3AEDC

Crystal structure of porcine heart mitochondrial complex ii bound with 2-iodo-n-phenyl-benzamide
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with 2-Iodo-N-phenyl-benzamide
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 48
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3aedC01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3aedC02
3S9OA 3VRBC 1YQ3D 3AEDD 3AE2D 1QLBC 3P4SC 2FBWC 1L0VC 2WP9D 1OW6A 3AECD 3AE1C 3AE5C 1ZP0D 2WDQD 2WS3C 3AEAD 2G3AA 3SFDC 1KFYC 2WU2C 2H89D 2WDRD 2ACZD 4YTPD 3AE3C 5C3JD 4YTMD 3AE6C 2WDVD 1YQ4D 4YSYC 3AEGC 4YSXC 3P4PC 5C2TC 1ZOYC 3P4QC 4YT0C 2WQYC 1KF6C 3VRBD 2BS3C 4KX6C 3AEEC 1OW8A 4YTNC 1NENC 3P4RC 3P4SD 2FBWD 1PV3A 1L0VD 1NEKC 3VR8C 3AE7C 2B76C 1OW7A 3AE1D 3VR9C 3CIRC 3VRAC 3AE5D 2WS3D 3SFDD 1KFYD 2WU2D 3AEFC 2WU5C 3AE3D 3AE8C 3AE6D 1KTMA 3AE9C 4YSYD 3AEGD 4YSXD 4YXDC 3P4PD 3AEBC 1ZOYD 5C2TD 3P4QD 3AEBD 4YT0D 1KF6D 2WQYD 4KX6D 3AEED 4YTND 3B71A 3AE4C 1NEND 3P4RD 4YSZC 1E7PC 1NEKD 3ABVC 3VR8D 3AE7D 3ABVD 2H88C 3SFEC 2B76D 3VR9D 3CIRD 3VRAD 1YQ3C 3AEDC 3AE2C 1K05A 3AEFD 2WU5D 3AE8D 2WP9C 3AE9D 1K04A 3AECC 4YXDD 2WDQC 1ZP0C 3AEAC 3AE4D 4YSZD 2BS4C 2H89C 2WDRC 2ACZC 2BS2C 4YTPC 2H88D 3SFED 5C3JC 4YTMC 2WDVC 1YQ4C
chains in the Genus database with same CATH superfamily
2FXMA 1JCDA 1M1JC 1KILA 2R5BA 1NOHA 1SQVD 2OYOA 1Q82Q 1DEEG 2KP8A 3M9QA 1H0TB 5APWA 3WMM0 3AE1C 4WB4A 1EDLA 3M0DC 1YTZI 2YNYA 3A5TA 3RL0C 2QM7A 1RF1C 1YTZT 1USDA 3RL0g 1MKMA 2ZXEB 2W90A 1KB9D 2Y9YA 1L0VD 1GDTA 3EQ2A 1KB9H 2SPZA 1SQBG 1K8AQ 3HE4A 3Q2YA 1Q7YQ 1HJBA 2OARA 3LIEA 3AE8C 2Y9ZA 1QVGO 1K73Q 1N7SA 1RF1A 4CPGA 1NU1G 1M8OB 2N9YB 4YTND 3IF4A 5L8RJ 3VR8D 4W7ZA 3ABVD 1BE3D 1OVUA 4KJMA 1PGJA 1KZUB 2QJPC 1IFPA 5AVUB 3KZIE 1SQXE 2ZT9C 3CI9A 