1QLBC 5LCKA 3ABVC 3R73A 4IFGA 4ZTLA 4FZFB 5K3YA 2HY0A 2GNFA 2JBOA 2XYNA 3AD4A 3AE1C 3BV2A 3F5UA 3EQGA 4ZP5A 3B8QA 5C8MA 4BDEA 5ICPA 3A60A 3VULA 4ACGA 5AUYA 3P7CA 3FHIA 3FSFA 4LMNA 5AJQA 3V6RA 2A1AB 1OUKA 3SXSA 3HV3A 3KFAA 5D7AA 4YMJA 3F9NA 1YDTE 1YQ3D 3AE3C 1OIQA 3LXNA 3SC1A 3D15A 5LOHA 3HV7A 2ZB0A 2DUVA 3A7IA 4DH7A 5AX9A 3W2QA 1KOAA 1HOWA 5AAFA 2XNBA 3KRRA 4DN5A 2CGWA 3FHRA 4R7BA 3ZLXA 3KN5A 2J9MA 2Z7RA 4BIEA 4AN9A 3P0MA 2QOFA 5AM7A 3TG1A 4LGGA 3MY5A 4U5JA 1YOLA 2EU9A 5JGAA 4UYAA 5DPVA 2XBAA 4WOVA 3MH0A 3RTPA 2ZM3A 1XH4A 1JNKA 2BIKB 4PMMA 3QZFA 3DLZA 1JKTA 1IA8A 3OD6X 3POZA 3F69A 1H4LA 4GT3A 5T68A 1A06A 3EQIA 5CSHA 4DEHA 5KCVA 4E6AA 3ROCA 4JR3A 3DTCA 4BCPA 4JX7A 4O6LA 5I5ZA 4GK2A 2XRWA 3NMUF 2YAKA 3KREA 1ST0A 4YTFA 1WVWA 4DHFA 5FUTA 3KULA 3MFSA 4O81A 3II5A 4I6FA 4Z16A 5AADA 3BPRA 2H89D 3CKXA 3IDPA 4UZDA 2PVHA 1H1SA 2W1GA 1Y8YA 4WKQA 1Z9XA 3W0RA 4QQCA 3Q4UA 2QO2A 5ETAA 2C69A 3LFBA 3HMMA 3PE1A 4WA9A 4XV2A 3FMLA 2FBWC 3LFNA 5HGIA 1YXSA 4KBKA 2V5QA 1YXXA 1XO2B 3UG1A 4M8TA 4FTTA 4RC4A 2UW8A 3GQLA 3HRBA 2VGPA 3LW0A 4FKVA 3PA3A 3DKCA 4LV7A 3WIGA 4BB4A 4BJJB 3VW6A 2XNGA 4KNBA 4KRCA 3ZC5A 5E91A 4JDHA 2F4JA 4O7SA 3DS6A 4U44A 3TZ8A 4GSBA 1XBAA 3M1SA 3SX9A 3QHWA 4F1TA 2W17A 1KF6D 3FAAA 4M84A 1GIJA 4NCTC 4XBUA 5FTOA 2JIVA 4RVLA 1MP8A 2C6IA 3LXKA 2C5NA 3H0YA 4ITJA 4CVAA 2ITQA 1G8JA 2OKRA 5KE0A 4NKAA 1KFYD 3KRWA 4PL3A 4XRLA 5D12A 4PP7A 2A19B 2HXQA 4BDGA 4PQNA 3KEXA 5C3JC 3IGGA 3IOKA 3PJ1A 3ZONA 5CAPA 4IVAA 5E1SA 4DEIA 3VHKA 4X7QA 4Y85A 3U6HA 3FLSA 4ZLOA 3DGKA 2WP9C 5EG3A 3LQ8A 3EHAA 2ZV2A 1SVEA 2B1PA 3MPTA 4GT4A 4HOKA 4JNWA 3PTGA 5H8GA 4EZ5A 2CGVA 1W98A 4EH4A 5DYJA 5BVDA 3TIZA 4GVAA 4YR8A 4BTFA 2WQYC 3ZZWA 4F64A 4L3PA 4USDA 1IASA 3VR9D 4RIYA 2Y6MA 3GU5A 2P33A 3I60A 5HVJA 3ZRLA 4DFYA 3CIRD 4KIOA 4R3PA 5AUWA 3UODA 3HP2A 4CSVA 4NIFB 4M13A 4D1ZA 3DAKA 5EI6A 3UPXA 3PP0A 3EN7A 4Q5HA 5CEOA 2BMCA 3BIZA 5BVEA 3FLWA 4GIHA 4OTFA 5CU2A 4ALUA 3JYAA 4AGCA 4CGAA 4E93A 5DEWA 3CR0A 4A9TA 3SFEC 2C3KA 3OXTA 3ORNA 4DDIA 4IWPA 1TFFA 2X9EA 3HMIA 4LUEA 4WRGA 3W32A 3NUPA 4FTCA 4YXDD 1JOWB 4HCUA 3COHA 3WF8A 4JT3A 3I7BA 4RIOA 5G1XA 3NS9A 4EC9A 3R8ZA 3AECD 1VEBA 4G9RA 4NFMA 5HCYA 5CF8A 2CHLA 3RP9A 4FKUA 3SFDC 3CCNA 4DH5A 2UW0A 4FMQA 3MI9A 3QYWA 1DM2A 3KL8A 4I6QA 4OTQA 4ALWA 4PTCA 3NSZA 4AUAA 1FGIA 4JDJA 2XKDA 3W55A 3HLLA 4MQ2A 4XRJA 1Q3WA 1PW2A 2PMIA 5C03A 4BZOA 2OH0E 2PHKA 3U6IA 3R1YA 3FY0A 4FR4A 3FL4A 3FY2A 3OWLA 3LFDA 2ZV8A 2BZKB 4YO6A 5AUZA 4OUCA 2XEYA 4EH9A 5FXQA 4EOMA 5CEIA 4AQKA 4KIPA 4MD8E 3JUHA 4E4MA 4EK4A 3PXZA 2XANA 4ITHA 4J8NA 4RZWA 4OT5A 4FTUA 3R8LA 2ONLC 3PLAE 3UZPA 4NM7A 4BGGA 5LCJA 3FKOA 4D9TA 1OL1A 3H9FA 5C8NA 3MDYA 4FEVA 4MCVA 3TKHA 3W0MA 3VRAC 1CMKE 2R7IA 4KSQA 4ZTMA 4LOQA 2C6OA 3CE3A 4ZSGA 3VWAA 2J5EA 4ORKA 1H1RA 3FDNA 5CEQA 3ZEPA 5ANJA 3ABVD 5IUGA 3LFCA 4I6BA 4ACHA 4N6ZA 1MQBA 2P4IA 4MX9A 1ERKA 1FQ1B 3VS3A 4BTMA 2PVFA 2VN9A 5CU3A 3AE1D 1EH4A 2WB8A 4PMPA 5KBRA 1K9AA 2VTAA 4FV2A 4YJQA 3AEEC 3LJ1A 3F7ZA 1UU9A 4QMPA 4TY1A 3N4UA 3RHKA 1GZNA 3O50A 4EOSA 3G9LX 1G8SA 4K18A 4UY9A 3CTQA 4XS2A 3V5QA 5LJJA 4XV9A 3BU5A 5LVMA 5DGZA 2PVRA 3AEDC 4E26A 3L9LA 4G2FA 1UNHA 4TYIA 4DFBA 5ANDA 3HGKA 3K5VA 1Q99A 3AC4A 1H07A 2VUWA 2YFXA 4M69B 5FDPA 5FP5A 1SVHA 3E8NA 4BBMA 4FSUA 3OCBA 3VR8C 2ZV7A 3CQEA 5CVFA 1OUYA 3H0ZA 2YZAA 3L8SA 2R0IA 4FTKA 5M51A 4I23A 4CLIA 3W2CA 3TJDA 4GS6A 3HV6A 3O17A 4QYHA 4C2VA 1GZKA 3C13A 5KMNA 3CXWA 2BKZA 4FUXA 3C0IA 2J0JA 3E7OA 5F94A 2VX1A 2XF0A 4BTKA 4E5BA 5EYDA 3D0EA 3OG7A 3ZO2A 2ZDUA 4YC6A 3QTZA 1L8TA 1YDRE 4OTGA 4QQTA 4G6LA 2WMSA 4TPTA 3O7LD 5B2LA 3HUCA 4JG6A 1WFCA 3EQFA 3MESA 5HO7A 2R3KA 3LMIA 2DYLA 5IQAA 4PL4A 4PX6A 1UU3A 4Y95A 3LJ2A 4GKIA 2J2IB 4TYHA 3LFSA 1MQ4A 1AGWA 1FGKA 2B4SB 2QC6A 2W4KA 3EQPA 3QX4A 4XG9A 5EOLA 5A4CA 5IZFA 3DKFA 5FEQA 3DNDA 4FTLA 5M56A 3FLYA 3ET7A 2Y4IB 4NTTA 3PP1A 5KMOA 4X2GA 3PG3A 2FBWD 1IAJA 4BCHA 5A9UA 2FB8A 3A2CA 4BZDA 2BS4C 3ROYA 2W4JA 4BJJA 1NVSA 5FQDC 3OY1A 2YZLA 4ZXTA 4FIFA 2RFEA 4L9IA 3ORXA 3L9PA 3TNIA 4BC6A 4EBVA 5I9YA 5EKNA 3AC3A 2ZDTA 5I0BA 3COKA 3RAKA 4JBOA 4KWPA 4G34A 3RCJA 3WZJA 4CMTA 5HNBA 4WNMA 5IA1A 5DEYA 1Q8UA 1H25A 3AMBA 3R1QA 4FT9A 2CGXA 4QEBA 3VF9A 1BUHA 1IRKA 1VR2A 4Z3VA 1E7PC 4GT5A 4A07A 5HCZA 3C0HA 3O8PA 3MVJA 2YJRA 4YPSA 4II5A 4FC0A 4UBAA 3L8XA 3S0OA 5J7HA 4LGHA 4TTHB 1DAYA 2X2KA 5BQ0A 4ZSEA 3AE2D 3BYSA 2WIPA 4G31A 5HG5A 4JDIA 1JSTA 2Y7JA 5CF6A 4TWNA 3P4KA 3KMUA 2YEXA 3FMNA 4FTAA 4NCTA 4RA4A 2GS6A 2B52A 3EFLA 5HBHA 4FV7A 3U8WA 4RFYA 2O5KA 1K3AA 1PXJA 2OZAB 4B4LA 5IPJA 5T3QA 2ZFYA 3SOCA 3FEGA 1GY3A 3Q04A 5C8KA 3VC4A 4QT1A 3IG7A 3E8CA 3MVHA 4G16A 2VRXA 2WHBA 3QXPA 4R7IA 5A4TA 2UVYA 3PLSA 5IU2A 3BHHA 2BIYA 4EH2A 3AE6C 2J7TA 3RK5A 3LLTA 5AP2A 5CU0A 4CG9A 2EXCX 3BHTA 2PE1A 4L52A 