3AEDC

Crystal structure of porcine heart mitochondrial complex ii bound with 2-iodo-n-phenyl-benzamide
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
138
structure length
138
Chain Sequence
b'TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with 2-Iodo-N-phenyl-benzamide
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 48
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3aedC01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3aedC02
3AEDD 1NEKC 4YSYD 2H89D 2WS3D 3AEAD 3AEDC 2WQYD 4YTPD 4YSYC 2H89C 4YXDD 3AEAC 2WS3C 2WDVD 2WP9D 2WQYC 1PV3A 4YTPC 4YXDC 2WDVC 2WP9C 3ABVD 1YQ4D 1YQ3D 3CIRD 4KX6D 3ABVC 3P4QD 1YQ3C 3CIRC 3P4PD 4KX6C 1K04A 3SFEC 3AE9D 3SFDD 3P4PC 3AE9C 3SFDC 4YSXD 2WU5D 3AEGC 4YSXC 2WU5C 1KF6C 1OW8A 1E7PC 1K05A 3AEEC 2WDRD 2WDRC 2WDQD 3AE8D 4YT0D 3VRAD 2WDQC 3AE8C 4YT0C 3S9OA 3VRAC 3SFED 3AE6C 3AE7D 1OW7A 3AE7C 2WU2D 3AEGD 3B71A 1KF6D 2WU2C 3AE2D 1ZOYD 1NEND 2B76D 1QLBC 3AE2C 1ZOYC 3VR9D 3AEED 1NENC 2B76C 3AEFD 3VR9C 3AECD 1ZP0D 1KFYD 3AEFC 3AECC 1ZP0C 3AE4D 1KFYC 3AE4C 2BS4C 3P4RD 2G3AA 3AE6D 3P4RC 1L0VD 1L0VC 2H88D 1OW6A 3AE5D 2H88C 3AE1D 3AE5C 4YTND 3AE1C 4YTNC 5C3JD 1KTMA 5C3JC 3AE3D 1YQ4C 5C2TD 2BS2C 3AE3C 3P4QC 3VRBD 4YSZD 5C2TC 3AEBD 4YTMD 3VRBC 4YSZC 2FBWD 3AEBC 4YTMC 2BS3C 2ACZD 3VR8D 2FBWC 3P4SD 2ACZC 3VR8C 3P4SC 1NEKD
chains in the Genus database with same CATH superfamily
1JTHB 4RKUJ 4YXDD 1WMKA 2WQYC 3RL0g 1YQ4D 3CCLP 1SFCD 3KZIE 1R5SA 1GL2D 3L74G 2XU6A 1X22A 3G9RA 2WU5D 3TK1A 3CXHH 4QMAA 3HUSA 1OVVA 1SQBK 2OARA 3AEEC 1IFMA 2XDJA 3NMDA 1X79B 1SQPE 2KUBA 1OW7A 3H1HE 3HE5A 2WU2C 1NVOA 3GLMA 3USSA 2YXQB 2O1KA 2ZT9D 3VR9D 1H0TA 3AECD 5AW8B 2Z5IA 4A7PA 1JCDA 1HTLC 5APVA 4EYYQ 3P4RD 3L72J 5H2FE 1LTIC 5KKZB 3V2RA 3F5HA 1G1IA 1L0VC 2KS1B 1JOCA 2Y0EA 2O01N 5CBOA 2OTLP 4OVNF 5CJ0A 2Q1KA 3CXHI 1NHLA 2C9LY 1SQBD 4PV1C 3RK3E 2AEFA 1VF5C 3LW5J 1JNMA 3AE3D 3GMAA 1ZN5A 3CWBD 3P8CE 2FYUD 3L71J 1GK4A 3TNUA 3O6QA 2E5YA 3TF5A 1MV8A 4U3FE 4N78E 3CCEP 1NTKD 1MZ9A 4PD4H 3AEAD 1E79H 1NTMJ 1G2CB 1GK6A 1KILE 5E79H 1BCCD 3N4XA 2Y0CA 2FYNC 3AE9D 3SFDC 2BASA 2QM8A 3A0BE 3M06A 4GOFA 3L73E 1N8RQ 2A45G 2G8YA 3RL0D 4PV1B 4GODA 1S4XA 2PRRA 3T97A 1EDKA 2WTYA 3Q5RA 2WDQC 5KLVJ 2L5GB 2A06D 1A02F 3H1KG 1P84D 2W27A 1NEND 1PGQA 4IOIH 1VDFA 4RESB 1YITP 1YJWP 1GU5A 4DDIA 2ZXEB 1PPJD 3AEFC 3GF3A 4W7ZA 2KXPB 2LXBA 4PD4I 3TGUJ 2YNYA 3H1ID 5KAIH 1VQKP 1CI6B 5AVSB 1W2EA 1IC2A 5GTHE 1HUCA 4C7NA 4LLHA 3G4SP 3BCCG 5B5EE 1TU3F 2JWAA 4GKGA 3A0HE 4R4LA 3L70D 1RF1C 1DX7A 1VQ6P 1WT6A 3VRBC 4IFFA 3CCMP 4YTMC 2D2CC 3L74J 1SQVK 1L0NG 3IN6A 3U59A 1UIIA 2E74C 4YSYD 2O01H 1X9VA 1M1JB 1AVOA 1M57D 4YTPC 1NTZG 2WP9C 2W6BA 5APTA 1FZBA 2A45H 1SQBE 3MIWA 4IL6E 1BE3G 1FZEA 4JF7A 1EDIA 1PP9D 4YSXC 1S5LH 3CWBE 2FYUE 2K9YA 2XKMA 2J58A 3F89A 1NTKE 1RF1B 1SP4A 2OYIC 2M0BA 5KJ7C 3H1JD 1DD4A 2BCCJ 1FZCA 1BCCE 1HF9A 2YKQA 5BU5A 1SQQJ 2E74B 2HLOA 4I1LA 3AE2D 2V7QH 3AEED 1SQVD 2E75C 3RK3C 1JM0A 5GTIH 1ZP0D 2C0XA 1H88A 3AE4D 4D6TD 1LJ2A 1BSHA 5EFWB 1KQGB 2P67A 4WWIA 2ZXXA 1YIJP 2A45I 1LTJA 3WUTA 1FDOA 2A06E 3AE5D 3Q5PA 3AE1D 1JMMA 1P84E 1KILC 5AW6B 3TYYA 4JQ0D 1K8AQ 5C2TD 5AW0B 4IL6X 1PPJE 3H1LE 4B86A 4C46A 2O01J 3VR8D 4RJTA 1QGKB 2QRXA 3PTZA 3NFQA 1LWUC 2KI7B 1OX3A 2QE7H 1E5WA 4YXDC 5CCHA 3M9QA 4H0LD 4U7JA 1SFCC 1IJDB 3SFEC 1FOSF 1GL2C 3L70E 2IYOA 2AXCA 2WU5C 3H1KJ 1JY3P 4Y99C 3G71P 1KILB 1NTMK 3VP9A 2N1TB 3RBZA 1E7PC 1VPCA 2WZ7A 1LTTC 1QVFO 1NJIQ 1H89A 1HJ0A 5AVUB 3L72D 3CD6P 2FXPA 3P8MC 1N2DC 2V7QJ 2VRSA 3AE7D 3EFGA 2M3EA 2HYNA 4EIJA 3B71A 3EQ2A 1SQXG 3HD7B 2QJKC 1OVRA 5CCHD 2B76D 1ZR4A 2AXTE 2ZT9C 3VR9C 1AQ5A 3AECC 2R44A 3P7KA 2KNCA 3BCCJ 1GL2B 2POHA 2G3AA 3P4RC 1DEBA 3RK2B 4AUWA 3C8VA 3HUSC 1MFTA 2MJZA 