1FDOA 4D6TD 5B66E 3AE9D 2W6AA 3VMZA 2JEEA 1L0LE 5AVTB 4DJGA 2I1KA 5E79H 4YTPC 4K35A 2WDVC 1A02J 1SQVJ 2HFED 5CBNA 2K9JA 3H1IE 1N73A 3AE2D 3SWKA 1SQBK 1UIIA 2E75B 3E7KA 3H1LD 2FFDC 3IAOA 4C7NA 2G3AA 3SFDC 2KI7B 1G1IA 3VMXA 2M3BA 1P84I 1S5LH 2JWAA 3L74J 2QJYB 4DCKA 1NU1K 4ZNCA 3JCUE 1VQ6P 4H44D 2YXRB 3V2QA 2BCCG 2KZJA 3L72E 4UB6E 3RK2D 3CWBG 2B76C 1OW7A 1QL2A 1BDCA 3Q1MA 4PV1C 3L71J 1HGZA 1KTMA 4B86A 3L70E 2QEXP 3E1IA 1ZOYD 4EIJA 3M9HA 3D71A 4EI2A 2OTKE 4ZMDA 3TGUD 4RESB 3H1JG 1EDIA 5CCHC 1LTBC 2A45H 1NTZE 2WP9C 1G2CA 4XFJA 4W80A 2WDQC 2A06E 4YSZD 2C0WA 3H1KD 3M0AA 4YTMC 1PZQA 3CX5D 3V6IA 1NKNA 2AEMA 5KLIC 3CX5H 5GTIH 5CCHA 5KAIE 1YQ3D 2OYIC 3H1LJ 1KYOD 3OW2O 1KYOH 3LW5H 2WU2C 3L4FA 1M7LA 1QX8A 1SQQG 2BEQD 1KB9E 3T97B 3CCQP 2Q6QA 2KB7P 2QSIA 3G9RA 1NTKG 2QVAA 4LGDE 1VQPP 1BGYD 3WUUA 3AE7C 2FYUD 2KZIA 3BCCG 1SP4A 2ZFCA 3GMAA 4NPDA 2WPRA 1SFCB 1AJYA 4N78D 1NAFA 1VL2A 1HWTC 1VQMP 2YXQB 1BE3E 2M5AB 3L36A 1FZCC 1L0NE 1H0TA 5TISE 3ABVC 2JWDA 1YJ9P 1CI6A 1FJPA 2FYZA 3MHVA 4D6TE 2IBZD 3HUSA 1RH5B 3H1IG 4ASWA 5CBOA 1OIPA 2AEJA 4L75A 2WSFH 3H1KJ 3KPEA 3D6ZA 1SQQK 1SQBJ 2H88D 3C8VA 4MN4C 3CXHE 3G3ZA 3P4SC 1EZVD 3A7OA 1HH0A 3Q3DA 1CZQA 5GTHE 1AVYA 1SQXK 1PFIA 4OWFA 3P8CD 3L70G 3GLMA 1WT6A 2W8ZA 4ZKPA 5APTA 5H2FH 4U3FE 3AE1D 3TF5A 3EFGA 1OX3A 3CIRC 3LIDA 3RL0B 4DHJA 1URQB 1GK4A 3RL0D 5KTBA 2LR2A 2PP6A 1GU5A 4YXDC 5CMZA 2O01N 3TGUE 3C1LA 3PJSK 1EQ7A 1NJIQ 3UIAA 1PP9J 3RBZA 1SQVG 1L2PA 1GK6A 3HD7B 1GMJA 1RQUA 3CCRP 1BCCE 3H32B 3AE8D 4Y28J 1HJ0A 4I7ZC 1S9KE 1PPJG 1EXIA 2WT7A 4I1LA 2YKQA 4ZKUA 2O01J 4H0LB 2FYNC 5BVZA 1N7LA 4H13C 4C7RA 2KLUA 1LT1A 3JSVC 3B5NC 2Q7CA 2QJKC 1KYOE 2NPSA 2W6JH 1QEXA 1JEKA 3CMEP 2IZ0A 2Z4EA 2ZT9D 1PGPA 1WMKA 2PGDA 1NVOA 1VF5B 2HYNA 3AE5C 1LTJC 1KFYC 