4YSZC 4BBFA 4I0RA 4O0TA 4OBOA 4YLLA 3DAEA 4L7FA 4ZZMA 4G3EA 2HZNA 5CANA 3JVSA 5AP4A 2NO3A 1ZP0D 2P2HA 3MS9A 5E8TA 3AE5C 1R1WA 3LLAA 2WDVC 5HI2A 5GJDA 1PMVA 3SXFA 2NP8A 4FSYA 4GK3A 4JBVA 5FRIA 4JI9A 4QTEA 1KE7A 2BRBA 3LFFA 1F5QA 3C4FA 1ZZLA 5A4QA 3CY2A 4C3FA 4MVFA 3TN8A 2YM7A 2QD9A 3K2LA 4U0IA 3F2AA 3UBDA 3W0OA 1FVTA 4KKHA 1PXLA 3FKLA 4F0IA 4CCBA 4M0YA 3HECA 1OPLA 4FVPA 2ITZA 3RNYA 4EOOA 4LRMA 3I0OA 3LAUA 2ZM1A 4K6ZA 3P86A 3AE9C 2C5VA 1V0PA 3SGCA 3O8TA 4AXFA 2HELA 4FKWA 4YBKA 2BAQA 4BHNA 4D1XA 5JFVA 2VD5A 2YAAA 3ORKA 4AZSA 5DRDA 2PE0A 3VUDA 4ASZA 5J5SA 5EM6A 5JMSA 4LI5A 3EQDA 4C37A 1B38A 4WSYA 3VRYA 3UQGA 4FVRA 1V1KA 4H1JA 1BMKA 2ONLA 2RF9A 2QO9A 2XNPA 1QPDA 4XG2A 4JBPA 2C6MA 3EOCA 1ZARA 3KC3A 4QMUA 4FSTA 4P7EA 2WTWA 4LV8A 2IZTA 5H3QA 4IAIA 4YP8A 4MNFA 4YTPC 4V01A 4M67A 1QCFA 1H1PA 4JIKA 4GW8A 1UKHA 3HDMA 3GC0A 3UO5A 5FGKA 4QMTA 3ZMMA 4DTBA 1CKPA 3I0QA 2QODA 4RJ6A 2R3IA 3ZFYA 3DB8A 4I5PA 5AP5A 2YM5A 3QCXA 1LPUA 2XNNA 3F3TA 4BCMA 4K33A 3I4BA 3ZOSA 4IACA 3EYHA 4CQEA 1P2AA 3G6GA 3KF7A 4O0YA 5IEXA 2IWIA 3NUAA 2XZSA 3FBVA 3COMA 3WF5A 1ST4A 4O21A 5CXZA 5EDRA 2QOKA 3E88A 3V5PA 2W99B 4F9CA 5KMMA 3NGAA 4BBEA 5HVYA 3TNQB 2GNHA 4E73A 4F63A 4W8DA 1XH7A 1LP4A 1Z5MA 3FLZA 3DA6A 4QDVA 3U51A 4AGWA 3P08A 2B54A 1ZMUA 1Y6BA 4IAAA 3LCOA 3LQ3A 5IUIA 3BU3A 3U4UA 5JZJA 4FTOA 5M06A 4Y83A 2XM8A 5FXSA 3AC2A 4ZZNA 3BYUA 3DOGA 4LFIA 4HGLA 4NU1A 3DK3A 4RGJA 2ESMA 3EWHA 3AEBD 3UZTA 4U8ZA 1JBPE 3NIZA 3EFKA 2VTTA 4JOAA 4DBXA 5AV2A 1XH5A 4Q5EA 3OW3A 3JY9A 2YCQA 4FV6A 2O3PA 5I9WA 3FV8A 3FL5A 4QMVA 4D4RA 1AD5A 1OIYA 3G9NA 3NRMA 4L46A 4UB7A 1E1VA 1RE8A 3IDCA 5IA0A 2ZMDA 3T9TA 3B2TA 3TZMA 1HCLA 2IZUA 1U54B 1UU7A 4RFMA 1ZLTA 4M3QA 5IQDA 5M08A 4WNKA 2PZRA 1TQIA 3PY0A 4DH8A 4FZDB 4RWLA 4AZWA 2QURA 4IMYA 3QTRA 2XJ1A 3H9RA 2I0YA 2P55A 3IS5A 3RCDA 3UVPA 4D2SA 3T8OA 3NW6A 3C4XA 1OL6A 4DTKA 1CDKA 2OGVA 5K4JA 5AP7A 4F7NA 2FA2A 4O7WA 4D1SA 3OUNB 4YT0D 5L6OA 4AA4A 4RIWA 4F70A 2WMWA 2CJMA 4XYFA 4FIHA 4GFOA 4IJPA 2WXVA 4U41A 3E8EA 3VRZA 4UWBA 4BDHA 3V5WA 3DV3A 3E7VA 2OZAA 2QKWB 4AQCA 4EHZA 4MK0A 3QRUA 3BE2A 2W9ZB 5ETCA 3R30A 5ACBC 4DEGA 4HVSA 5CEPA 3R22A 5D10A 2P0CA 4FTRA 3VRBC 4M7IA 4QMWA 1J1BA 3KN6A 4I1ZA 5DOSA 4J8MA 2QR8A 1LEZA 4DGNA 4PDYA 4C3RA 4BGHA 3OUKA 3OT8A 4TL0A 3AE6D 4FTIA 3QRJA 4O0VA 3Q5IA 5HNIX 4G5PA 4FI1A 2JKKA 1M2PA 4MAOA 2NYAA 3WZKA 2IO6A 4YSZD 3KQ7A 5JRSA 4LG4A 3W2RA 5DT4A 3D83A 3LMGA 3FQEA 4MNEA 2YIWA 3WILA 3A8XA 4OGRA 4ZS0A 5GJGA 3I5ZA 2PL0A 4DT8A 3AE5D 3QLFA 4D0XA 4FA2A 3UOJA 2WDVD 2I6LA 2PTKA 3OCGA 4BKJA 2H89C 3HYHA 1VZOA 5AP3A 4A9UA 3FPMA 3C4WA 3MIAA 2F9GA 4FTJA 4OT6A 3R9NA 1QPCA 3BGQA 2OLCA 2Q0NA 5EH0A 4CXAA 3NUSA 4WNPA 1TVOA 4RT7A 5JFSA 4DH1A 4EJNA 4TW9A 1SVGA 4HVDA 5HIEA 3A99A 3FMHA 4G3DA 2G1TA 2I0EA 4TYJA 4AFJA 4FKLA 2OJ9A 2GPHA 5E4HA 3VVHA 2BRMA 3NUYA 4RX8A 4RVKA 4CFVA 4BDCA 4DCEA 4DFLA 4FTNA 4O86A 1KF6C 4YC8A 2BDFA 1UNGA 2ITWA 1YKRA 3SG9A 3AC8A 5A6OA 4X2JA 4AOIA 3O5AA 2CN8A 2W1CA 1KFYC 1ZYSA 2X7GA 3N51A 5JT2A 3S1HA 3ITZA 4FZ6A 4LRKA 1Z57A 4EYJA 3F3WA 1PJKA 1A48A 1BLXA 4Y73A 4TZRA 4AW0A 5C01A 4OBPA 3SVVA 2ZVAA 2IJMA 3C50A 4UN0C 3QUPA 4J96A 3EKKA 4YTPD 4F6SA 2YA9A 4YTHA 4NKSA 3TUDA 3ENMA 4K11A 1KWPA 4MKCA 4XJ0A 4KUJA 3O71A 2WDRD 3LOKA 4U3YA 4MF1A 3PPKA 3VBVA 3QD2B 3VAPA 3R6XA 2OIBA 2R3LA 2DQ7X 2E9UA 3PVUA 3CIRC 5FEEA 4C62A 2WMQA 4RIYB 3EJ1A 3VS0A 4BCJA 4EQUA 2XARA 3COIA 2XH5A 3DK6A 1ZOHA 2UV2A 5LWNA 2HXLA 5KMKA 2OIQA 4JIAA 3BQCA 2XYUA 4A4XA 3Q2MA 4EUUA 1ATPE 3CEKA 3DCVA 5H2UA 4EH8A 4CT2A 3FZSA 2UW7A 4WUAA 2UW5A 5HORA 3AECC 2YDJA 3GEQA 3VBTA 2BPMA 2UZUE 3OP5A 1JKKA 4C3PA 3VBWA 4I5HA 4P90A 4IM2A 3TTJA 3PVBA 3ULIA 4C4JA 1V0OA 2XK8A 3H9OA 3UYSA 2HIWA 4EJ7A 2B9JA 1LR4A 3MVMA 4MUQA 3NUNA 3IW6A 3UE4A 1OM1A 4E4LA 5J1VA 2GQGA 4FOCA 4GKHA 2R64A 4R3RA 5ANGA 5DR2A 4FIJA 4C0TA 3EN5A 3P7BA 4M12A 2VTHA 3PUFC 2X4ZA 4AT5A 4FJVA 3TIYA 2IVSA 3BEAA 3QZIA 4RWKA 2ITYA 2JBPA 3W33A 2VV9A 3C5IA 4KAOA 3VJNA 4F4PA 5LMBA 5EYCA 3G0EA 3L9MA 2Z7LA 2XCKA 3E87A 2R3NA 4DDGA 2R3HA 3KXZA 3BKBA 3Q9XA 4S34A 5KX8A 3AKLA 4EOJA 1WMKA 2A0CX 2Y0AA 3IONA 5CTPA 4ZY4A 3A4OX 2E9OA 3G33A 4XP3A 4XHKB 2VTNA 3DQWA 2YDIA 5CAVA 3K54A 3QTSA 4GK4A 1ZYLA 3V51A 4MXCA 4X6RA 2R3JA 4L00A 1TQMA 4BCOA 3AC1A 3H3CA 3OWKA 3PXFA 3E5AA 3F88A 3FKNA 3K3JA 4JG7A 3Q96A 2W9FB 5EI2A 3W0PA 4AF3A 4FV4A 4RLLA 3V8TA 4A4LA 3QA0A 3P4QD 2YM6A 3MB7A 4ERKA 2XVDA 1ZOEA 1H1WA 2C0IA 5CSPA 3KXMA 1J7UA 2BAJA 4EHEA 3MGYA 3TMOA 4MWHA 3QQLA 3RAHA 3WZDA 4ZMFA 1OGUA 2YISA 1FINA 3AG9A 4FG8A 4H05A 4AZTA 3ORMA 1PXPA 3MJ1A 2UZVA 3EFJA 2EB3A 2LAVA 2PZ5A 2XMYA 3CD8A 2WMXA 4FOBA 4FV1A 4L6QA 3S3IA 2IPXA 3SW4A 2CSNA 3DJ7A 3LCKA 3DJ6A 4G6NA 1SNUA 1PYXA 2W1ZA 3MTLA 3OF0A 1Q4LA 3OEFX 4KSPA 4NT4A 4ZOGA 3VRBD 4HGTA 1KOBA 5JKGA 5AM6A 4F6UA 4GMYA 