1W5CE 2Q3IA 3H1JE 3HTKA 4NPDA 1SLQA 1L0NJ 1NH4A 4PJ0H 1NTMD 2IBZG 1SQVE 1L4AA 3CXHD 3MGNA 2P2UA 3AE3C 1NTZJ 4KHXA 3V5BA 4D6TE 2HPCB 1BE3J 1Y47A 3GF7A 2WPQA 3CI9A 3PH0A 2N9BA 2WMMA 3AEAC 1FU1A 1D7MA 3WUUA 2M5AB 1BGYG 2KSEA 5KLVD 2HODB 1YQ3D 1PFIA 2IPPA 2QA4P 3SSUA 1LP1B 1LGHB 3AE9C 1LT9A 3JCUE 1AFOA 2Q3EA 1X0TA 1G1JA 1EQ7A 3RL0C 1L4AD 3WU2E 2XZRA 1LTBC 3HE5B 2K9JA 3W67A 3TGUD 3CX5H 5AVQB 3PP5A 1H0TB 2CK3H 1N73A 4R4MA 2E76B 4LC1A 1ZW0A 4I2LC 3LIDA 1NENC 4K35A 2CPSA 3A3YB 1FE6A 1SQQK 1EXIA 2QG4A 4PD4D 1R5LA 3L74D 3L72E 1K73Q 3RL0B 3D6YA 3MHVA 1FBMA 2E75D 1FZGA 4TLFA 2W8ZA 2WT7A 1JY2P 5KLIC 1EXJA 1NU1G 2BEQD 1CSBA 3S4RA 4YSZD 1QX8A 4OGQB 1IZNB 1CZQA 3CX5I 2ACZD 1PGPA 1FOSE 4GIFA 3CCQP 2ZVOB 3AEDD 2WPRA 3PHLA 4YSYC 4NPEA 1OIPA 2NZ2A 1N7SA 2Y9YA 2JJLA 1NTME 4IFDK 3FXEA 1JY3N 3SWFA 3T97B 3L35A 3CXHE 2KP8A 1YTZT 1L0LG 1SQXJ 2WDRD 3H1HG 1KZUB 2LKMA 2IBZI 3NXSA 4H44B 2M3BA 3SFED 1USEA 5TISE 5KLVE 2R32A 2V4HA 1N7SD 2KK7A 3AE2C 2QJYC 5KAFE 2HG5D 1BSNA 1AV1A 3VMAA 1ZP0C 4I6MC 2R3CA 3OA7A 3HRNA 3AE4C 2BS4C 2K37A 3S1KA 3B5NB 3TGUE 3L75G 2RN0A 3PJSK 1IFNA 5C39A 2N9YB 3KDPB 5AW4B 4XE5B 3GG2A 3AE5C 3BATA 3CCSP 3AE1C 2JO1A 2WSCH 1FJKA 1FZCC 2BS2C 2BCCG 5C2TC 1PIXA 1BGYJ 1SQQG 3KZIH 1L0NK 3H1KD 5AVZB 3MTUE 3VR8C 4H13D 4YXWH 3L74E 2H89D 1NTZK 1H8AA 1K9MQ 2WDVD 3L73G 4Y28J 3ABVD 3VN0A 2ZFCA 2HFED 4H0LC 1LTJC 4TT3H 3NTNA 3WUVA 1LTAC 2HR3A 1KF6C 1NO4A 3BASA 4WY4A 4I7ZC 5AW9B 1VQ9P 1M56D 2DW3A 3BRTB 4OWFA 1NOHA 3FWLA 5H2FH 3AE7C 2WVRA 1EZVE 2IZ0A 5B66E 5M1BA 3C9IA 2ITAA 1L0ND 1IFDA 4I6LA 4BRYA 2YMYA 5CCHC 2B76C 4GDOA 1FZAA 2GM4A 1VF5B 1AA0A 4O9BA 1NTZD 1FS0E 5KAIE 5APYA 1NU1J 2OQQA 3V2PA 4JBZA 1HWTC 3H32B 2RH0A 2WSCJ 1KQLA 4I7ZB 2K3RA 4AQRD 2H88D 1J1DC 2NPSA 2PP6A 4ZKPA 1URQA 2FYNB 4JYBA 2OYHA 1HGZA 2YXRB 1RQVA 1JTHA 1OMIA 5APWA 1KQFB 4DZOA 1YI2P 2H7HA 1ZV8A 1S72P 3A0BH 1IFIA 2Z5HA 5CCGA 4L74A 4WBAA 1L0LJ 1QL1A 4OH8B 1PGOA 4DHIB 3H1HJ 1NKZB 1EDJA 4KX6D 1FDIA 1YQ3C 4HYTB 2NPSD 2QSIA 2KZJA 2Q7CA 3IFMA 1URQD 2PAJA 4ASVA 5L8RJ 1L4AC 1VQ7P 2FXMA 4CPGA 1GW3A 4UB8H 1SQXK 2C9NY 5CCGD 2E5TA 3W68A 3CPWO 3BVHA 3L75J 5GTHH 2UWJE 3M0DA 3TSIA 1KFYD 3GHGA 2AEMA 5B5EH 2A06G 3V4WA 1LT9C 1GDTA 2D2CB 3CC2P 1AJYA 1N7LA 3QWOC 3SWYA 5BVZA 2B87A 4LDTA 5CBNA 3H1LG 4YTND 1N86A 3M9BA 1L0NE 3MZWB 1KTMA 1PL5A 2IFNA 1N73C 1LNQA 3L73J 4YSZC 2WPSA 1G2CA 1NTZE 4IL6H 2ACZC 3CX5D 1JO5A 3AEDC 2OYIB 2C0WA 3VP8A 4LGDE 1NAFA 3QH9A 1KYOD 3EWKA 3SWKA 1VQLP 3AEGC 5AVWB 1JB0J 2E75B 3RK3B 3H1IE 2L91A 4HB1A 4YPCA 2WDRC 1FDMA 3AE8D 4YT0D 3N7NA 3VRAD 2IBZD 3FWNA 2J59M 5APXA 1S3JA 3VMXA 1S2EA 1KF6D 1WRGA 1N7SC 1CI6A 3D6ZA 1OWAA 1J2JB 3I56P 2JP3A 2ZYDA 3P32A 1R8EA 3MUDA 2GA1A 1NGMB 1BGYD 4WB4A 4UB6H 1JY3O 3OJAB 4HH2A 3OAKA 1LWUB 2OGUA 4PJ0E 1CW5A 4M3LA 3II6A 1KFNA 1SVFA 1NU1K 1PP9E 2OYOA 3E1RA 2WSSH 1SFCB 2OTKE 4BWNA 1M1JA 1XTCC 2O3JA 3L71D 4Y99B 5DJUB 2FYUJ 2P58A 3H25A 2XNXA 1N7SB 1T3JA 3KPEA 3IAOA 3TDKA 1NTKJ 4H13C 3PLNA 3HE4B 3R2PA 1T3UA 1KB9H 2Y0DA 2H89C 1J1EC 1QL2A 2K1AA 2BEZF 2WDVC 3VMZA 1BCCJ 3ABVC 2H43A 3A5TA 1VQ4P 2MKVA 2QJKB 1SQPK 1L0LK 2ZT9B 2RMZA 3GW6A 2AXTH 2R5BA 4L75A 3CX5E 2XNDH 1LTGC 2IYPA 3R4YA 4ZKUA 3OW2O 3HUSB 1RY3A 2QM7A 2KLVA 1FC2C 3L37A 1KYOE 1MKMA 4MN4C 3H1LJ 1DH3A 1KB9I 3IR9A 2YKPA 3PRJA 1M7LA 3V2QA 3CC7P 4WY4C 2IBZE 2H88C 1L0LD 1X8YA 2QEXP 3E7KA 3CCJP 3L70J 2ZJSE 3P4QC 1HH0A 1ZXGA 3FXDA 4W7YA 1ZRTD 3JCUH 3C1LA 1OXZA 3WU2H 3TNUB 1KILA 3O6QB 4KJMA 2N1TA 3LIEA 1DIPA 3P4PD 4KX6C 2ZYAA 2E43A 4KT0J 3U1CA 1DEEG 4W80A 3L75D 2NPSC 2NRGA 5AW3B 5DJTB 4DHZA 3L71E 1U57A 1URQC 1JY2O 2OYHC 1KN7A 2IZ1A 3HD7A 4ZNCA 2FFDA 3A7OA 2Q5UA 2J5UA 3WMM0 2IFMA 2BCCD 4BRYB 3AEGD 1SQQD 1U7MA 3V6IA 3M9HA 5CCGC 2Q9IA 1Q82Q 1NWQA 2QIWA 1RE4A 1SQPG 2N1TD 5KLIB 