2O3JA 2R5DA 3CCSP 4YTPD 1L0LD 3B5NA 2WDVD 1BGYE 5CCGA 3L75D 1GTWA 1BSHA 2JKVA 1FC2C 1KQFB 1VQOP 1JY2P 4N78E 5KLVE 3WU2E 2FFDB 2H7HA 1SQVK 4Y99B 4DHZA 1LTJA 3SFDD 1W2EA 1USEA 4HYTB 3R2PA 3U1AA 1YHQP 1JTHA 4DDIA 3MZWB 1JM0A 4BRYB 1KQGB 2XZRA 1JY2N 2Y0EA 2B76D 1ZR2A 1Q90D 4PV1D 3L72D 2OQQA 1VDFA 1LT9B 1FZEA 3A0BH 3H1LG 5AVWB 1DD4A 1LTAC 1ZP0C 3QH9A 3CC7P 1KILE 1Q86Q 1FDIA 3BATA 5DJUB 2FXPA 1JCCA 1YYCA 1KILC 5CCHD 3VRBC 2N1TB 1SQXJ 2WP9D 2Q3IA 1KV4A 2M5AA 1FU1A 2CK3H 1NTZD 1L0LJ 1ZN5A 2IYPA 2WDQD 1R8EA 1GD2E 4YTMD 4OGQC 1LNQA 2A06D 3CCEP 2OYHC 3SWFA 3KHUA 3P4PC 3H1IJ 2J5UA 3QWOC 1ZMEC 3OAKA 2HPCB 5KAIH 4JF7A 3VRAC 2WU2D 4XA4A 2C9LY 1PIXA 1TU3F 2KS1A 1LJ2A 1N7SC 2D2CC 2OYHA 1NTME 3H1KG 4PD4E 1E7PC 3AE7D 5K5GB 3L72J 2WSEH 3A3YB 4GOFA 1J1DC 3AEDC 3OA7A 1M56D 1OWAA 1KQSO 3VMYA 3L70J 2HLOA 3GHGB 2GUSA 3USSA 2G8YA 2R3CA 2H89C 2KXPB 3V5BA 1LWUA 3TNUB 1L0ND 1DH3A 2FYUG 5M1BA 1AQ5A 5TISH 1N73C 4TT3H 1L4AA 1NTZJ 4WBAA 2QRXA 2WSCH 1HVVA 2WS3C 1T6AA 3L75E 2WTYA 4DDGA 4LLHA 3AE6C 3VMAA 2K1AA 3HD7A 3HTKB 4HH2A 2IBZG 4IFFA 3P4SD 3CD6P 1PP9G 3A0HH 3O6QB 4BWNA 3VR9C 2CPSA 3SWYA 3CXHD 3CXHH 1JUNA 2DW3A 3Q5RA 2WU5C 2YIUB 2KLVA 4H44B 5GTHH 3MTUE 1IFDA 3RK2B 3GG2A 3HE5A 2E76C 3A0BE 5KJ7A 3NMDA 3ZDMA 3VP9A 3CIRD 2FYUK 1EZVG 2KIKA 2I1JA 4U3FD 3ITKA 1ZRTE 1SQPE 3BRVB 4YXDD 1BE3J 3RK3E 3N4XA 3TSIA 1L0NJ 3IFMA 2ZYDA 2BS4C 1P84H 2ACZC 3RK3C 3VONA 1GL2C 1KMIZ 4UB8H 4KT0J 4D6TJ 1LTTC 2WSCJ 1MUUA 1ZXGA 2AXTH 1IFNA 5CHXA 1NGMB 2Q1KA 3M91A 4H13B 1T3JA 1BCCD 1S9KD 3CL3D 1WRGA 2QJKB 4H13D 5CJ4A 1GL2A 3AE3C 3B5ND 4YSXC 2P1JA 1RF0C 1LT9A 2P58A 3AEEC 4WY4C 3Q5SA 1MV8A 1M57D 1NH4A 3Q5PA 1Y8AA 2MJZA 3AE5D 2V7QH 2XDJA 5AW5B 2XNDH 3VYIA 1KFYD 2LKMA 1FZBA 3E1RA 1RF0A 1JOCA 2N1TA 1JNMA 2Y0DA 4WY4A 3U59A 