3HA6A 3UZRA 4EOKA 5AA9A 2A4LA 2OF2A 4Z55A 3MA6A 4QP7A 4XNEA 5B7VA 5JQ5A 4RVTA 3CP9A 1KSWA 2GQSA 2W1FA 3MH1A 4Y8DA 5CS6A 4DINA 4ENXA 1JKSA 4G3CA 1L0VD 2RIOA 4QQ5A 4EI4A 4D58A 3V04A 5BUIA 3VNTA 5IMXA 4XG4A 4IAZA 1GJOA 4FX3A 3BX5A 1XMLA 3BRBA 4KBCA 4YJSA 3TKUA 2OK1A 2GU8A 4A9SA 1UVRA 3FMEA 5F9EA 1M17A 5LVPA 1H01A 2F7XE 4GEOA 4LMUA 4RFZA 4E20A 5FD2A 4FSRA 5E8SA 1F3MC 2WD1A 3OROA 3QD0A 4F9YA 3ZDUA 1BL7A 2C6EA 4NWMA 3I6UA 4NFNA 3PVWA 4EH7A 3IW7A 4HCTA 1W84A 3A7JA 4TYHB 4Z7GA 1ND4A 2C0OA 1CSNA 2YJSA 3DBCA 1YWRA 3FMDA 3CC6A 1PF8A 1PKDA 1OL5A 2VX3A 3RVGA 1U5QA 3JVRA 2FSLX 1QPEA 4N6YA 3TZ7A 3AMAA 2BVAA 5HX8A 5HZNA 2UZWE 4AZVA 3AEAD 4E5AX 4H39A 4IZAA 3F66A 4EK3A 4L43A 4PV0A 4BCNA 3E93A 1KE8A 2F2CB 5IQCA 4O91A 2VTJA 1JLUE 3NVKI 4BCKA 3CJFA 2RFDA 1ZMWA 2JDOA 2XK3A 3R8UA 5C4KA 1ZYDA 2JKQA 3QLGA 3RWQA 3GVUA 2VTMA 5CQWA 1ZOGA 2PY3A 3F3UA 1QPJA 1YXUA 3QD4A 4ZSLA 3ZO3A 5KNJA 3A7GA 5E8XA 3WYYA 3AE8C 2CPKE 3O7LB 4JRNA 4CTCA 4J98A 3EN6A 2JITA 2R3RA 1YWNA 2ZMCA 3D5XA 4HPUE 4XOYA 5JQ8A 5ANEA 2PMNX 2XIYA 3EQHA 1YOJA 3TJCA 1M7NA 3KU2A 4FODA 4YJOA 4DEEA 4P2KA 1R78A 2CNVA 3IO7A 2OXYA 4EYMA 2V62A 3MTFA 5M4UA 3HL7A 4TNDA 3TV4A 2VTSA 3OW4A 4TN6A 1UWJA 4HJOA 1OBGA 3OS3A 4M14A 3CQUA 3AEGD 3DTWA 3L9NA 5GHVA 3AE2C 3GCPA 3N9XA 1SMHA 5KBQA 4IAYA 4DH3A 3S00A 2C3JA 1STCE 5EDQA 3Q9ZA 2C3LA 4IM0A 3R7VA 4DG0E 2V7OA 4KX6D 3D4QA 5CSXA 3I7CA 3QKMA 4YZDA 1OL7A 4DYMA 5M44A 3DZQA 3ANQA 2YERA 2XAOA 3SRVB 2WQBA 3WOWA 4AXEA 1WCCA 4HGSA 5BVFA 5L2WA 4MBJA 4ZTHA 2IZRA 3IECA 4FK3A 4V05A 4YLJA 5DBXA 4QYFA 2R4BA 5KZIA 4ANQA 3HRFA 2P3GX 3OC1A 1OECA 4ANLA 2VNWA 3GFWA 3ZS5A 3BZ3A 4F7LA 3QWJA 3EL7A 3Q52A 1Y6AA 3CGFA 3IOPA 4IJ9A 2PU8A 2QU5A 1GAGA 4K8AA 3KRLA 3FZRA 1ZP0C 3QXOA 3MY0A 1WBNA 4B8LA 2XKCA 4AS0A 5IQFA 4J52A 1DI8A 4X6QC 4I21A 3ZO4A 4YTMC 3DQXA 3FI4A 2Y8OA 1BX6A 1FVRA 5HBEA 2JDVA 2Z7SA 5BMSA 2C5XA 3QQHA 5FTQA 4U45A 3UO6A 4FL2A 2PUIA 5M4FA 1U46A 4GJ2A 4WG5A 5AA8A 4PDOA 5CVGA 3R8PA 4F9WA 3W8QA 3SLSA 2H88C 3SG8A 1Y91A 5DR9A 3A4PA 4TWCA 4D0WA 5E90A 4RRVA 5J9ZA 2SRCA 4F78A 4O0WA 4IC8A 3TKIA 5HLWA 4Y5HA 4AT3A 4O2ZA 3GENA 4JR7A 4AACA 2WFYA 2YDKA 4WD5A 3UIUA 4YZMA 3T9IA 4LUDA 3WE4A 4AW1A 3WZUA 4DT9A 5BVNA 4QO9A 4DGMA 4EOQA 3G6HA 4TNBA 4W4WA 1IAHA 3AC5A 4L8MA 4FSNA 4NM3A 2WKMA 4QP4A 4O7VA 1NVRA 4FG7A 4UWYA 2R3GA 4FEUA 4F9BA 1T46A 2OJIA 5FBNC 1FMOE 2E9NA 3QWKA 4J99A 2RFNA 5DR6A 2YWPA 2VTPA 2V7AA 3VUIA 4DEAA 4JQ7A 3WZEA 4ACMA 4NM5A 3G90X 3DBEA 3AEFC 3O8UA 3TT0A 2ZOQA 4KINA 2YABA 1UNLA 4GUBA 4HPTE 1G3NA 4DFZE 3OTVA 4L42A 4JAJA 4QMOA 4QMYA 5CU4A 4ZTNA 3TXOA 2C68A 3VQUA 3VS4A 2I0HA 3A7FA 4FKRA 3P4PC 2X7FA 1OIRA 3GU7A 2OXDA 4D9UA 4JXFA 3FZTA 1OKVA 3CGOA 3D5UA 4RJ5A 2QOCA 2CGUA 4FK6A 5JN2A 3UG2A 2C1BA 3FYKX 4TWOA 1ZAOA 4O7YA 5L2IA 5FLFA 2W5AA 2WEVA 2B9IA 2WMRA 5JGDA 4F0FA 1VYZA 4RPVA 4MTAA 3FJQE 5CYIA 3ANRA 3IGOA 1NW1A 4EONA 2LGCA 5D9HA 5M55A 3LXPA 1S9JA 3QL8A 5HD7A 4NJDA 3RKBA 3AE7D 1S9IA 2ETRA 4E4XA 2GFSA 4I3ZA 3QBNA 3D7ZA 2GS7A 4G9CA 4U79A 3UOLA 3VJOA 1FPUA 2VTLA 4IWOA 3REPA 3CPBA 1UV5A 2O8YA 2XCHA 2VAGA 2QLQA 4DF3A 3ZBFA 4BDFA 2PVJA 1ZY4A 5L8LA 4ARKA 3UOHA 3ZO1A 3BHVA 2OJFE 5AUUA 4QP2A 3LCDA 5DA3A 3PYYA 1RDQE 4LOPA 3AEBC 2ZV9A 1X8BA 3F61A 1P5EA 3QKLA 1W82A 4FYOA 4G3FA 5GIOE 4OTHA 1YXVA 2X7OA 3NDMA 3KGAA 3R1NA 4YNOA 1CKJA 3R2BA 2JIIA 3UMWA 4USEA 1JAMA 2OBJA 2YM8A 3BI6A 2GMXA 4JJRA 5EDPA 4I92A 4MHAA 4O7RA 4RBLA 4RVMA 3RK9A 4E6DA 2E9PA 3AE8D 5BVOA 1OKZA 4NYEA 2WNTA 4QTBA 3OFMA 4WNOA 4C7TA 3CTJA 5J95A 3FMKA 3HA8A 2O0UA 3ORTA 1PRYA 5CAOA 1IA9A 4EZ3A 5AP1A 5CZHA 2JLDA 3I79A 1GOLA 4PMTA 2PYWA 2AYPA 3EYGA 3QZHA 4Q9SA 5CI6A 4CKRA 4YT0C 5LXMA 3TV6A 2F57A 4LL0A 3SHEA 4UZHA 5HE2A 5KMLA 1J91A 4RIWB 3PSBA 2XIZA 2ZAZA 1REKA 4MH7A 1YW2A 2C6LA 3HMNA 4B0GA 4EL9A 3LKMA 4BR3A 3C5UA 1H27A 3SRVA 3BV3A 4QTDA 1CTPE 4RJ8A 4NH1A 2GS2A 1YHVA 4G1WA 3NVMB 2Z2WA 3TNPC 4UV0A 5HG9A 2F7ZE 3S4QA 5AEPA 4O83A 2RFSA 1XH6A 4G6OA 5DH3A 4AP7A 2OFVA 2HCKA 1G8AA 4EWQA 2JFMA 2VGOA 5LMAA 4GVJA 4EQMA 4RG0A 5HU3A 3GI3A 3W16A 2IW8A 3W2PA 2BZJA 4FIEA 4NL0A 4N57A 5EYMA 2ETMA 1H08A 2G15A 2YM3A 2WMTA 2J0LA 3UNJA 3GNIB 4R1VA 3BGPA 3VS6A 1H24A 2H96A 3QUEA 4I4EA 5GJFA 3VQHA 3U55A 2ZM4A 5EK7A 5HLNA 3RHXA 4KABA 4MNEB 1P4FA 5B2MA 3P4SD 2I1MA 1H28A 4ZSJA 3KIOC 4YTMD 3FZOA 4X3JA 3ZH8A 3MWUA 2PWLA 2OIDA 3PY3A 4QOXA 4O84A 4F7JA 2QOHA 3QTWA 4DITA 2VWUA 3PRIA 2OU7A 2PULA 2KTYA 4FZ7A 4EHGA 2I0VA 5IUHA 2H88D 1XBCA 3NUUA 2IW6A 4FSMA 1YQ4C 2W06A 4CEGA 4DEDA 1Y57A 4NW5A 5L2TA 2RGPA 4CD0A 1W7HA 3Q9WA 3KK8A 5TKDA 3LCSA 5IDNA 4R77A 3LCTA 2XRUA 1VLRA 4TYEA 2CKQA 3UC3A 4U40A 4H3BA 3DDQA 4AOJA 5E8WA 1OI9A 3D5VA 5F1ZA 5M07A 4OW8A 3AXWA 4K9YA 2ITOA 3P79A 4PDPA 2WTKC 4C2WA 4KD1A 1BI8A 2WU2C 2R7BA 4R5YA 4XLIA 3ACJA 3DKGA 5FM2A 3QCSA 5BYZA 1PMNA 3O0GA 