1PGJA 1KFYC 3L73D 1VQ5P 5AVYB 1LTSC 4GT1A 1RF0A 4JYCA 4C7RA 2OYHB 3HD7D 3KQGA 5CHXA 2HPCA 4YTNC 4DOJA 1XTGB 5C3JD 3IF4A 2Y9ZA 1M90Q 4EI2A 4C7NB 3AEBD 3RK2D 2QJPC 1KFMA 2M5AA 3P4SD 5KKZC 2HODA 4XFJA 3M0DC 3KHUA 2WSEH 3GHGC 1BDCA 1LP1A 2WS3D 2WSFH 2Q6QA 2FXOA 2FYUK 2W90A 4U3FG 1L0LE 3CIRD 1IFPA 1NTKK 1Y9BA 2LXCB 5TISH 2QJYB 1M8OB 4PD4E 5AW2B 1Q81Q 3D70A 1GD2E 2WITA 1HBWA 1ZRTE 3I55P 5TJHA 5E79E 2I1JA 4DJGA 1NAYA 2LR2A 1VQMP 1EZVG 1KORA 5KAFH 4IFMA 2OTJP 3AE8C 4YT0C 3VRAC 2QJPB 1HVVA 2B88A 3GHGB 1T2KD 3RGUA 3L75E 2AEJA 1FZCB 1KV4A 3BCCD 2B87B 1Q86Q 3CLQA 3VOPA 5APUA 3EFFK 2KIKA 3E1IA 2E76D 2BCCE 2JR8A 1SQQE 3M0AA 4L73A 2ZYGA 2I1KA 4H0LB 1LTJB 4HKZH 1IK7A 2WSEJ 4EDFA 1ZLLA 4WY4D 2FBWD 2WSFJ 2P7JA 4DCKA 2W6AA 2P10A 1BE3D 1NEKD 2FY8A 3MUDC 1JY2N 1TFFA 3P4QD 2KLUA 4OGQD 3FX0A 2KZIA 2XV5A 5B66H 1PZQA 3H6PA 3VTPC 1SQBG 3H1LD 1MUUA 1SQPJ 1FAVA 2B89A 1M1JC 1Q7YQ 1KQSO 4UB8E 3CWBG 3Q3DA 2FYUG 1S5LE 1LT1A 1NTKG 2JDIH 1ZOYD 1J1DB 1DD3A 3B4SA 4FJVA 3B5NA 1RE3A 3H1KE 1ZMEC 1GZLA 1BCCG 4DT0A 2GUSA 1GTWA 1RQUA 4DHJA 4XA4A 3CCRP 4H44D 1YJNP 3VMYA 2JEEA 1KB9D 2K88A 3CL3D 3MP7B 2KB7P 2Z4EA 1VQNP 3MD0A 2KNCB 5GTIE 5AW7B 2H8PD 1EC5A 2IX7C 1EZVI 2KS1A 1SS1A 1W2BO 1YBKA 3A0HH 2KOGA 3HTKB 1OZHA 4U3FJ 3BCCE 3B5ND 1Q2NA 1L4AB 1PPJG 1Z56A 2WQYD 2R5DA 3L36A 1T8ZA 1IO4A 5AW1B 1QVGO 3RBXA 3H1IG 1NKNA 1S5LX 3A2AA 3Q1MA 2KYVA 3P4PC 3CMEP 3M91A 1VL2A 4RO0A 2GUVA 1SQXD 1K05A 2ZFYA 1BE3E 3L70G 1LT9B 1KD1Q 1L2PA 3AE6C 5AVVB 4NPFX 1KC8Q 2WU2D 1T6AA 1JCCA 5AVTB 2K9JB 1QLBC 3U1AA 1YTZI 3KYQA 3H32A 2N1TC 1S1CX 3ZDMA 1VQPP 3UIAA 1N73B 4HJGH 4UB6E 1GU4A 3O8ZA 4BXLA 2WPVB 2YO3A 1L0VD 3K5BA 2RKLA 1PP9G 2I8DA 2IDBA 2JWDA 4JPZB 1Q90D 2ZVNB 2FKWB 3HD7C 2FFDC 1USDA 4PV1D 2YO2A 1KMIZ 1VF5D 1P84H 5C3JC 3CCUP 1YQ4C 3D71A 1VQOP 1YJ9P 1ZR2A 3VYIA 3H1JG 4WVZA 1QLED 3AEBC 2YKOA 3RK2C 1RE4C 2WT7B 4AYCA 3P4SC 1KB9E 1SQVG 5AVRB 3I5CA 3JC22 2WS3C 1PV3A 4D6TG 2FYZA 1RF0C 2M8RA 1SQBJ 2JKVA 3CIRC 1IK9A 3SFDD 3CWBJ 3Q2YA 3VONA 3G6EP 2FFDB 1AVYA 2YIUC 1OW8A 5CJ4A 5KLVK 1S9KD 5AW5B 2WDQD 2R3SA 5APQA 3S9OA 1GW4A 1P84I 1NYHA 1IFJA 1VQ8P 4ZMDA 1RF1A 1FZFA 1T2KC 5APSA 3AEFD 1SQXE 1JEKA 4L76A 1NU1D 1U7JA 3BRVB 1BDDA 2YIUB 2W6JH 4H13B 2E76C 2QVAA 1J1EB 4N6JA 1GMJA 4Z1MH 3CC4P 3L72G 1OVUA 1AQTA 3VRBD 2OYIA 4YTMD 2WWWA 2D2CD 3H1IJ 2BS3C 1RH5B 2FBWC 5KJ7A 2E42A 2E74D 3CMAP 1NEKC 4EOTA 1SQPD 4YTPD 5BU8B 2WP9D 1HGVA 3H1HD 3L71G 5K5GB 2SPZA 1K04A 1A02J 4ASWA 4YSXD 4OGQC 2P1JA 3CCVP 1YYCA 1BGYE 1UIXA 1JUNA 1KYOH 1NTMG 1HJBA 2KSJA 1OFCX 4GOEA 5KJ7D 1JMBA 3JSVC 4WY4B 2PGDA 5CMZA 2PFXA 4K3AA 1PP9J 3L4FA 1RHZB 3Q5SA 3RK3D 1ZOYC 5KTBA 2CPBA 1LWUA 2O1JA 5KLVG 3P8CD 1S9KE 3AE6D 4U3FD 3B8EB 4H44C 4N78D 1YHQP 1FJPA 3H1JJ 1SFCA 1Y8AA 1GL2A 1OW6A 5AVXB 1KILD 1M1KQ 1SQVJ 3TGUG 1KYOI 3ITKA 2W83C 1EDLA 1EZVD 3FGAD 4N3YB 4D6TJ 3HE4A 3KXDA 4DDGA 2ZAEB 3V4QA 2YMKA 2NPSB 1NU1E 3V2NA 3B5NC 3LW5H 1URQB 1RE3C 2B9BA 3G3ZA 1MFZA 1QEXA
chains in the Genus database with same CATH topology
3AEDD 1NEKC 2E74C 4YSYD 2H89D 2WS3D 3AEAD 3AEDC 2WQYD 4RKUJ 4YTPD 4YSYC 2H89C 4YXDD 1WMKA 3AEAC 2WDVD 2WP9D 2WQYC 3RL0g 1PV3A 2WS3C 2NZ2A 4YTPC 4YXDC 2BEZF 4Y28J 2WDVC 1KILE 2WP9C 1YQ4D 3ABVD 4H0LD 1YQ3D 4U7JA 3CIRD 1DIPA 1FDIA 3ABVC 3P4QD 4KX6D 4H0LC 2FYNC 1S5LX 1YQ3C 3CIRC 3P4PD 4KX6C 1K04A 3EWKA 3SFEC 3AE9D 3SFDD 4TT3H 2MKVA 1Y9BA 4KT0J 4OGQD 3Q1MA 3AE9C 3SFDC 3G9RA 3T97B 2WU5D 3Q2YA 4YSXD 3AEGC 4OGQC 4YSXC 2QSIA 2WU5C 1VL2A 1JB0J 1KF6C 2ZT9B 2G8YA 2YIUC 2E75B 1UIXA 1OW8A 3D70A 1U57A 2K9YA 1E7PC 1K05A 1ZRTE 4I7ZC 3AEEC 4PV1B 5L8RJ 2WDRD 2WDRC 1KORA 2WDQD 1HJ0A 3AE8D 4YT0D 3VRAD 3Q5RA 4H44B 3R4YA 2FXPA 2WDQC 2J5UA 3AE8C 3Q3DA 3S9OA 4YT0C 3VRAC 3SFED 5C2TD 2V7QJ 3AE6C 3AE7D 1OW7A 1DD4A 1NYHA 3AE7C 