3IN6A 1S1CX 4JQ0D 3SFEC 3L74E 3HUSC 5KLVD 2GA1A 1S3JA 2IBZI 4JBZA 3WU2H 1SQXG 4KHXA 2FY8A 2POHA 1L0LG 2WZ7A 3R4YA 1H8AA 3TGUJ 2J59M 2K88A 3VOPA 3BASA 3L71E 2I8DA 1RQVA 5AW7B 5C3JC 4IL6E 1Q81Q 1NAYA 4AYCA 1BCCJ 2Z5IA 4GDOA 3V4WA 1S72P 1EZVI 3H1HE 1HF9A 1ZP0D 2P7JA 1E5WA 1DD3A 2P10A 1KILB 3A0HE 4YSYC 5APUA 4GIFA 4GODA 5C2TC 3M06A 1KILD 1SS1A 3VRBD 4EOTA 4KX6C 3LW5J 3L35A 2IYOA 1NKZB 2WPVB 3L72G 2PRRA 3CCMP 5AW6B 4M3LA 4AQRD 2PFXA 2KNCB 2Q3EA 1ZR4A 2BCCD 2LXCB 3GW6A 3AEFC 3TNUA 1M1JB 3OJAB 4OGQD 1JMBA 1BGYJ 2JJLA 2FYUJ 1L0LK 3P4PD 1VQ8P 1IFJA 1VQKP 2E75C 3HE4B 3MUDA 2N9BA 1LTGC 1JY3P 4OVNF 2Q5UA 3I55P 3PRJA 3CMAP 3VRAD 3V4QA 3O8ZA 1N7SB 1RF1B 2QJYC 1NTZG 1P84E 1OVVA 1N7SD 2D2CD 2RN0A 3FGAD 3V2RA 3AECC 3HTKA 4UB8E 1LP1B 3AEAC 2A06G 3L73E 3O6QA 1NTMD 2AXTE 2WDRC 4PD4D 4RKUJ 4I6LA 3F89A 4PD4H 2WSFJ 1JO5A 1FZFA 2OGUA 2NPSC 3BRTB 3C9IA 1JY3N 4DOJA 5AVYB 1M90Q 3AEDD 2O1KA 3B4SA 4JYCA 1MFTA 1FOSE 3VN0A 3TYYA 2QJPB 2H89D 1RE4A 2K9JB 2W6BA 2JO1A 5CCGC 2QE7H 1H89A 2ZT9B 1FJKA 4ASVA 1KF6C 2BS3C 1NENC 2YKPA 5AVVB 4NPEA 5KAFE 3G6EP 4C7NB 5APXA 1SQBE 4IL6X 1NTKD 2WS3D 1DX7A 1PL5A 2K3RA 1NTZK 2BASA 1HBWA 2YO2A 3P7KA 1MFZA 3BCCD 3TK1A 3AE6D 1LGHB 2B9BA 1BE3G 1RHZB 1NU1E 1G1JA 4JYBA 1L0NG 4W7YA 1KORA 3CC4P 1IJDB 3VR9D 4D6TG 5BU5A 4L73A 3BVHA 2HG5D 3M9BA 5APYA 3FXEA 2FXOA 1FAVA 2VRSA 2WU5D 1DEBA 1TFFA 1OZHA 1NTMJ 2C9NY 2BEZF 3F5HA 5AVRB 2E76D 3H25A 4XE5B 4PV1B 1FDMA 2YO3A 1JY2O 3V2PA 1YQ4C 1SFCC 2ITAA 2CPBA 3T97A 3NTNA 1QLBC 2FBWC 1G2CB 1AVOA 3JC22 4N3YB 3VTPC 3H6PA 3RK3B 1ZRTD 1SQPD 2OTJP 2ACZD 3RK3D 1GL2D 3SSUA 1SFCA 1Y9BA 4U7JA 5CJ0A 1JB0J 3AEGC 4I2LC 5B5EE 1MZ9A 1H88A 3P4QC 4YT0C 2WQYC 1L0NK 1K9MQ 1U7MA 4FJVA 1GU4A 1YJNP 2BCCE 4U3FG 3RGUA 3CWBE 3D6YA 5C39A 2AEFA 3L75J 5KLIB 