3RPVA 1PXOA 3IPHA 3Q5ZA 4HCVA 5C9CA 4MXZA 5G6VA 4MD7E 4QP6A 2W96B 3AEFD 4J53A 2C5OA 2FUMA 3TYKA 3QKKA 4FKPA 4AXDA 5L8JA 4YSMA 4EKLA 4YURA 4YTNC 3UNZA 2AUHA 4C36A 3QTIA 4M15A 2QNJA 4DEBA 1NY3A 3P4PD 3RMFA 2WDRC 2QOLA 4AW2A 1B39A 1DI9A 4QMNA 4CKJA 2X0GA 4G3GA 2XK6A 3VUHA 4I6LA 3QFVA 4IB3A 3QGYA 2VTQA 4AA0A 3HEGA 3I1AA 3S2PA 3ZXZA 3F5GA 1NEKD 4WBOA 5CX9A 5CEKA 3GQIA 1O6KA 2WTJA 3CBLA 4O0XA 3NLBA 3Q4TA 4WT6A 5EOBA 3N4TA 4GG5A 3UIXA 3CKWA 3DK7A 1MUOA 2YIQA 3Q4CA 4H3PA 4L53A 4JX3A 4FGRA 2WTKB 2GHLA 4HZRA 2H6DA 2VO6A 3PZEA 4MWIA 3RJCA 4USFA 2XIKA 3CJGA 4U9AA 4YJRA 3PJ3A 4BZNA 4XLVA 2XM9A 2XK7A 3V8SA 4X0MA 3SV0A 2WTCA 2XIRA 3R7EA 1J7LA 1HCKA 3LFEA 4APCA 2R3FA 3NW5A 3TZ9A 2YCSA 5D11A 3UYTA 3KA0A 4C4GA 2UW3A 2WMVA 3PJCA 4NJ3A 4R6VA 4ANBA 5JSMA 3MSSA 4PY1A 2BFYA 3KB7A 1ZWSA 4HYHA 3OBJA 2WU5D 3ZTXA 3EFWA 5BUJA 5C4LA 2OWBA 2YIRA 5KHXA 4FV0A 3GT8A 5LARA 4C35A 1YI4A 1YWVA 3W0SA 4RLKA 1WZYA 4BDBA 2XUUA 4GRBA 4GG7A 5FDXA 1WBOA 4IE9A 3GCQA 3BHYA 4V04A 4AGDA 1CM8A 2WS3D 2V0DA 4IVCA 4QQJA 1F0QA 2VO0A 3C0GA 3W0QA 4KA3A 4DCAA 2PVNA 2HZIA 3QTUA 3EH9A 4U6RA 4FNXA 3UGCA 2J90A 4X2NA 4C4HA 4GYIA 4UWCA 5IG1A 4IDTA 4FV5A 4JVGA 3OEZA 3FXZA 4FKGA 3WF6A 4BN1A 4DFXE 4YSXC 1PMUA 5M53A 2RKUA 5J1WA 2ACZC 3EQBA 3IDBA 2EB2A 4Q2AA 3C7QA 4TKSA 5CNOA 2ITPA 3RPRA 4WRSA 3F2NA 2ZYBA 3WF9A 3P4QC 4PRJA 5AUVA 5HG7A 2BZHB 3IW8A 3PZHA 1WVYA 3GP0A 2F49A 3QHRA 4FT3A 2BTRA 4EOIA 5AMNA 1V0BA 4YPDA 3ETAA 4ANSA 3NNVA 2J0KA 3ZLYA 3AD5A 2ERZE 5FXRA 1Q8ZA 3F3VA 2BTSA 3RI1A 3W18A 3JY0A 3LM5A 3ORLA 5HIDA 4DHJA 3DXPA 4FKQA 1H0VA 3TWJA 1PKGA 5CASA 5ANOA 2VO7A 2A27A 3PWYA 1KE5A 1XJDA 4R7HA 3E62A 2BALA 2X6DA 4M97A 3RPOA 4AOTA 1IG1A 2FYSA 4YHJA 4E1ZA 5HE3A 4QP3A 1Q8WA 2DWBA 3H30A 3MVLA 4EHVA 2HZ0A 2WZJA 3A7HA 4FE2A 4J71A 4ALVA 3GC8A 2W1DA 5AP0A 2WTVA 3TV7A 4DLIA 5HG8A 1L0VC 3JPVA 4FVQA 5CF5A 4YSYC 4DAWA 4P5ZA 2YITA 2PK9A 2R3QA 3LFQA 3UVRA 4DFUA 3PXRA 4Q9ZA 4YC3A 3ZCLA 3NAXA 2XK4A 1KUTA 3AMYA 1T45A 3NNUA 4I94A 2JDRA 2W5BA 4W4VA 4HNFA 5JZNA 5TF9A 3FUPA 3R83A 3UP2A 4RX7A 2IVVA 3AGMA 4W4YA 3ZFMA 5HE0A 4AA5A 1Q61A 1ZZ2A 3UNKA 3E8DA 2QOOA 3BLQA 3ATTA 2NNWB 3NUXA 4AZFA 5JK3A 2XKEA 4XP0A 1OKYA 3QQGA 3R0TA 5DHJA 4F6WA 2XALA 4I6HA 4CFFA 4AU8A 4YSJA 1YQ4D 4R78A 3FXWA 3PG1A 5ETIA 3RK7A 4D55A 3DFCB 2R0UA 2WOUA 2Y9QA 2O63A 3IKAA 4FG9A 4Y46A 4N0SA 4DTAA 5HVKA 2FSMX 2B55A 4FV8A 5CSVA 3AEAC 4UYNA 2G01A 2X39A 4K0YA 4S30A 3E3BX 3LVPA 4IC7A 4LOOA 5I4NA 5I9VA 4FKTA 1BYGA 4PWNA 3KF4A 3ZU7A 2I40A 1WBTA 3TM0A 1P14A 2O2UA 2QU6A 1W83A 3QZGA 2BUJA 4MBIA 4KBAA 4PL5A 3C51A 5HCXA 4EK6A 5JEBA 3R1SA 2WU2D 3R02A 5M09A 4E4NA 5A4LA 3U9CA 4A06A 4ERWA 3OOGA 2QHNA 3PY1A 2Y4PA 4DGOA 3PWDA 3FC2A 2GNIA 1OB3A 3PVGA 5H9BA 5IEVA 4ZJIA 4GFGA 1OKWA 2PZPA 4YNEA 3RALA 4CMUA 1GIIA 1KV1A 4YTND 2JKOA 4TRLA 5I9UA 3DXQA 4YGAA 2XB7A 4O38A 3OVVA 2HY81 1BI7A 2UUEA 4FNWA 3RPYA 2C6KA 4BICA 2W4OA 2HK5A 2AC3A 3GC9A 5CVHA 3ZDIA 3UQCA 5ANIA 5A6NA 2O65A 1OGYA 3AEGC 4WIHA 1H8FA 4BDAA 1Q3DA 3CLYA 3Q4ZA 3GCVA 4GU6A 2OH4A 3WBLA 3PA5A 1CKIA 2PVKA 5IQGA 4AE6A 4HYUA 5LVNA 1A9UA 3P1AA 3NAYA 4D4VA 3I5NA 4KX6C 3UDZA 3OHTA 2GHMA 1RW8A 2BRGA 2CMWA 3L1SA 3R2YA 3SDJA 2OF4A 2PZYA 4CKIA 4JS8A 3UPZA 3PPJA 3QU0A 4XV1A 1ZRZA 3LXLA 4CG8A 5E8YA 3PE2A 2QI8A 1Q8YA 3VUMA 4AXAA 2OO8X 3IW4A 3TI1A 3FLQA 4FICA 4QP1A 5CT0A 2VNYA 4LYNA 2G2FA 4G17A 3LHJA 4KKEA 4U43A 4FNYA 3ZRMA 1FOTA 4JG8A 3RINA 2NRUA 4L3JA 2IG7A 3POOA 1NT2A 3QRTA 3ZSGA 4AN2A 5E7RA 2P2IA 3CTHA 1OMWA 1YI3A 2GTMA 5LMKC 4GCJA 4OTDA 1PXMA 1MRUA 3MPMA 3VS2A 4AW5A 4Y72A 5A3XA 3ERKA 4C4IA 3MY1A 4E5WA 2C0TA 1U5RA 3BYOA 4QPAA 3EMGA 3QGWA 2GDOA 2RL5A 4RX9A 4F08A 2OW3A 3HUBA 4TXCA 2UZBA 3THBA 3P4RC 3UVQA 4AXCA 3CD3A 4EQCA 3ZFXA 3KMWA 4IZ5A 2X1NA 3ZUVA 5CNNA 4D2RA 3UDTA 5GIPE 4JMQA 4YSXD 4MXAA 2ACZD 4F9AA 4O0SA 4CCUA 2JDTA 3V3VA 1JKLA 3E3PA 4GJ3A 3R8VA 1Q97A 1PHKA 3QA8A 4X3FC 5A46A 5HTBA 3OMVA 4FSWA 3EN4A 3C4ZA 4ZZOA 2J0MB 5L6WL 3O96A 5DLSA 3ZSIA 1WBVA 3MN3A 1LUFA 2GNLA 2QG7A 4LDTA 1PXNA 4YBJA 4DLJA 5CENA 3EB0A 3BBWA 3PUPA 2DS1A 4FNZA 3KVXA 3PXQA 2PVLA 2E2BA 1ZMVA 2VWYA 2XKFA 4FUYA 2J5FA 2X9FA 4WO5A 1PMEA 5AP6A 1GIHA 3I6WA 4IWQA 4O0UA 3W2OA 1M2RA 3QRKA 4JL9A 3ELJA 4QMZA 5KMJA 4HYSA 4HGEA 4AG8A 5K5NA 5E1EA 2PUNA 1BL6A 4YTIA 4OTRA 2X6EA 3MV5A 1H26A 1M7QA 5AWMA 5LVLA 4FKSA 4XH6A 2PVYA 3DKOA 3ZUUA 5EI8A 2R5TA 2W1IA 3HAMA 4YSYD 5HICA 2ACXA 2YIXA 4MEDA 1SM2A 4GV1A 3MPAA 4RIXA 3RM6A 3HAVA 3VBQA 4CTBA 1WBPA 3FMJA 1B6CB 1FBNA 1GZ8A 1XQZA 3OWJA 4X3FB 4C02A 3DLSA 4CFWA 3LPBA 3DU8A 3VUGA 2BCJA 2HZ4A 5BVWA 3ZM4A 4RQVA 5ANKA 3AE7C 1ZYCA 2JAMA 5K4IA 3EQCA 3H10A 4F09A 5J9YA 1BKXA 3A62A 3NR9A 2UZDA 4F1MA 1OPJA 2B76D 3ENHA 4V0GA 3Q53A 3L8PA 3PIYA 4DE4A 3F7WA 4I41A 2V55A 3D7TA 3RPSA 4L7SA 5AIKA 3RAWA 5F95A 3PIZA 3F2RA 4EBWA 5DT0A 