2WU2D 3AEGD 1HF9A 4R4MA 2E76B 3B71A 1KF6D 2WU2C 2E74B 5M1BA 3GLMA 2QJKC 1MKMA 3AE2D 1ZOYD 2ZT9D 1NEND 2QIWA 3Q5SA 1QLBC 1DD3A 3AE2C 1ZOYC 2B76D 3VR9D 2QJYC 2ZT9C 3AEED 1NENC 2B76C 2E75C 4GDOA 3AEFD 3VR9C 3D6ZA 3AECD 1S1CX 1ZP0D 2JP3A 1KFYD 1VF5B 1R8EA 1ZMEC 3AEFC 3GF3A 3AECC 1ZP0C 3AE4D 1KFYC 1RQUA 3AE4C 1NGMB 2BS4C 3P4RD 4H44D 1EXIA 2G3AA 3AE6D 3P4RC 1KQGB 2OQQA 2WPVB 4H44C 2D2CB 3C8VA 1AJYA 1L0VD 1L0VC 2IDBA 4H13B 2WSCJ 2E76D 1Q90D 1FDOA 4I7ZB 3D6YA 3P4PC 2H88D 1OW6A 2E76C 3AE5D 3Q5PA 2H88C 2E75D 3AE1D 3AE5C 4YTND 1GMJA 3AE1C 2JO1A 4YTNC 4PV1D 4Z1MH 1TU3F 1KMIZ 5KLIC 5C3JD 1VF5D 1EXJA 4H0LB 4PV1C 3RK3E 1KTMA 4R4LA 5C3JC 1VF5C 3LW5J 3AE3D 1PL5A 1YQ4C 3FGAD 3D71A 1RQVA 3GMAA 1IK7A 2BEQD 4IL6X 2WSEJ 3AE3C 2BS2C 3P4QC 1OMIA 3VRBD 1PIXA 4YSZD 5C2TC 3AEBD 4OGQB 1KQFB 4YTMD 3VRBC 2D2CD 2O01J 4YSZC 2FBWD 2YMKA 2WSFJ 3AEBC 4YTMC 2BS3C 3H25A 2ACZD 3VR8D 2QJPC 3O6QA 2D2CC 2FBWC 3P4SD 5KKZC 2ACZC 2P10A 3IN6A 4XFJA 3VR8C 3IAOA 4H13D 3P4SC 1NEKD 2E74D 3GF7A 4H13C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AED D;  1NEK C;  4YSY D;  2H89 D;  2WS3 D;  3AEA D;  3AED C;  2WQY D;  4YTP D;  4YSY C;  2H89 C;  4YXD D;  3AEA C;  2WS3 C;  2WDV D;  2WP9 D;  2WQY C;  1PV3 A;  4YTP C;  4YXD C;  2WDV C;  2WP9 C;  3ABV D;  1YQ4 D;  1YQ3 D;  3CIR D;  4KX6 D;  3ABV C;  3P4Q D;  1YQ3 C;  3CIR C;  3P4P D;  4KX6 C;  1K04 A;  3SFE C;  3AE9 D;  3SFD D;  3P4P C;  3AE9 C;  3SFD C;  4YSX D;  2WU5 D;  3AEG C;  4YSX C;  2WU5 C;  1KF6 C;  1OW8 A;  1E7P C;  1K05 A;  3AEE C;  2WDR D;  2WDR C;  2WDQ D;  3AE8 D;  4YT0 D;  3VRA D;  2WDQ C;  3AE8 C;  4YT0 C;  3S9O A;  3VRA C;  3SFE D;  3AE6 C;  3AE7 D;  1OW7 A;  3AE7 C;  2WU2 D;  3AEG D;  3B71 A;  1KF6 D;  2WU2 C;  3AE2 D;  1ZOY D;  1NEN D;  2B76 D;  1QLB C;  3AE2 C;  1ZOY C;  3VR9 D;  3AEE D;  1NEN C;  2B76 C;  3AEF D;  3VR9 C;  3AEC D;  1ZP0 D;  1KFY D;  3AEF C;  3AEC C;  1ZP0 C;  3AE4 D;  1KFY C;  3AE4 C;  2BS4 C;  3P4R D;  2G3A A;  3AE6 D;  3P4R C;  1L0V D;  1L0V C;  2H88 D;  1OW6 A;  3AE5 D;  2H88 C;  3AE1 D;  3AE5 C;  4YTN D;  3AE1 C;  4YTN C;  5C3J D;  1KTM A;  5C3J C;  3AE3 D;  1YQ4 C;  5C2T D;  2BS2 C;  3AE3 C;  3P4Q C;  3VRB D;  4YSZ D;  5C2T C;  3AEB D;  4YTM D;  3VRB C;  4YSZ C;  2FBW D;  3AEB C;  4YTM C;  2BS3 C;  2ACZ D;  3VR8 D;  2FBW C;  3P4S D;  2ACZ C;  3VR8 C;  3P4S C;  1NEK D; 
#chains in the Genus database with same CATH topology
 1JTH B;  4RKU J;  4YXD D;  1WMK A;  2WQY C;  3RL0 g;  1YQ4 D;  3CCL P;  1SFC D;  3KZI E;  1R5S A;  1GL2 D;  3L74 G;  2XU6 A;  1X22 A;  3G9R A;  2WU5 D;  3TK1 A;  3CXH H;  4QMA A;  3HUS A;  1OVV A;  1SQB K;  2OAR A;  3AEE C;  1IFM A;  2XDJ A;  3NMD A;  1X79 B;  1SQP E;  2KUB A;  1OW7 A;  3H1H E;  3HE5 A;  2WU2 C;  1NVO A;  3GLM A;  3USS A;  2YXQ B;  2O1K A;  2ZT9 D;  3VR9 D;  1H0T A;  3AEC D;  5AW8 B;  2Z5I A;  4A7P A;  1JCD A;  1HTL C;  5APV A;  4EYY Q;  3P4R D;  3L72 J;  5H2F E;  1LTI C;  5KKZ B;  3V2R A;  3F5H A;  1G1I A;  1L0V C;  2KS1 B;  1JOC A;  2Y0E A;  2O01 N;  5CBO A;  2OTL P;  4OVN F;  5CJ0 A;  2Q1K A;  3CXH I;  1NHL A;  2C9L Y;  1SQB D;  4PV1 C;  3RK3 E;  2AEF A;  1VF5 C;  3LW5 J;  1JNM A;  3AE3 D;  3GMA A;  1ZN5 A;  3CWB D;  3P8C E;  2FYU D;  3L71 J;  1GK4 A;  3TNU A;  3O6Q A;  2E5Y A;  3TF5 A;  1MV8 A;  4U3F E;  4N78 E;  3CCE P;  1NTK D;  1MZ9 A;  4PD4 H;  3AEA D;  1E79 H;  1NTM J;  1G2C B;  1GK6 A;  1KIL E;  5E79 H;  1BCC D;  3N4X A;  2Y0C A;  2FYN C;  3AE9 D;  3SFD C;  2BAS A;  2QM8 A;  3A0B E;  3M06 A;  4GOF A;  3L73 E;  1N8R Q;  2A45 G;  2G8Y A;  3RL0 D;  4PV1 B;  4GOD A;  1S4X A;  2PRR A;  3T97 A;  1EDK A;  2WTY A;  3Q5R A;  2WDQ C;  5KLV J;  2L5G B;  2A06 D;  1A02 F;  3H1K G;  1P84 D;  2W27 A;  1NEN