3AE3D 2K37A 3L37A 2OYIB 5AVZB 4YSXD 1IFIA 2JP3A 2W83C 3TGUG 1KQLA 2J58A 1FBMA 3AEED 4WY4D 1QL1A 4PJ0E 2Z5HA 5AW2B 2H43A 2A45G 1KB9I 2RMZA 2IPPA 2B87B 2YMKA 1J1EC 3H1JE 4R4MA 2UWJE 1GW4A 1W2BO 1X0TA 3MP7B 3KYQA 1BCCG 4GT1A 1VQNP 1CI6B 1QGKB 2ZYGA 1FOSF 5KKZC 1PPJD 2B89A 2IX7C 3HUSB 1LWUC 3SFED 1IC2A 2KNCA 3I5CA 1X9VA 2M8RA 1LTSC 1URQC 2V4HA 1M1JA 3L74D 1L4AC 4EYYQ 2KUBA 1FZCB 1SQPJ 3KXDA 3KQGA 3FWNA 1E79H 3K5BA 3M0DA 1OVRA 1KC8Q 1SQQE 5C3JD 1BGYG 3HD7C 2ZVNB 3NXSA 5AW3B 3L71D 4L74A 5AVXB 1URQA 1NTKE 1N2DC 3W67A 3CLQA 1NEKC 1IZNB 5KLVG 2ZFYA 4IL6H 1IK9A 2WWWA 4H0LC 1LP1A 3CCVP 3BCCE 1IFMA 1NYHA 3A2AA 3CXHI 2K9YA 1HUCA 3H1HD 4NPFX 4YSYD 2XNXA 5C2TD 2Q9IA 3H32A 3AEBD 3GF3A 4KX6D 3MIWA 3AE4C 3IR9A 5KJ7C 4AUWA 1VF5C 2AXCA 2FKWB 2HODB 2M0BA 2E74C 3I56P 1PGOA 4JPZB 3AEFD 1YBKA 5AVQB 2JR8A 2WSEJ 1SVFA 2E75D 1S2EA 1VQ5P 3VP8A 4HB1A 4Y99C 1R5SA 2BS2C 3S9OA 1EXJA 3EWKA 2OTLP 4IFDK 2WT7B 1GZLA 1NWQA 1QLED 2A45I 5KLVK 3WUVA 1Z56A 3AECD 1JMMA 1P84D 2FFDA 3AEAD 2WDRD 1LTIC 2NPSB 1KFMA 2WMMA 4K3AA 3PLNA 4QMAA 3L73D 4DHIB 2NPSD 1LT9C 3CX5I 4BXLA 4I7ZB 1FE6A 2B88A 1KFNA 2LXBA 3P4RC 4O9BA 2FYNB 4BRYA 1KYOI 1RY3A 4Z1MH 5BU8B 4IFMA 2WPQA 3H1HJ 5DJTB 3B5NB 3G71P 5CCGD 5AW4B 1NTMG 2N1TC 3CPWO 1KF6D 1QVFO 3B71A 1NEND 1T2KC 4DT0A 1LTJB 1SQVE 5AW9B 5AW1B 3TDKA 1JTHB 1SQBD 1VQ9P 1ZW0A 5KAFH 1VQ4P 2R44A 2ZXXA 2QIWA 1PPJE 1K04A 5AVSB 1EDKA 1AFOA 4HKZH 4U3FJ 3PHLA 4IOIH 2L5GB 1NU1D 1Y47A 2QA4P 2OYIA 2GM4A 1N86A 1L0VC 5TJHA 1OW6A 1XTGB 4A7PA 1VQLP 2E43A 2E42A 2JDIH 3L75G 3L73J 2HPCA 1FS0E 2B87A 3S4RA 4DZOA 1OFCX 1NTMK 1S4XA 1YQ4D 1SFCD 3W68A 2KOGA 3CC2P 2E5YA 1KN7A 2WPSA 1OW8A 4YTNC 5APQA 2FBWD 3VR8C 3II6A 1Q2NA 3GHGC 5AW0B 3FWLA 1PP9D 1OMIA 2NRGA 5E79E 3AE9C 3MGNA 3AEGD 2PAJA 3KDPB 3AEBC 1NHLA 