1W0XC 4ZLYA 1Q8TA 2WTDA 2X81A 2JD5A 3GU8A 1G5SA 3LFAA 4FSZA 1YDSE 4R1YA 3HZTA 3MBLA 3P23A 3SD0A 2BAKA 4O7LA 3ZM9A 4Z9LA 1WVXA 2A2AA 5IQHA 2R3PA 4XG8A 4MQ1A 2R2PA 2WQEA 3HMPA 4CNHA 1URWA 1PXKA 3RGFA 4CV9A 2C5YA 3K3IA 2HWPA 1UKIA 3BLHA 2R3MA 5KZ0A 3ORZA 3CPCA 2X8IA 5EQPA 3PFYA 4ZTQA 3FC1X 2J6MA 1I09A 3BL9A 3GXLA 3NX8A 3V5TA 3BWJA 4E6CA 3A8WA 2F7EE 4EH6A 4BI0A 2YCFA 3AT2A 3R7UA 1YI6A 2XJ2A 3MH3A 5HE1A 4J97A 2QOIA 2JIUA 3JS2A 2WQMA 4IHPA 2BRNA 5CALA 4QNAA 4DGGA 4QMQA 2QO7A 4ITIA 2FVDA 5IQEA 4D5KA 4X21A 4ZMEA 3B8RA 2C4GA 3F6XA 3KRXA 5JGBA 3NCGA 1YRPA 3OZ6A 4EH3A 2ITTA 2REIA 3UDSA 5K5XA 4IM3A 4KRDA 3PFQA 2YIYA 2IW9A 4O82A 3DAJA 3GCUA 3ZBXA 5AX3A 4BCIA 3NYOA 4L01A 4GUEA 2JKMA 3UDBA 2WAJA 3M11A 3EZVA 4BY9E 1W8CA 1FVVA 4U7ZA 5D1JA 3G2FA 3UMXA 1YQJA 3DJ5A 4AGUA 4EOPA 5AAGA 3QCQA 4ZLZA 2X2MA 3PJ2A 3QF9A 3PSCA 4I0SA 2WELA 1XWSA 1YVJA 2QCSA 3FI8A 4YZBA 5E8VA 2YCRA 5EM5A 3BQRA 4UXQA 4U81A 5FBOA 4PUZA 5AV1A 3KY2A 3RNIA 5HEZA 3OY3A 3ML1A 1RQQA 4EKKA 4FTMA 5IMEA 3W10A 2QVSE 3GFEA 4M0ZA 1NXKA 1JPAA 4WHZA 1E9HA 2BKKA 3IQ7A 4ZK5A 4L3LA 3TL8A 2OJGA 3E63A 5CF4A 3DZOA 3AE4D 2BZIB 2OFUA 3P4SC 1JSVA 1QMZA 3A61A 4I93A 5LVOA 3MB6A 3NFGB 3BWFA 5GINE 2HWOA 4BCGA 1XH8A 4K2RA 3NNWA 3UOKA 1UU8A 2XEZA 3CIKA 3P4RD 2HENA 3R21A 2GNJA 3WYXA 2VTRA 2PVMA 2Z7QA 4DFNA 3DBDA 3P7AA 4EZ7A 3R7IA 1P4OA 3PXYA 4Y5QA 4ACCA 3DXNA 4P4CA 4HVGA 4RMZA 3BE9A 4XP2A 2EWAA 2UW9A 4NM0A 4YTCA 3U54A 3PIXA 2PUPA 5JFWA 4AFEA 5HO8A 2VTIA 4J1RA 4RA5A 5AV0A 4FT5A 3RZBA 4CRLA 3GGFA 5LMKA 4QPSA 2HW6A 2XNMA 5IQBA 2R9SA 4O0RA 4ASDA 2WU7A 1Y8GA 5IA3A 3OCSA 1AQ1A 4AAYA 3KK9A 3W0NA 2NPQA 4ZJJA 1I44A 3O23A 3T3VA 4E6QA 5J8IA 3VF8A 4B9DA 2BDWA 4U97A 3Q32A 2QOBA 2E9VA 4JQ8A 2XP2A 3VUKA 3HVCA 3UP7A 3WARA 4KB8A 5M4CA 3BHUA 5EYKA 2QKRA 1MRYA 2UW4A 5C2TC 5HNGA 1ZY5A 4I4FA 2ITXA 2WMAA 1NVQA 2XAMA 1Q62A 3ODYX 5HQ0A 2G9XA 4IVBA 4CZTA 5A4EA 5AAEA 4ASXA 4BGQA 4ACDA 4I5MA 2PPQA 5DT3A 2C1AA 4QYGA 1NEKC 3AGLA 3AE3D 2G2HA 4X3FA 2YM4A 5EHYA 1J1CA 2XJ0A 1Q24A 1PXIA 2JDSA 2JC6A 2UZNA 4DHZA 4XCUA 4NSTA 2BS3C 2Y4IC 5EKOA 2Z60A 3TTIA 3MIYA 2IZSA 5I9XA 5KMIA 3D94A 3QQFA 2B9HA 4IB1A 3VIDA 4H3QA 4IAKA 4QP9A 2YN8A 1FMKA 4BCFA 1Q41A 5E8UA 4EK5A 2B53A 3SA0A 1ZOYC 4EOLA 3C9WA 3AT4A 2GNGA 3UJGA 4QRCA 4EK8A 5K9IA 2WEIA 2CDZA 1O6LA 4FIIA 4IZYA 2QG5A 3G0FA 5DE2A 3WF7A 1YXTA 2FGIA 3BYVA 3NZ0A 1WBSA 4KIQA 1O6YA 4NZWB 4RQKA 3ZLWA 4AN3A 1R3CA 5CI7A 4BVUA 4CRSA 4J95A 3QTXA 2WQOA 2WU5C 2ZB1A 3TNHA 4QMSA 5JH6A 2C3IB 2VO3A 3UQFA 1KE6A 1XMMA 5J87A 3HX4A 5EW8A 4DGLC 3AQVA 1M2QA 4RWIA 4FT7A 3MFUA 2J51A 5L8KA 4GFMA 3QX2A 2BFXA 3R00A 4BDKA 1G8KA 2PE2A 5BUEA 5EHLA 3UTOA 2WS3C 4BDDA 2X4FA 5HHWA 3BLRA 1WAKA 4LQMA 4FSQA 3ALOA 5KHWA 3SQQA 4F0GA 2OG8A 2X8DA 2XNOA 5I9ZA 1DS5A 4JDKA 4RX5A 4YO4A 2WDQC 2JAVA 5ITAA 4QMLA 1H1QA 3MH2A 4IX6A 2W0JA 4LM5A 4E7WA 3QQUA 1PY5A 5EW9A 4IIRA 3OWPA 5FM3A 3FZ1A 4OTIA 3GU4A 1L3RE 4CFMA 2ETKA 4ZY5A 2WIHA 5TT7A 3NEWA 4C61A 4UX9A 2FH9A 4MYGA 2CCHA 2B9FA 3H4JA 4NW6A 4U3ZA 2JGZA 2ITNA 4EEVA 3R71A 5EQEA 3SOAA 4DG2E 5HIBA 4B7TA 4QTCA 2BR1A 2CNQA 2FO0A 3ACKA 3Q3BA 5C3JD 2WMUA 4MXXA 5CXHA 5A14A 4YU2A 3NIEA 4CZUA 1MRVA 4MXOA 5IH5A 3AKJA 3LIJA 5CAQA 4RC3A 2WP9D 3LJ0A 1H00A 4C38A 3TDVA 3D14A 3HRCA 1J3HA 4YZ9A 2EXMA 3OCTA 4N4SA 3FSKA 4HW7A 2OZOA 2PUUA 3R01A 2QLUA 3LM0A 3U6JA 1IR3A 4CLJA 3QQKA 2VTOA 2WQYD 4DHIB 2AEGA 4WG3A 5FG8A 3ZRKA 3BBTB 1REJA 4ONAA 2OICA 3NYXA 2W05A 4TT7A 4XV3A 5LQFA 4FT0A 4NUSA 3QUDA 4I20A 4HNIA 4QMMA 3WI6A 5IH6A 3UC4A 5BMMA 4QP8A 4HVHA 3GB2A 4I5CA 1JSUA 2C30A 3NYNA 3R8MA 5FTGA 2WO6A 3R9RA 3SFED 2Z02A 5DNRA 5BNJA 3VBYA 5TO8A 4EORA 3R9DA 3GOKA 4C4EA 2WOTA 3ZHPC 1OIUA 2B0QA 2HYYA 3FI2A 2QR7A 5EM7A 4D5HA 1OZ1A 3KVWA 3DY7A 3O2MA 3FPQA 4D4SA 3IW5A 1KE9A 3SFDD 2V22A 3ZSHA 4IVDA 2QQ7A 3UIBA 3TNWA 2CLQA 4D28A 2PMLX 3IK3A 4RJ3A 3D2KA 4WUNA 1SNXA 4A7CA 4OLIA 2UW6A 4F1OA 2QOQA 3HMOA 2VWZA 3L8VA 3ODZX 4FEQA 4ZTSA 4WG4A 3SKCA 3HDNA 5DWRA 3GUBA 1J7IA 3DPKA 4FKIA 1JWHA 1E1XA 2BILB 3AOXA 4GIIA 4YLKA 1PYEA 4ZEGA 3MJ2A 3M2WA 4IX3A 3KXGA 3K5UA 4GL9A 2H9VA 4KS8A 1M14A 5D7VA 4FV9A 2GSFA 4YJTA 4S2ZA 5CWZA 5BYYA 3ZC6A 3PPZA 5EW3A 5H8EA 4B99A 3KXHA 4ZJVA 1K2PA 1QL6A 3Q2JA 4UALA 4XG6A 3QTQA 2W1EA 5BVKA 3PDTA 4XEYA 3BELA 3VRAD 1OITA 4BIBA 2FSOX 5DVRA 1IEPA 3G5DA 3HV4A 4K77A 5DI1A 5DG5A 4QMXA 4DBNA 2H8HA 4OTWA 3V8WA 3F5XA 3Q6UA 4TYGA 5DFPA 3TCPA 1TQPA 2KULA 5IF1A 3PSDA 4O22A 4PTGA 2PZIA 5IA5A 1U4DA 4NTSA 2BROA 5L6PA 5C2TD 2NRYA 3AEED 5F4NA 2BDJA 2CNUA 4IAFA 4AT4A 1TKIA 3CY3A 3OTUA 4OBQA 2CKOA 5L2SA 3MYGA 5M4IA 2VWBA 4PNIA 4FL3A 3SXRA 3U87A 3HV5A 3I81A 2RG6A 2UZTA 4IW0A 5BYLA 3UO4A 5DIAA 5C1QB 5IISA 2GCDA 2WQNA 4IDVA 3VS7A 4U80A 4YZCA 3AEDD 4L44A 4EC8A 2RG5A 1Q5KA 1GZOA 3KCFA 3PA4A 4YZNA 2BHEA 2Y6OA 3BEGA 3DBQA 4KKGA 2XNEA 3WIKA 