D;  1PGQ A;  4IOI H;  1VDF A;  4RES B;  1YIT P;  1YJW P;  1GU5 A;  4DDI A;  2ZXE B;  1PPJ D;  3AEF C;  3GF3 A;  4W7Z A;  2KXP B;  2LXB A;  4PD4 I;  3TGU J;  2YNY A;  3H1I D;  5KAI H;  1VQK P;  1CI6 B;  5AVS B;  1W2E A;  1IC2 A;  5GTH E;  1HUC A;  4C7N A;  4LLH A;  3G4S P;  3BCC G;  5B5E E;  1TU3 F;  2JWA A;  4GKG A;  3A0H E;  4R4L A;  3L70 D;  1RF1 C;  1DX7 A;  1VQ6 P;  1WT6 A;  3VRB C;  4IFF A;  3CCM P;  4YTM C;  2D2C C;  3L74 J;  1SQV K;  1L0N G;  3IN6 A;  3U59 A;  1UII A;  2E74 C;  4YSY D;  2O01 H;  1X9V A;  1M1J B;  1AVO A;  1M57 D;  4YTP C;  1NTZ G;  2WP9 C;  2W6B A;  5APT A;  1FZB A;  2A45 H;  1SQB E;  3MIW A;  4IL6 E;  1BE3 G;  1FZE A;  4JF7 A;  1EDI A;  1PP9 D;  4YSX C;  1S5L H;  3CWB E;  2FYU E;  2K9Y A;  2XKM A;  2J58 A;  3F89 A;  1NTK E;  1RF1 B;  1SP4 A;  2OYI C;  2M0B A;  5KJ7 C;  3H1J D;  1DD4 A;  2BCC J;  1FZC A;  1BCC E;  1HF9 A;  2YKQ A;  5BU5 A;  1SQQ J;  2E74 B;  2HLO A;  4I1L A;  3AE2 D;  2V7Q H;  3AEE D;  1SQV D;  2E75 C;  3RK3 C;  1JM0 A;  5GTI H;  1ZP0 D;  2C0X A;  1H88 A;  3AE4 D;  4D6T D;  1LJ2 A;  1BSH A;  5EFW B;  1KQG B;  2P67 A;  4WWI A;  2ZXX A;  1YIJ P;  2A45 I;  1LTJ A;  3WUT A;  1FDO A;  2A06 E;  3AE5 D;  3Q5P A;  3AE1 D;  1JMM A;  1P84 E;  1KIL C;  5AW6 B;  3TYY A;  4JQ0 D;  1K8A Q;  5C2T D;  5AW0 B;  4IL6 X;  1PPJ E;  3H1L E;  4B86 A;  4C46 A;  2O01 J;  3VR8 D;  4RJT A;  1QGK B;  2QRX A;  3PTZ A;  3NFQ A;  1LWU C;  2KI7 B;  1OX3 A;  2QE7 H;  1E5W A;  4YXD C;  5CCH A;  3M9Q A;  4H0L D;  4U7J A;  1SFC C;  1IJD B;  3SFE C;  1FOS F;  1GL2 C;  3L70 E;  2IYO A;  2AXC A;  2WU5 C;  3H1K J;  1JY3 P;  4Y99 C;  3G71 P;  1KIL B;  1NTM K;  3VP9 A;  2N1T B;  3RBZ A;  1E7P C;  1VPC A;  2WZ7 A;  1LTT C;  1QVF O;  1NJI Q;  1H89 A;  1HJ0 A;  5AVU B;  3L72 D;  3CD6 P;  2FXP A;  3P8M C;  1N2D C;  2V7Q J;  2VRS A;  3AE7 D;  3EFG A;  2M3E A;  2HYN A;  4EIJ A;  3B71 A;  3EQ2 A;  1SQX G;  3HD7 B;  2QJK C;  1OVR A;  5CCH D;  2B76 D;  1ZR4 A;  2AXT E;  2ZT9 C;  3VR9 C;  1AQ5 A;  3AEC C;  2R44 A;  3P7K A;  2KNC A;  3BCC J;  1GL2 B;  2POH A;  2G3A A;  3P4R C;  1DEB A;  3RK2 B;  4AUW A;  3C8V A;  3HUS C;  1MFT A;  2MJZ A;  1W5C E;  2Q3I A;  3H1J E;  3HTK A;  4NPD A;  1SLQ A;  1L0N J;  1NH4 A;  4PJ0 H;  1NTM D;  2IBZ G;  1SQV E;  1L4A A;  3CXH D;  3MGN A;  2P2U A;  3AE3 C;  1NTZ J;  4KHX A;  3V5B A;  4D6T E;  2HPC B;  1BE3 J;  1Y47 A;  3GF7 A;  2WPQ A;  3CI9 A;  3PH0 A;  2N9B A;  2WMM A;  3AEA C;  1FU1 A;  1D7M A;  3WUU A;  2M5A B;  1BGY G;  2KSE A;  5KLV D;  2HOD B;  1YQ3 D;  1PFI A;  2IPP A;  2QA4 P;  3SSU A;  1LP1 B;  1LGH B;  3AE9 C;  1LT9 A;  3JCU E;  1AFO A;  2Q3E A;  1X0T A;  1G1J A;  1EQ7 A;  3RL0 C;  1L4A D;  3WU2 E;  2XZR A;  1LTB C;  3HE5 B;  2K9J A;  3W67 A;  3TGU D;  3CX5 H;  5AVQ B;  3PP5 A;  1H0T B;  2CK3 H;  1N73 A;  4R4M A;  2E76 B;  4LC1 A;  1ZW0 A;  4I2L C;  3LID A;  1NEN C;  4K35 A;  2CPS A;  3A3Y B;  1FE6 A;  1SQQ K;  1EXI A;  2QG4 A;  4PD4 D;  1R5L A;  3L74 D;  3L72 E;  1K73 Q;  3RL0 B;  3D6Y A;  3MHV A;  1FBM A;  2E75 D;  1FZG A;  4TLF A;  2W8Z A;  2WT7 A;  1JY2 P;  5KLI C;  1EXJ A;  1NU1 G;  2BEQ D;  1CSB A;  3S4R A;  4YSZ D;  1QX8 A;  4OGQ B;  1IZN B;  1CZQ A;  3CX5 I;  2ACZ D;  1PGP A;  1FOS E;  4GIF A;  3CCQ P;  2ZVO B;  3AED D;  2WPR A;  3PHL A;  4YSY C;  4NPE A;  1OIP A;  2NZ2 A;  1N7S A;  2Y9Y A;  2JJL A;  1NTM E;  4IFD K;  3FXE A;  1JY3 N;  3SWF A;  3T97 B;  3L35 A;  3CXH E;  2KP8 A;  1YTZ T;  1L0L G;  1SQX J;  2WDR D;  3H1H G;  1KZU B;  2LKM A;  2IBZ I;  3NXS A;  4H44 B;  2M3B A;  3SFE D;  1USE A;  5TIS E;  5KLV E;  2R32 A;  2V4H A;  1N7S D;  2KK7 A;  3AE2 C;  2QJY C;  5KAF E;  2HG5 D;  1BSN A;  1AV1 A;  3VMA A;  1ZP0 C;  4I6M C;  2R3C A;  3OA7 