3P4QD 1ZLLA 4YT0D 2WQYD 2V7QJ 2HR3A 3MUDC 1RE3C 1FZCA 1PGQA 1M1KQ 3GHGA 1T3UA 5B5EH 1EDJA 2NZ2A 4EDFA 4GKGA 2O01H 3P8MC 2MKVA 4OGQB 2KS1B 1NTKK 1X79B 3CWBD 2OYHB 3AE2C 2XV5A 1K05A 3H1LE 3S1KA 3FXDA 1S5LE 2ZVOB 2W27A 1SQPG 4TLFA 1KD1Q 1NU1J 2P2UA 1EC5A 2ZJSE 1RE3A 4L76A 3PP5A 5KLVJ 1J1EB 2H8PD 1OXZA 2WVRA 5APVA 4PD4I 4HJGH 4PJ0H 1YI2P 2D2CB 2YIUC 2YMYA 1VPCA 1DIPA 4H44C 2QM8A 2RH0A 2L91A 3H1JD 3RBXA 3RK2C 3PTZA 4N6JA 2P67A 5KKZB 1N8RQ 3D70A 1LWUB 2HODA 1RE4C 2WSSH 2IZ1A 2KYVA 1UIXA 1J1DB 4LDTA 1L4AB 2E5TA 1W5CE 1AQTA 1ZOYC 1JY3O 1URQD 1U7JA 1L4AD 3NFQA 3U1CA 2R3SA 2GUVA 1AV1A 3EFFK 2ZYAA 1BSNA 2Y0CA 3B8EB 1A02F 3WUTA 2IFNA 1T8ZA 5EFWB 1N73B 1SQPK 4RJTA 3HD7D 2KSJA 3H1KE 1IO4A 2O1JA 1XTCC 1SQQD 3CX5E 3CCJP 1YJWP 5GTIE 3G4SP 1GW3A 4YSZC 1NEKD 1VQ7P 2BCCJ 3CWBJ 4H0LD 3L74G 2XU6A 3GF7A 2C0XA 1YQ3C 4OH8B 3N7NA 2IFMA 3HE5B 1CSBA 3V2NA 2YKOA 3KZIH 1SQXD 3AE4D 1CW5A 5KJ7D 2E74B 3L71G 1VF5D 5B66H 4RO0A 3CCLP 2XKMA 2E74D 3H1JJ 1BDDA 2FYUE 3P32A 3MD0A 2KSEA 4LC1A 2RKLA 1YIJP 1J2JB 4GOEA 2E76B 2KK7A 3H1ID 1X22A 3H1HG 3FX0A 4I6MC 1NO4A 1U57A 3CCUP 1S5LX 4WVZA 2WITA 1HGVA 2IBZE 1PV3A 2QG4A 1PP9E 3JCUH 1GL2B 5APSA 1FZAA 1D7MA 2IDBA 4UB6H 1SQQJ 1YITP 4YXWH 3PH0A 1NTKJ 3P4RD 4YPCA 3HRNA 2H88C 3L70D 1ZV8A 5AW8B 4R4LA 3BCCJ 1FZGA 1EZVE 4C46A 1R5LA 2R32A 4WY4B 4WWIA 1HTLC 2N1TD 1IK7A 1AA0A 3L73G 3P8CE 1X8YA 2M3EA 1T2KD 2ZAEB 1SLQA 5H2FE
chains in the Genus database with same CATH topology
2QJKC 4KT0J 5KLIC 3S9OA 2WSFJ 3EWKA 1FDIA 1EXJA 3C8VA 2FXPA 5M1BA 2WSCJ 2D2CB 2YIUC 1DIPA 3VRBC 1YQ3D 3AEDD 4H44C 4TT3H 3AE2D 1QLBC 3P4SC 2FBWC 2ZT9D 1L0VC 1NGMB 2WP9D 2E75B 1OW6A 4GDOA 3Q3DA 3AECD 1WMKA 2E76B 3AE1C 1VF5B 3D70A 4H13B 3IAOA 3AE5C 1HF9A 1ZP0D 2WDQD 2WS3C 2G3AA 3AEAD 3SFDC 1KFYC 