2C47A 2WGJA 3KCKA 2VX0A 3VR8D 1OBDA 3BLAA 3FWQA 3P5JC 4L68A 5CLPA 4FGBA 4YUQA 3E64A 5CQUA 3FLNC 1ZOYD 3GOPA 2OXXA 3QCYA 3TACA 3V5JA 3QD3A 4BHZA 4CFNA 2XA4A 3QRIA 4IANA 5HX6A 1RJBA 3O51A 2YACA 3KKVA 4O27B 4XG3A 3ALNA 2UZLA 1NENC 2B7AA 2C6DA 5J9LA 3VBXA 4ASEA 3GBZA 4IZ7A 5FEDA 3UIMA 2ITVA 3E92A 4RSSA 4FZAB 4O7NA 5IH4A 5EQYA 5AV4A 4XUFA 3OXIA 4F65A 1H0WA 3DT1A 4AX8A 3V5LA 4CFUA 2GQRA 4YHTA 3EL8A 5AIRA 1OVEA 2O64A 2VZ6A 3M42A 4YJVA 2J50A 4BYIA 4QTAA 5D41A 3C4CA 3AD6A 1LEWA 2GHGA 4C33A 2JEDA 4YJNA 2HOGA 4CMOA 2CCIA 5CZIA 4ZS4A 2XS0A 3R7YA 3BL7A 1YOMA 3P78A 2WDQD 2ZJWA 4IB0A 4R3CA 4BI1A 4M68A 3MFRA 1JVPP 5CEMA 3CS9A 4RJ7A 3OOMA 4S32A 3RM7A 2VWWA 4J7BA 3U4WA 3SW7A 4APPA 3VS5A 3FMMA 1VYWA 5CAUA 5H8BA 1R39A 4I24A 1YHSA 2OI4X 4PMSA 2OSCA 5HLPA 3R63A 3R04A 4YJPA 4FKOA 3BCEA 4BF2A 3QYZA 3AKKA 1UA2A 2Q0BA 5E92A 2QHMA 4FEXA 4CFXA 4MBLA 3VS1A 3VW8A 4PTEA 3QC9A 4MXYA 5TOZA 4A9YA 3KMMA 4TWPA 3C4EA 4C59A 4N70A 5E9EA 5ACKA 4DG3E 1KV2A 4H58A 3KXXA 5AUTA 5C26A 2IVUA 3LMHA 3LZBA 4U42A 4XMOA 5IQIA 4BCQA 2CKPA 1OL2A 4IB5A 2OJJA 3Q6WA 4I0TA 2XBJA 5JFXA 4RWJA 4IQ6A 3GC7A 5L3AA 5HU9A 4PF4A 2YWVA 3VHEA 3LQ5A 4S33A 4FKJA 4UXLA 4Z7HA 5HBJA 5EM8A 2EVAA 3ZLSA 2GFCA 1XR1A 5AV3A 4FTQA 5F20A 1YQ3C 1APME 4PP9A
chains in the Genus database with same CATH topology
3NYVA 1OPKA 2IVTA 4IFCA 4R5SA 5HESA 3LE6A 4BTJA 3ULZA 3WE8A 5AUXA 3D2IA 4BRXA 3R7OA 2HW7A 4RIXB 5AFVA 4ID7A 5B0XA 4P5QA 5LWMA 4W8EA 3ZYAA 3MA3A 4IX5A 3HP5A 3QC4A 4JBQA 3TEIA 1SYKA 4FEWA 3ATSA 3G51A 4BYJA 4L45A 1XH9A 3D5WA 4LV5A 3ZEWA 5CY3A 4IWDA 2UVZA 3ZUTA 4V0GB 5CT7A 4MD9E 4B6LA 3NW7A 3Q60A 2J0IA 4AWIA 5A54A 3D7TB 4YHFA 4D4YA 2F2UA 2G2IA 1R0EA 2IN6A 1URCA 3DNEA 4RJ4A 4LL5A 3V6SA 5BV3A 2ITUA 4NK9A 5BPYA 1UWHA 4ANMA 4DC2A 5KO1A 3RAIA 4BDIA 4A9RA 2PSQA 3V01A 5FP6A 4EH5A 5DRBA 3R28A 4HZSA 3KULB 4QNYA 4IBMA 3MW1A 3NPCA 4XX9A 4JQEA 2Q83A 5HTCA 3DB6A 2VWIA 3QALE 4FIGA 4H36A 4RZVA 3MFTA 3AT3A 1SZMA 3OBGA 2C6TA 4F7SA 3RWPA 3VO3A 3CQWA 3PRFA 3ZZEA 4FBXA 4IH8A 4L67A 4LRJA 4K1BA 3EQRA 4GYGA 5IEYA 2EUFB 3FI3A 3NWWA 2QONA 1GNGA 4S31A 3FQSA 5E8ZA 2VWVA 4O7ZA 3F82A 5JRQA 2HAKA 4KS7A 3F3ZA 3BU6A 4G5JA 3JXWA 4BDJA 3PJ8A 3TDWA 3TUCA 3KRJA 2YHVA 2W5HA 3U9NA 1ZYJA 2W7XA 2X8EA 4XOZA 4EWHA 4FL1A 2X2LA 4IEBA 5C27A 3OXZA 4XBRA 4C34A 1R0PA 4EUTA 2CKEA 4ZTRA 1VJYA 3W1FA 2VU3A 4PNKA 3PXKA 4FYNA 3SAYA 3BYMA 2UZEA 3DFAA 5IDPA 4WBBB 1U59A 3JR1A 5T6KA 4CV8A 3P9JA 2JFLA 3GCSA 4GH2A 4W4XA 2BHHA 4ZAUA 3FZPA 4O6EA 4E8AA 4X2KA 3ORPA 3P5KA 2AC5A 5KKRC 4IADA 3DDPA 4ZIMA 2WU6A 4QDEA 4A4OA 4O96A 5GNKA 2R3OA 2I7QA 3EN9A 1M52A 4RC2A 1WBWA 4BIDA 2H34A 5CSWA 1XBBA 3W8LA 3F5PA 3NNXA 4JLCA 3FE3A 3NFFB 1XHAA 2J4ZA 2XIXA 3W2SA 4CT1A 5BX0A 1JQHA 3R9OA 3BGZA 4XG7A 3FQHA 3G15A 3EIDA 5IA2A 2ERKA 4B8MA 3N4VA 4QYYA 4PDSA 3R9HA 2WMBA 5IA4A 4GU9A 4UEUA 4O2PA 3HKOA 3DBFA 4AZEA 3S95A 3B2WA 3C1XA 4H1MA 2UZOA 5KUPA 5M57A 4I22A 3Q9YA 3TUBA 2WTIA 4YJUA 3T3UA 3ZXTA 3CSVA 3QQJA 3D9VA 4FV3A 1ZXEA 2W1HA 3GU6A 3HNGA 3ORIA 5CU6A 4C58A 3EZRA 5ETFA 3FYJX 2CLXA 4F99A 4HVIA 3NCZA 1YHWA 4HYIA 4ZSAA 4DA5A 2VWXA 3QAME 3KXNA 4AAAA 4JRVA 3OT3A 4AE9A 1NA7A 1XKKA 5KKRB 4C4FA 2PMOX 4IX4A 5EHOA 2UVXA 3ID6C 3VN9A 5EFQA 4ENYA 2Z8CA 2GTNA 1O9UA 2FSTX 5HD4A 1DAWA 1U54A 2CN5A 4JAIA 3EKNA 4QYEA 5B2KA 5DN3A 4X2FA 4O7TA 2BRHA 2WPAA 2XK9A 3FXXA 4OR5A 3VONA 5HKMA 5TR6A 4BI2A 4ZY6A 5LCKA 3R73A 4IFGA 4ZTLA 4FZFB 5K3YA 2HY0A 2GNFA 2JBOA 2XYNA 3AD4A 4BDEA 3BV2A 3F5UA 3EQGA 4ZP5A 3B8QA 5C8MA 5ICPA 3A60A 3VULA 4ACGA 5AUYA 3P7CA 3FHIA 3FSFA 4LMNA 5AJQA 3V6RA 2A1AB 1OUKA 3SXSA 3HV3A 3KFAA 5D7AA 4YMJA 3F9NA 1YDTE 1OIQA 3LXNA 3SC1A 3D15A 5LOHA 3HV7A 2ZB0A 2DUVA 3A7IA 4DH7A 5AX9A 3W2QA 1KOAA 1HOWA 5AAFA 2XNBA 3KRRA 4DN5A 2CGWA 3FHRA 4R7BA 3ZLXA 3KN5A 2J9MA 2Z7RA 4BIEA 4AN9A 3P0MA 2QOFA 5AM7A 3TG1A 4LGGA 3MY5A 4U5JA 1YOLA 2EU9A 5JGAA 4UYAA 5DPVA 2XBAA 4WOVA 3MH0A 3RTPA 2ZM3A 1XH4A 1JNKA 2BIKB 4PMMA 3QZFA 3DLZA 1JKTA 1IA8A 3OD6X 3POZA 3F69A 1H4LA 4GT3A 5T68A 1A06A 3EQIA 5CSHA 4DEHA 5KCVA 4E6AA 3ROCA 4JR3A 3DTCA 4BCPA 4JX7A 4O6LA 5I5ZA 4GK2A 2XRWA 3NMUF 2YAKA 3KREA 1ST0A 4YTFA 1WVWA 4DHFA 5FUTA 3KULA 3MFSA 4O81A 3II5A 4I6FA 4Z16A 5AADA 3BPRA 3CKXA 3IDPA 4UZDA 2PVHA 1H1SA 2W1GA 1Y8YA 4WKQA 1Z9XA 3W0RA 4QQCA 3Q4UA 2QO2A 5ETAA 2C69A 3LFBA 3HMMA 3PE1A 4WA9A 4XV2A 3FMLA 3LFNA 5HGIA 1YXSA 4KBKA 2V5QA 1YXXA 1XO2B 3UG1A 4M8TA 4FTTA 4RC4A 2UW8A 3GQLA 3HRBA 2VGPA 3LW0A 4FKVA 3PA3A 3DKCA 4LV7A 3WIGA 4BB4A 4BJJB 3VW6A 2XNGA 4KNBA 4KRCA 3ZC5A 5E91A 4JDHA 2F4JA 4O7SA 3DS6A 4U44A 3TZ8A 4GSBA 1XBAA 3M1SA 3SX9A 3QHWA 4F1TA 2W17A 3FAAA 4M84A 4NCTC 1GIJA 4XBUA 5FTOA 2JIVA 4RVLA 1MP8A 2C6IA 3LXKA 2C5NA 3H0YA 4ITJA 4CVAA 2ITQA 1G8JA 2OKRA 5KE0A 4NKAA 4XRLA 3KRWA 4PL3A 5D12A 4PP7A 2A19B 2HXQA 4BDGA 4PQNA 3KEXA 