A;  3HRN A;  3AE4 C;  2BS4 C;  2K37 A;  3S1K A;  3B5N B;  3TGU E;  3L75 G;  2RN0 A;  3PJS K;  1IFN A;  5C39 A;  2N9Y B;  3KDP B;  5AW4 B;  4XE5 B;  3GG2 A;  3AE5 C;  3BAT A;  3CCS P;  3AE1 C;  2JO1 A;  2WSC H;  1FJK A;  1FZC C;  2BS2 C;  2BCC G;  5C2T C;  1PIX A;  1BGY J;  1SQQ G;  3KZI H;  1L0N K;  3H1K D;  5AVZ B;  3MTU E;  3VR8 C;  4H13 D;  4YXW H;  3L74 E;  2H89 D;  1NTZ K;  1H8A A;  1K9M Q;  2WDV D;  3L73 G;  4Y28 J;  3ABV D;  3VN0 A;  2ZFC A;  2HFE D;  4H0L C;  1LTJ C;  4TT3 H;  3NTN A;  3WUV A;  1LTA C;  2HR3 A;  1KF6 C;  1NO4 A;  3BAS A;  4WY4 A;  4I7Z C;  5AW9 B;  1VQ9 P;  1M56 D;  2DW3 A;  3BRT B;  4OWF A;  1NOH A;  3FWL A;  5H2F H;  3AE7 C;  2WVR A;  1EZV E;  2IZ0 A;  5B66 E;  5M1B A;  3C9I A;  2ITA A;  1L0N D;  1IFD A;  4I6L A;  4BRY A;  2YMY A;  5CCH C;  2B76 C;  4GDO A;  1FZA A;  2GM4 A;  1VF5 B;  1AA0 A;  4O9B A;  1NTZ D;  1FS0 E;  5KAI E;  5APY A;  1NU1 J;  2OQQ A;  3V2P A;  4JBZ A;  1HWT C;  3H32 B;  2RH0 A;  2WSC J;  1KQL A;  4I7Z B;  2K3R A;  4AQR D;  2H88 D;  1J1D C;  2NPS A;  2PP6 A;  4ZKP A;  1URQ A;  2FYN B;  4JYB A;  2OYH A;  1HGZ A;  2YXR B;  1RQV A;  1JTH A;  1OMI A;  5APW A;  1KQF B;  4DZO A;  1YI2 P;  2H7H A;  1ZV8 A;  1S72 P;  3A0B H;  1IFI A;  2Z5H A;  5CCG A;  4L74 A;  4WBA A;  1L0L J;  1QL1 A;  4OH8 B;  1PGO A;  4DHI B;  3H1H J;  1NKZ B;  1EDJ A;  4KX6 D;  1FDI A;  1YQ3 C;  4HYT B;  2NPS D;  2QSI A;  2KZJ A;  2Q7C A;  3IFM A;  1URQ D;  2PAJ A;  4ASV A;  5L8R J;  1L4A C;  1VQ7 P;  2FXM A;  4CPG A;  1GW3 A;  4UB8 H;  1SQX K;  2C9N Y;  5CCG D;  2E5T A;  3W68 A;  3CPW O;  3BVH A;  3L75 J;  5GTH H;  2UWJ E;  3M0D A;  3TSI A;  1KFY D;  3GHG A;  2AEM A;  5B5E H;  2A06 G;  3V4W A;  1LT9 C;  1GDT A;  2D2C B;  3CC2 P;  1AJY A;  1N7L A;  3QWO C;  3SWY A;  5BVZ A;  2B87 A;  4LDT A;  5CBN A;  3H1L G;  4YTN D;  1N86 A;  3M9B A;  1L0N E;  3MZW B;  1KTM A;  1PL5 A;  2IFN A;  1N73 C;  1LNQ A;  3L73 J;  4YSZ C;  2WPS A;  1G2C A;  1NTZ E;  4IL6 H;  2ACZ C;  3CX5 D;  1JO5 A;  3AED C;  2OYI B;  2C0W A;  3VP8 A;  4LGD E;  1NAF A;  3QH9 A;  1KYO D;  3EWK A;  3SWK A;  1VQL P;  3AEG C;  5AVW B;  1JB0 J;  2E75 B;  3RK3 B;  3H1I E;  2L91 A;  4HB1 A;  4YPC A;  2WDR C;  1FDM A;  3AE8 D;  4YT0 D;  3N7N A;  3VRA D;  2IBZ D;  3FWN A;  2J59 M;  5APX A;  1S3J A;  3VMX A;  1S2E A;  1KF6 D;  1WRG A;  1N7S C;  1CI6 A;  3D6Z A;  1OWA A;  1J2J B;  3I56 P;  2JP3 A;  2ZYD A;  3P32 A;  1R8E A;  3MUD A;  2GA1 A;  1NGM B;  1BGY D;  4WB4 A;  4UB6 H;  1JY3 O;  3OJA B;  4HH2 A;  3OAK A;  1LWU B;  2OGU A;  4PJ0 E;  1CW5 A;  4M3L A;  3II6 A;  1KFN A;  1SVF A;  1NU1 K;  1PP9 E;  2OYO A;  3E1R A;  2WSS H;  1SFC B;  2OTK E;  4BWN A;  1M1J A;  1XTC C;  2O3J A;  3L71 D;  4Y99 B;  5DJU B;  2FYU J;  2P58 A;  3H25 A;  2XNX A;  1N7S B;  1T3J A;  3KPE A;  3IAO A;  3TDK A;  1NTK J;  4H13 C;  3PLN A;  3HE4 B;  3R2P A;  1T3U A;  1KB9 H;  2Y0D A;  2H89 C;  1J1E C;  1QL2 A;  2K1A A;  2BEZ F;  2WDV C;  3VMZ A;  1BCC J;  3ABV C;  2H43 A;  3A5T A;  1VQ4 P;  2MKV A;  2QJK B;  1SQP K;  1L0L K;  2ZT9 B;  2RMZ A;  3GW6 A;  2AXT H;  2R5B A;  4L75 A;  3CX5 E;  2XND H;  1LTG C;  2IYP A;  3R4Y A;  4ZKU A;  3OW2 O;  3HUS B;  1RY3 A;  2QM7 A;  2KLV A;  1FC2 C;  3L37 A;  1KYO E;  1MKM A;  4MN4 C;  3H1L J;  1DH3 A;  1KB9 I;  3IR9 A;  2YKP A;  3PRJ A;  1M7L A;  3V2Q A;  3CC7 P;  4WY4 C;  2IBZ E;  2H88 C;  1L0L D;  1X8Y A;  2QEX P;  3E7K A;  3CCJ P;  3L70 J;  2ZJS E;  3P4Q C;  1HH0 A;  1ZXG A;  3FXD A;  4W7Y A;  1ZRT D;  3JCU H;  3C1L A;  1OXZ A;  3WU2 H;  3TNU B;  1KIL A;  3O6Q B;  4KJM A;  2N1T A;  3LIE A;  1DIP A;  3P4P D;  4KX6 C;  2ZYA A;  2E43 A;  4KT0 J;  3U1C A;  1DEE G;  4W80 A;  3L75 D;  2NPS C;  2NRG A;  5AW3 B;  5DJT B;  4DHZ A;  3L71 E;  1U57 A;  1URQ C;  1JY2 O;  2OYH C;  1KN7 A;  2IZ1 A;  3HD7 A;  4ZNC A;  2FFD A;  3A7O A;  2Q5U A;  2J5U A;  3WMM 0;  2IFM A;  2BCC D;  4BRY B;  3AEG D;  1SQQ D;  1U7M A;  3V6I A;  3M9H A;  5CCG C;  2Q9I A;  1Q82 Q;  1NWQ A;  2QIW A;  1RE4 A;  1SQP G;  2N1T D;  5KLI B;  1PGJ A;  1KFY C;  3L73 D;  1VQ5 P;  5AVY B;  1LTS C;  4GT1 A;  1RF0 A;  4JYC A;  4C7R A;  2OYH B;  3HD7 D;  3KQG A;  5CHX A;  2HPC A;  4YTN C;  4DOJ A;  1XTG B;  5C3J D;  3IF4 A;  2Y9Z A;  1M90 Q;  4EI2 A;  4C7N B;  3AEB D;  3RK2 D;  2QJP C;  1KFM A;  2M5A A;  3P4S D;  5KKZ C;  2HOD A;  4XFJ A;  3M0D C;  3KHU A;  2WSE H;  3GHG C;  1BDC A;  1LP1 A;  2WS3 D;  2WSF H;  2Q6Q A;  2FXO A;  2FYU K;  2W90 A;  4U3F G;  1L0L E;  3CIR D;  1IFP A;  1NTK K;  1Y9B A;  2LXC B;  5TIS H;  2QJY B;  1M8O B;  4PD4 E;  5AW2 B;  1Q81 Q;  3D70 A;  1GD2 E;  2WIT A;  1HBW A;  1ZRT E;  3I55 P;  5TJH A;  5E79 E;  2I1J A;  4DJG A;  1NAY A;  2LR2 A;  1VQM P;  1EZV G;  1KOR A;  5KAF H;  4IFM A;  2OTJ P;  3AE8 C;  4YT0 C;  3VRA C;  2QJP B;  1HVV A;  2B88 A;  3GHG B;  1T2K D;  3RGU A;  3L75 E;  2AEJ A;  1FZC B;  1KV4 A;  3BCC D;  2B87 B;  1Q86 Q;  3CLQ A;  3VOP A;  5APU A;  3EFF K;  2KIK A;  3E1I A;  2E76 D;  2BCC E;  2JR8 A;  1SQQ E;  3M0A A;  4L73 A;  2ZYG A;  2I1K A;  4H0L B;  1LTJ B;  4HKZ H;  1IK7 A;  2WSE J;  4EDF A;  1ZLL A;  4WY4 D;  2FBW D;  2WSF J;  2P7J A;  4DCK A;  2W6A A;  2P10 A;  1BE3 D;  1NEK D;  2FY8 A;  3MUD C;  1JY2 N;  1TFF A;  3P4Q D;  2KLU A;  4OGQ D;  3FX0 A;  2KZI A;  2XV5 A;  5B66 H;  1PZQ A;  3H6P A;  3VTP C;  1SQB G;  3H1L D;  1MUU A;  1SQP J;  1FAV A;  2B89 A;  1M1J C;  1Q7Y Q;  1KQS O;  4UB8 E;  3CWB G;  3Q3D A;  2FYU G;  1S5L E;  1LT1 A;  1NTK G;  2JDI H;  1ZOY D;  1J1D B;  1DD3 A;  3B4S A;  4FJV A;  3B5N A;  1RE3 A;  3H1K E;  1ZME C;  1GZL A;  1BCC G;  4DT0 A;  2GUS A;  1GTW A;  1RQU A;  4DHJ A;  4XA4 A;  3CCR P;  4H44 D;  1YJN P;  3VMY A;  2JEE A;  1KB9 D;  2K88 A;  3CL3 D;  3MP7 B;  2KB7 P;  2Z4E A;  1VQN P;  3MD0 A;  2KNC B;  5GTI E;  5AW7 B;  2H8P D;  1EC5 A;  2IX7 C;  1EZV I;  2KS1 A;  1SS1 A;  1W2B O;  1YBK A;  3A0H H;  2KOG A;  3HTK B;  1OZH A;  4U3F J;  3BCC E;  3B5N D;  1Q2N A;  1L4A B;  1PPJ G;  1Z56 A;  2WQY D;  2R5D A;  3L36 A;  1T8Z A;  1IO4 A;  5AW1 B;  1QVG O;  3RBX A;  3H1I G;  1NKN A;  1S5L X;  3A2A A;  3Q1M A;  2KYV A;  3P4P C;  3CME P;  3M91 A;  1VL2 A;  4RO0 A;  2GUV A;  1SQX D;  1K05 A;  2ZFY A;  1BE3 E;  3L70 G;  1LT9 B;  1KD1 Q;  1L2P A;  3AE6 C;  5AVV B;  4NPF X;  1KC8 Q;  2WU2 D;  1T6A A;  1JCC A;  5AVT B;  2K9J B;  1QLB C;  3U1A A;  1YTZ I;  3KYQ A;  3H32 A;  2N1T C;  1S1C X;  3ZDM A;  1VQP P;  3UIA A;  1N73 B;  4HJG H;  4UB6 E;  1GU4 A;  3O8Z A;  4BXL A;  2WPV B;  2YO3 A;  1L0V D;  3K5B A;  2RKL A;  1PP9 G;  2I8D A;  2IDB A;  2JWD A;  4JPZ B;  1Q90 D;  2ZVN B;  2FKW B;  3HD7 C;  2FFD C;  1USD A;  4PV1 D;  2YO2 A;  1KMI Z;  1VF5 D;  1P84 H;  5C3J C;  3CCU P;  1YQ4 C;  3D71 A;  1VQO P;  1YJ9 P;  1ZR2 A;  3VYI A;  3H1J G;  4WVZ A;  1QLE D;  3AEB C;  2YKO A;  3RK2 C;  1RE4 C;  2WT7 B;  4AYC A;  3P4S C;  1KB9 E;  1SQV G;  5AVR B;  3I5C A;  3JC2 2;  2WS3 C;  1PV3 A;  4D6T G;  2FYZ A;  1RF0 C;  2M8R A;  1SQB J;  2JKV A;  3CIR C;  1IK9 A;  3SFD D;  3CWB J;  3Q2Y A;  3VON A;  3G6E P;  2FFD B;  1AVY A;  2YIU C;  1OW8 A;  5CJ4 A;  5KLV K;  1S9K D;  5AW5 B;  2WDQ D;  2R3S A;  5APQ A;  3S9O A;  1GW4 A;  1P84 I;  1NYH A;  1IFJ A;  1VQ8 P;  4ZMD A;  1RF1 A;  1FZF A;  1T2K C;  5APS A;  3AEF D;  1SQX E;  1JEK A;  4L76 A;  1NU1 D;  1U7J A;  3BRV B;  1BDD A;  2YIU B;  2W6J H;  4H13 B;  2E76 C;  2QVA A;  1J1E B;  4N6J A;  1GMJ A;  4Z1M H;  3CC4 P;  3L72 G;  1OVU A;  1AQT A;  3VRB D;  