3IOKA 3IGGA 3PJ1A 5CAPA 3ZONA 4IVAA 5E1SA 4DEIA 3VHKA 4X7QA 4Y85A 3U6HA 3FLSA 4ZLOA 3DGKA 5EG3A 3LQ8A 3EHAA 2ZV2A 1SVEA 2B1PA 3MPTA 4GT4A 4HOKA 4JNWA 3PTGA 5H8GA 4EZ5A 2CGVA 1W98A 4EH4A 5DYJA 5BVDA 3TIZA 4GVAA 4YR8A 4BTFA 3ZZWA 4F64A 4L3PA 4USDA 1IASA 4RIYA 2Y6MA 3GU5A 2P33A 3I60A 5HVJA 3ZRLA 4DFYA 4KIOA 4R3PA 3UODA 5AUWA 4CSVA 3HP2A 4D1ZA 4NIFB 4M13A 3DAKA 5EI6A 3UPXA 3PP0A 3EN7A 4Q5HA 5CEOA 2BMCA 3BIZA 5BVEA 3FLWA 4GIHA 4OTFA 5CU2A 4ALUA 3JYAA 4AGCA 4CGAA 4E93A 5DEWA 3CR0A 4A9TA 2C3KA 3OXTA 3ORNA 4DDIA 4IWPA 1TFFA 2X9EA 3HMIA 4LUEA 4WRGA 3W32A 3NUPA 4FTCA 1JOWB 4HCUA 5IA3A 3COHA 3WF8A 4JT3A 3I7BA 4RIOA 5G1XA 3NS9A 4EC9A 3R8ZA 4HVHA 1VEBA 4G9RA 4NFMA 5HCYA 5CF8A 2CHLA 3RP9A 4FKUA 4DH5A 3CCNA 2UW0A 4FMQA 3MI9A 3QYWA 1DM2A 3KL8A 4I6QA 4OTQA 4ALWA 4PTCA 3NSZA 4AUAA 1FGIA 4JDJA 2XKDA 3W55A 3HLLA 4MQ2A 4XRJA 1Q3WA 1PW2A 2PMIA 5C03A 4BZOA 2OH0E 2PHKA 3U6IA 3R1YA 3FY0A 4FR4A 3FL4A 3FY2A 3OWLA 3LFDA 2ZV8A 2BZKB 4YO6A 5AUZA 4OUCA 2XEYA 4EH9A 5FXQA 4EOMA 5CEIA 4AQKA 4KIPA 4MD8E 3JUHA 4E4MA 4EK4A 3PXZA 2XANA 4ITHA 4J8NA 4RZWA 4OT5A 4FTUA 3R8LA 2ONLC 3PLAE 3UZPA 4NM7A 4BGGA 5LCJA 3FKOA 4D9TA 1OL1A 3H9FA 5C8NA 3MDYA 4FEVA 4MCVA 3TKHA 3W0MA 4ZTMA 1CMKE 2R7IA 4KSQA 4LOQA 2C6OA 3CE3A 4ZSGA 3VWAA 2J5EA 4ORKA 1H1RA 3FDNA 5CEQA 3ZEPA 5ANJA 5IUGA 3LFCA 4I6BA 4ACHA 4N6ZA 1MQBA 2P4IA 4MX9A 1ERKA 1FQ1B 3VS3A 4BTMA 2PVFA 2VN9A 5CU3A 1EH4A 2WB8A 4PMPA 5KBRA 1K9AA 2VTAA 4FV2A 4YJQA 3LJ1A 3F7ZA 1UU9A 4QMPA 4TY1A 3N4UA 3RHKA 1GZNA 3O50A 4EOSA 3G9LX 1G8SA 4K18A 4UY9A 3CTQA 4XS2A 3V5QA 5LJJA 4XV9A 3BU5A 5LVMA 5DGZA 2PVRA 4E26A 3L9LA 4G2FA 1UNHA 4TYIA 4DFBA 5ANDA 3HGKA 3K5VA 1Q99A 3AC4A 1H07A 2VUWA 2YFXA 4M69B 5FDPA 5FP5A 1SVHA 3E8NA 4BBMA 4FSUA 3OCBA 2ZV7A 3CQEA 5CVFA 1OUYA 3H0ZA 2YZAA 3L8SA 2R0IA 4FTKA 5M51A 4I23A 4CLIA 3W2CA 3TJDA 4GS6A 3HV6A 3O17A 4QYHA 4C2VA 1GZKA 3C13A 5KMNA 3CXWA 2BKZA 4FUXA 3C0IA 2J0JA 3E7OA 5F94A 2VX1A 2XF0A 4BTKA 4E5BA 5EYDA 3D0EA 3OG7A 3ZO2A 2ZDUA 4YC6A 3QTZA 1L8TA 1YDRE 4OTGA 4QQTA 4G6LA 2WMSA 4TPTA 3O7LD 5B2LA 3HUCA 4JG6A 1WFCA 3EQFA 3MESA 5HO7A 2R3KA 3LMIA 2DYLA 5IQAA 4PL4A 4PX6A 1UU3A 4Y95A 3LJ2A 4GKIA 2J2IB 4TYHA 3LFSA 1MQ4A 1AGWA 1FGKA 2B4SB 2QC6A 2W4KA 3EQPA 3QX4A 4XG9A 5EOLA 5A4CA 5IZFA 3DKFA 5FEQA 3DNDA 4FTLA 5M56A 3FLYA 3ET7A 2Y4IB 4NTTA 3PP1A 4X2GA 3PG3A 1IAJA 4BCHA 5A9UA 2FB8A 3A2CA 4BZDA 3ROYA 2W4JA 4BJJA 1NVSA 5FQDC 3OY1A 2YZLA 4ZXTA 4FIFA 2RFEA 4L9IA 3ORXA 3L9PA 3TNIA 4BC6A 4EBVA 5I9YA 5EKNA 3AC3A 2ZDTA 5I0BA 3COKA 3RAKA 4JBOA 4KWPA 4G34A 3RCJA 3WZJA 4CMTA 5HNBA 4WNMA 5IA1A 5DEYA 1Q8UA 1H25A 3AMBA 3R1QA 4FT9A 2CGXA 4QEBA 3VF9A 1BUHA 1IRKA 1VR2A 4Z3VA 4GT5A 4A07A 5HCZA 3C0HA 3O8PA 3MVJA 2YJRA 4YPSA 4II5A 4FC0A 4UBAA 3L8XA 3S0OA 5J7HA 4LGHA 4TTHB 1DAYA 2X2KA 5BQ0A 4ZSEA 3BYSA 2WIPA 4G31A 5HG5A 4JDIA 1JSTA 2Y7JA 5CF6A 4TWNA 3P4KA 3KMUA 2YEXA 3FMNA 4FTAA 4NCTA 4RA4A 2GS6A 2B52A 3EFLA 5HBHA 4FV7A 3U8WA 4RFYA 2O5KA 1K3AA 1PXJA 2OZAB 4B4LA 5IPJA 5T3QA 2ZFYA 3SOCA 3FEGA 1GY3A 3Q04A 5C8KA 3VC4A 4QT1A 3IG7A 3E8CA 3MVHA 4G16A 2VRXA 2WHBA 3QXPA 4R7IA 5A4TA 2UVYA 3PLSA 5IU2A 3BHHA 2BIYA 4EH2A 2J7TA 3RK5A 3LLTA 5AP2A 5CU0A 4CG9A 2EXCX 3BHTA 2PE1A 4L52A 4BBFA 4I0RA 4O0TA 4OBOA 4YLLA 3DAEA 4L7FA 4ZZMA 4G3EA 2HZNA 5CANA 3JVSA 5AP4A 2NO3A 2P2HA 3MS9A 5E8TA 1R1WA 3LLAA 5HI2A 5GJDA 1PMVA 3SXFA 2NP8A 4FSYA 4GK3A 4JBVA 5FRIA 4JI9A 4QTEA 1KE7A 2BRBA 3LFFA 1F5QA 3C4FA 1ZZLA 5A4QA 3CY2A 4C3FA 4MVFA 3TN8A 2YM7A 2QD9A 3K2LA 4U0IA 3F2AA 3UBDA 3W0OA 1FVTA 4KKHA 1PXLA 3FKLA 4F0IA 4CCBA 4M0YA 3HECA 1OPLA 4FVPA 2ITZA 3RNYA 4EOOA 4LRMA 3I0OA 3LAUA 2ZM1A 4K6ZA 3P86A 2C5VA 1V0PA 3SGCA 3O8TA 4AXFA 2HELA 4FKWA 4YBKA 2BAQA 4BHNA 4D1XA 5JFVA 2VD5A 2YAAA 3ORKA 4AZSA 5DRDA 2PE0A 3VUDA 4ASZA 5J5SA 5EM6A 5JMSA 4LI5A 3EQDA 4C37A 1B38A 4WSYA 3VRYA 3UQGA 4FVRA 1V1KA 4H1JA 1BMKA 2ONLA 2RF9A 2QO9A 2XNPA 1QPDA 4XG2A 4JBPA 2C6MA 3EOCA 1ZARA 3KC3A 4QMUA 4FSTA 4P7EA 2WTWA 4LV8A 2IZTA 5H3QA 4IAIA 4YP8A 4MNFA 4V01A 4M67A 1QCFA 1H1PA 4JIKA 4GW8A 1UKHA 3HDMA 3GC0A 3UO5A 5FGKA 4QMTA 3ZMMA 4DTBA 1CKPA 3I0QA 2QODA 4RJ6A 2R3IA 3ZFYA 3DB8A 4I5PA 5AP5A 2YM5A 3QCXA 1LPUA 2XNNA 3F3TA 4BCMA 4K33A 3I4BA 3ZOSA 4IACA 3EYHA 4CQEA 1P2AA 3G6GA 3KF7A 4O0YA 5IEXA 2IWIA 3NUAA 2XZSA 3FBVA 3COMA 3WF5A 1ST4A 4O21A 5CXZA 5EDRA 2QOKA 3E88A 3V5PA 2W99B 4F9CA 5KMMA 3NGAA 4BBEA 5HVYA 3TNQB 2GNHA 4E73A 4F63A 4W8DA 1XH7A 1LP4A 1Z5MA 3FLZA 3DA6A 4QDVA 3U51A 4AGWA 3P08A 2B54A 1ZMUA 1Y6BA 4IAAA 3LCOA 3LQ3A 5IUIA 3BU3A 3U4UA 5JZJA 4FTOA 5M06A 4Y83A 2XM8A 5FXSA 3AC2A 4ZZNA 3BYUA 3DOGA 4LFIA 4HGLA 4NU1A 3DK3A 4RGJA 2ESMA 3EWHA 3UZTA 4U8ZA 1JBPE 3NIZA 3EFKA 2VTTA 4JOAA 4DBXA 5AV2A 1XH5A 4Q5EA 3OW3A 3JY9A 2YCQA 4FV6A 2O3PA 5I9WA 3FV8A 3FL5A 4QMVA 4D4RA 1AD5A 1OIYA 3G9NA 3NRMA 4L46A 4UB7A 1E1VA 1RE8A 3IDCA 5IA0A 2ZMDA 3T9TA 3B2TA 3TZMA 1HCLA 2IZUA 1U54B 1UU7A 4RFMA 1ZLTA 4M3QA 5IQDA 5M08A 4WNKA 2PZRA 1TQIA 3PY0A 4DH8A 4FZDB 4RWLA 4AZWA 2QURA 4IMYA 3QTRA 2XJ1A 3H9RA 2I0YA 2P55A 3IS5A 3RCDA 3UVPA 4D2SA 3T8OA 3NW6A 3C4XA 1OL6A 4DTKA 1CDKA 2OGVA 5K4JA 5AP7A 4F7NA 2FA2A 4O7WA 4D1SA 3OUNB 5L6OA 4AA4A 4RIWA 4F70A 2WMWA 2CJMA 4XYFA 4FIHA 4GFOA 4IJPA 2WXVA 4U41A 3E8EA 3VRZA 4UWBA 4BDHA 3V5WA 3DV3A 3E7VA 2OZAA 2QKWB 4AQCA 4EHZA 4MK0A 3QRUA 3BE2A 2W9ZB 5ETCA 3R30A 5ACBC 4DEGA 4HVSA 5CEPA 3R22A 5D10A 2P0CA 4FTRA 4M7IA 4QMWA 1J1BA 3KN6A 4I1ZA 5DOSA 4J8MA 2QR8A 1LEZA 4DGNA 4PDYA 4C3RA 4BGHA 3OUKA 3OT8A 4TL0A 4FTIA 5HNIX 3QRJA 4O0VA 3Q5IA 4G5PA 4FI1A 2JKKA 1M2PA 4MAOA 2NYAA 3WZKA 2IO6A 3KQ7A 5JRSA 3W2RA 4LG4A 5DT4A 3D83A 3LMGA 3FQEA 4MNEA 2YIWA 3WILA 3A8XA 4OGRA 4ZS0A 5GJGA 3I5ZA 2PL0A 4DT8A 5KMOA 3QLFA 4D0XA 4FA2A 3UOJA 2I6LA 2PTKA 3OCGA 4BKJA 3HYHA 1VZOA 5AP3A 4A9UA 3FPMA 3C4WA 3MIAA 2F9GA 4FTJA 4OT6A 3R9NA 1QPCA 3BGQA 2OLCA 2Q0NA 5EH0A 4CXAA 3NUSA 4WNPA 1TVOA 4RT7A 5JFSA 4DH1A 4EJNA 4TW9A 1SVGA 4HVDA 5HIEA 3A99A 3FMHA 4G3DA 2G1TA 2I0EA 4TYJA 4AFJA 4FKLA 2OJ9A 2GPHA 5E4HA 3VVHA 2BRMA 3NUYA 4RX8A 4RVKA 4CFVA 4BDCA 4DCEA 4DFLA 4FTNA 4O86A 4YC8A 2BDFA 1UNGA 2ITWA 1YKRA 3SG9A 3AC8A 5A6OA 4X2JA 4AOIA 3O5AA 2CN8A 2W1CA 3S1HA 1ZYSA 2X7GA 3N51A 5JT2A 3ITZA 4FZ6A 4LRKA 1Z57A 4EYJA 3F3WA 1PJKA 1A48A 1BLXA 4Y73A 4TZRA 4AW0A 5C01A 4OBPA 3SVVA 2ZVAA 2IJMA 3C50A 4UN0C 3QUPA 4J96A 3EKKA 4F6SA 2YA9A 4YTHA 4NKSA 3TUDA 3ENMA 4K11A 1KWPA 4MKCA 4XJ0A 4KUJA 3O71A 3LOKA 4U3YA 4MF1A 3PPKA 3VBVA 3QD2B 3VAPA 3R6XA 2OIBA 2R3LA 2DQ7X 2E9UA 3PVUA 5FEEA 4C62A 2WMQA 4RIYB 3EJ1A 3VS0A 4BCJA 4EQUA 2XARA 3COIA 2XH5A 3DK6A 1ZOHA 2UV2A 5LWNA 2HXLA 5KMKA 2OIQA 4JIAA 3BQCA 2XYUA 4A4XA 3Q2MA 4EUUA 1ATPE 3CEKA 3DCVA 5H2UA 4EH8A 4CT2A 3FZSA 2UW7A 4WUAA 2UW5A 5HORA 2YDJA 3GEQA 3VBTA 2BPMA 2UZUE 3OP5A 1JKKA 4C3PA 3VBWA 4I5HA 4P90A 4IM2A 3TTJA 3PVBA 3ULIA 4C4JA 1V0OA 2XK8A 3H9OA 3UYSA 2HIWA 4EJ7A 2B9JA 1LR4A 3MVMA 4MUQA 3NUNA 3IW6A 3UE4A 1OM1A 4E4LA 5J1VA 2GQGA 4FOCA 4GKHA 2R64A 4R3RA 5ANGA 5DR2A 4FIJA 4C0TA 3EN5A 3P7BA 4M12A 2VTHA 3PUFC 2X4ZA 4AT5A 4FJVA 3TIYA 2IVSA 3BEAA 3QZIA 4RWKA 2ITYA 2JBPA 3W33A 2VV9A 3C5IA 4KAOA 3VJNA 4F4PA 5LMBA 5EYCA 3G0EA 3L9MA 2Z7LA 2XCKA 3E87A 2R3NA 4DDGA 2R3HA 3KXZA 3BKBA 3Q9XA 4S34A 5KX8A 3AKLA 4EOJA 1WMKA 2A0CX 2Y0AA 3IONA 5CTPA 4ZY4A 3A4OX 2E9OA 3G33A 4XP3A 4XHKB 2VTNA 3DQWA 2YDIA 5CAVA 3K54A 3QTSA 4GK4A 1ZYLA 3V51A 4MXCA 4X6RA 2R3JA 4L00A 1TQMA 4BCOA 3AC1A 3H3CA 3OWKA 3PXFA 3E5AA 3F88A 3FKNA 3K3JA 4JG7A 3Q96A 2W9FB 5EI2A 3W0PA 4AF3A 4FV4A 4RLLA 3V8TA 4A4LA 3QA0A 2YM6A 3MB7A 4ERKA 2XVDA 1ZOEA 1H1WA 2C0IA 5CSPA 3KXMA 1J7UA 2BAJA 4EHEA 3MGYA 3TMOA 4MWHA 3QQLA 3RAHA 3WZDA 4ZMFA 1OGUA 2YISA 1FINA 3AG9A 4FG8A 4H05A 4AZTA 3ORMA 1PXPA 3MJ1A 2UZVA 3EFJA 2EB3A 2LAVA 2PZ5A 2XMYA 3CD8A 2WMXA 4FOBA 4FV1A 4L6QA 3S3IA 2IPXA 3SW4A 2CSNA 3DJ7A 3LCKA 3DJ6A 4G6NA 1SNUA 1PYXA 2W1ZA 3MTLA 3OF0A 1Q4LA 3OEFX 4KSPA 4NT4A 4ZOGA 4HGTA 1KOBA 5JKGA 5AM6A 4F6UA 4GMYA 3HA6A 3UZRA 4EOKA 5AA9A 2A4LA 2OF2A 4Z55A 3MA6A 4QP7A 4XNEA 5B7VA 5JQ5A 4RVTA 3CP9A 1KSWA 2GQSA 2W1FA 3MH1A 4Y8DA 5CS6A 4DINA 4ENXA 1JKSA 4G3CA 2RIOA 4QQ5A 4EI4A 4D58A 3V04A 5BUIA 3VNTA 5IMXA 4XG4A 4IAZA 1GJOA 4FX3A 3BX5A 1XMLA 3BRBA 4KBCA 4YJSA 3TKUA 2OK1A 2GU8A 4A9SA 1UVRA 3FMEA 5F9EA 1M17A 5LVPA 1H01A 2F7XE 4GEOA 4LMUA 4RFZA 4E20A 5FD2A 4FSRA 5E8SA 1F3MC 2WD1A 3OROA 3QD0A 4F9YA 3ZDUA 1BL7A 2C6EA 4NWMA 3I6UA 4NFNA 3PVWA 4EH7A 3IW7A 4HCTA 1W84A 3A7JA 4TYHB 4Z7GA 1ND4A 2YJSA 2C0OA 1CSNA 3DBCA 1YWRA 3FMDA 3CC6A 1PF8A 1PKDA 1OL5A 2VX3A 3RVGA 1U5QA 3JVRA 2FSLX 1QPEA 4N6YA 3TZ7A 3AMAA 2BVAA 5HX8A 5HZNA 2UZWE 4AZVA 4E5AX 4H39A 4IZAA 3F66A 4EK3A 4L43A 4PV0A 4BCNA 3E93A 1KE8A 2F2CB 5IQCA 4O91A 2VTJA 1JLUE 3NVKI 4BCKA 3CJFA 2RFDA 1ZMWA 2JDOA 2XK3A 3R8UA 5C4KA 1ZYDA 2JKQA 3QLGA 3RWQA 3GVUA 2VTMA 5CQWA 1ZOGA 2PY3A 3F3UA 1QPJA 1YXUA 3QD4A 4ZSLA 3ZO3A 5KNJA 3A7GA 5E8XA 3WYYA 4CTCA 2CPKE 3O7LB 4JRNA 4J98A 3EN6A 2JITA 2R3RA 1YWNA 2ZMCA 3D5XA 4HPUE 4XOYA 5JQ8A 5ANEA 2PMNX 2XIYA 3EQHA 1YOJA 3TJCA 1M7NA 3KU2A 4FODA 4YJOA 4DEEA 4P2KA 1R78A 2CNVA 3IO7A 2OXYA 4EYMA 2V62A 3MTFA 5M4UA 3HL7A 4TNDA 3TV4A 2VTSA 3OW4A 4TN6A 1UWJA 4HJOA 1OBGA 3OS3A 4M14A 3CQUA 3DTWA 3L9NA 5GHVA 3GCPA 3N9XA 1SMHA 5KBQA 4IAYA 4DH3A 3S00A 2C3JA 1STCE 5EDQA 3Q9ZA 2C3LA 4IM0A 3R7VA 4DG0E 2V7OA 3D4QA 5CSXA 3I7CA 3QKMA 4YZDA 1OL7A 4DYMA 5M44A 3DZQA 3ANQA 2YERA 2XAOA 3SRVB 2WQBA 3WOWA 4AXEA 1WCCA 4HGSA 5BVFA 5L2WA 4MBJA 4ZTHA 2IZRA 3IECA 4FK3A 4V05A 4YLJA 5DBXA 4QYFA 2R4BA 5KZIA 4ANQA 3HRFA 2P3GX 3OC1A 1OECA 4ANLA 2VNWA 3GFWA 3ZS5A 3BZ3A 4F7LA 3QWJA 3EL7A 3Q52A 1Y6AA 3CGFA 3IOPA 4IJ9A 2PU8A 2QU5A 1GAGA 4K8AA 3KRLA 3FZRA 3QXOA 3MY0A 1WBN