2OYI A;  4YTM D;  2WWW A;  2D2C D;  3H1I J;  2BS3 C;  1RH5 B;  2FBW C;  5KJ7 A;  2E42 A;  2E74 D;  3CMA P;  1NEK C;  4EOT A;  1SQP D;  4YTP D;  5BU8 B;  2WP9 D;  1HGV A;  3H1H D;  3L71 G;  5K5G B;  2SPZ A;  1K04 A;  1A02 J;  4ASW A;  4YSX D;  4OGQ C;  2P1J A;  3CCV P;  1YYC A;  1BGY E;  1UIX A;  1JUN A;  1KYO H;  1NTM G;  1HJB A;  2KSJ A;  1OFC X;  4GOE A;  5KJ7 D;  1JMB A;  3JSV C;  4WY4 B;  2PGD A;  5CMZ A;  2PFX A;  4K3A A;  1PP9 J;  3L4F A;  1RHZ B;  3Q5S A;  3RK3 D;  1ZOY C;  5KTB A;  2CPB A;  1LWU A;  2O1J A;  5KLV G;  3P8C D;  1S9K E;  3AE6 D;  4U3F D;  3B8E B;  4H44 C;  4N78 D;  1YHQ P;  1FJP A;  3H1J J;  1SFC A;  1Y8A A;  1GL2 A;  1OW6 A;  5AVX B;  1KIL D;  1M1K Q;  1SQV J;  3TGU G;  1KYO I;  3ITK A;  2W83 C;  1EDL A;  1EZV D;  3FGA D;  4N3Y B;  4D6T J;  3HE4 A;  3KXD A;  4DDG A;  2ZAE B;  3V4Q A;  2YMK A;  2NPS B;  1NU1 E;  3V2N A;  3B5N C;  3LW5 H;  1URQ B;  1RE3 C;  2B9B A;  3G3Z A;  1MFZ A;  1QEX A; 
#chains in the Genus database with same CATH homology
 3AED D;  1NEK C;  2E74 C;  4YSY D;  2H89 D;  2WS3 D;  3AEA D;  3AED C;  2WQY D;  4RKU J;  4YTP D;  4YSY C;  2H89 C;  4YXD D;  1WMK A;  3AEA C;  2WDV D;  2WP9 D;  2WQY C;  3RL0 g;  1PV3 A;  2WS3 C;  2NZ2 A;  4YTP C;  4YXD C;  2BEZ F;  4Y28 J;  2WDV C;  1KIL E;  2WP9 C;  1YQ4 D;  3ABV D;  4H0L D;  1YQ3 D;  4U7J A;  3CIR D;  1DIP A;  1FDI A;  3ABV C;  3P4Q D;  4KX6 D;  4H0L C;  2FYN C;  1S5L X;  1YQ3 C;  3CIR C;  3P4P D;  4KX6 C;  1K04 A;  3EWK A;  3SFE C;  3AE9 D;  3SFD D;  4TT3 H;  2MKV A;  1Y9B A;  4KT0 J;  4OGQ D;  3Q1M A;  3AE9 C;  3SFD C;  3G9R A;  3T97 B;  2WU5 D;  3Q2Y A;  4YSX D;  3AEG C;  4OGQ C;  4YSX C;  2QSI A;  2WU5 C;  1VL2 A;  1JB0 J;  1KF6 C;  2ZT9 B;  2G8Y A;  2YIU C;  2E75 B;  1UIX A;  1OW8 A;  3D70 A;  1U57 A;  2K9Y A;  1E7P C;  1K05 A;  1ZRT E;  4I7Z C;  3AEE C;  4PV1 B;  5L8R J;  2WDR D;  2WDR C;  1KOR A;  2WDQ D;  1HJ0 A;  3AE8 D;  4YT0 D;  3VRA D;  3Q5R A;  4H44 B;  3R4Y A;  2FXP A;  2WDQ C;  2J5U A;  3AE8 C;  3Q3D A;  3S9O A;  4YT0 C;  3VRA C;  3SFE D;  5C2T D;  2V7Q J;  3AE6 C;  3AE7 D;  1OW7 A;  1DD4 A;  1NYH A;  3AE7 C;  2WU2 D;  3AEG D;  1HF9 A;  4R4M A;  2E76 B;  3B71 A;  1KF6 D;  2WU2 C;  2E74 B;  5M1B A;  3GLM A;  2QJK C;  1MKM A;  3AE2 D;  1ZOY D;  2ZT9 D;  1NEN D;  2QIW A;  3Q5S A;  1QLB C;  1DD3 A;  3AE2 C;  1ZOY C;  2B76 D;  3VR9 D;  2QJY C;  2ZT9 C;  3AEE D;  1NEN C;  2B76 C;  2E75 C;  4GDO A;  3AEF D;  3VR9 C;  3D6Z A;  3AEC D;  1S1C X;  1ZP0 D;  2JP3 A;  1KFY D;  1VF5 B;  1R8E A;  1ZME C;  3AEF C;  3GF3 A;  3AEC C;  1ZP0 C;  3AE4 D;  1KFY C;  1RQU A;  3AE4 C;  1NGM B;  2BS4 C;  3P4R D;  4H44 D;  1EXI A;  2G3A A;  3AE6 D;  3P4R C;  1KQG B;  2OQQ A;  2WPV B;  4H44 C;  2D2C B;  3C8V A;  1AJY A;  1L0V D;  1L0V C;  2IDB A;  4H13 B;  2WSC J;  2E76 D;  1Q90 D;  1FDO A;  4I7Z B;  3D6Y A;  3P4P C;  2H88 D;  1OW6 A;  2E76 C;  3AE5 D;  3Q5P A;  2H88 C;  2E75 D;  3AE1 D;  3AE5 C;  4YTN D;  1GMJ A;  3AE1 C;  2JO1 A;  4YTN C;  4PV1 D;  4Z1M H;  1TU3 F;  1KMI Z;  5KLI C;  5C3J D;  1VF5 D;  1EXJ A;  4H0L B;  4PV1 C;  3RK3 E;  1KTM A;  4R4L A;  5C3J C;  1VF5 C;  3LW5 J;  3AE3 D;  1PL5 A;  1YQ4 C;  3FGA D;  3D71 A;  1RQV A;  3GMA A;  1IK7 A;  2BEQ D;  4IL6 X;  2WSE J;  3AE3 C;  2BS2 C;  3P4Q C;  1OMI A;  3VRB D;  1PIX A;  4YSZ D;  5C2T C;  3AEB D;  4OGQ B;  1KQF B;  4YTM D;  3VRB C;  2D2C D;  2O01 J;  4YSZ C;  2FBW D;  2YMK A;  2WSF J;  3AEB C;  4YTM C;  2BS3 C;  3H25 A;  2ACZ D;  3VR8 D;  2QJP C;  3O6Q A;  2D2C C;  2FBW C;  3P4S D;  5KKZ C;  2ACZ C;  2P10 A;  3IN6 A;  4XFJ A;  3VR8 C;  3IAO A;  4H13 D;  3P4S C;  1NEK D;  2E74 D;  3GF7 A;  4H13 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...