2WU2C 1U57A 2H89D 2WDRD 1R8EA 4H13D 2ACZD 4YSZD 1UIXA 1S5LX 1DD3A 2P10A 4YTPD 2BEQD 3AE3C 5C3JD 3AE6C 4OGQC 3T97B 4YTMD 2WDVD 1Y9BA 2JO1A 3G9RA 2QSIA 1YQ4D 4U7JA 4YSYC 1JB0J 3AEGC 4YSXC 2ZT9B 3P4PC 5C2TC 1ZOYC 3P4QC 4I7ZB 4YT0C 3GLMA 2WQYC 1KQFB 3RL0g 1KF6C 1MKMA 4H44D 2J5UA 2BS3C 3AEEC 1OW8A 3LW5J 4KX6C 4YTNC 1NENC 3P4RC 3P4SD 2FBWD 1PV3A 1ZMEC 1L0VD 1NEKC 3VR8C 2WPVB 3AE7C 4IL6X 3Q5SA 4H0LC 1OW7A 3D6YA 2B76C 3Q2YA 3AE1D 4Z1MH 3VR9C 3Q1MA 3CIRC 3Q5PA 3VRAC 3AE5D 2WS3D 3GMAA 4PV1C 1NYHA 1PL5A 3SFDD 1AJYA 1KFYD 2WU2D 2IDBA 1PIXA 1OMIA 2K9YA 3Q5RA 3AEFC 1TU3F 2WU5C 1VL2A 3AE3D 3AE8C 4OGQD 3AE6D 4H44B 3AE9C 1KTMA 2D2CC 4YSYD 3AEGD 4YSXD 2JP3A 4YXDC 3P4PD 3AEBC 1ZOYD 5C2TD 3P4QD 1KQGB 3AEBD 4YT0D 1KF6D 2WQYD 3GF3A 4KX6D 2E75C 2V7QJ 3AEED 4YTND 3B71A 3AE4C 3D71A 1NEND 5L8RJ 3IN6A 1E7PC 3P4RD 2E76C 1S1CX 1KORA 3ABVC 1NEKD 3VR8D 1VF5C 3AE7D 3ABVD 2H88C 3SFEC 4H0LD 2B76D 2NZ2A 4RKUJ 2E74C 2YMKA 4R4LA 3VR9D 4YSZC 2QJPC 3CIRD 3VRAD 3GF7A 4R4MA 2MKVA 4OGQB 1Q90D 4PV1D 2OQQA 1GMJA 1YQ3C 3AEDC 3AE2C 1K05A 2QJYC 1RQUA 3AEFD 2ZT9C 1DD4A 2WU5D 1FDOA 3AE8D 2QIWA 1ZRTE 2WP9C 4Y28J 3AE9D 1HJ0A 4I7ZC 2D2CD 3FGAD 1EXIA 1K04A 3AECC 4YXDD 2WSEJ 3RK3E 1IK7A 2O01J 4XFJA 3R4YA 4H0LB 2FYNC 1ZP0C 2E75D 3AEAC 2WDQC 2BEZF 2G8YA 3AE4D 3D6ZA 3O6QA 5KKZC 3H25A 2E74B 2E76D 2H89C 2BS4C 4H13C 2ACZC 1VF5D 2WDRC 3VRBD 2BS2C 4PV1B 1KILE 1RQVA 4YTPC 2H88D 3SFED 5C3JC 4YTMC 1KMIZ 2WDVC 1YQ4C 2E74D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S9O A;  3VRB C;  1YQ3 D;  3AED D;  3AE2 D;  1QLB C;  3P4S C;  2FBW C;  1L0V C;  2WP9 D;  1OW6 A;  3AEC D;  3AE1 C;  3AE5 C;  1ZP0 D;  2WDQ D;  2WS3 C;  3AEA D;  2G3A A;  3SFD C;  1KFY C;  2WU2 C;  2H89 D;  2WDR D;  2ACZ D;  4YTP D;  3AE3 C;  5C3J D;  4YTM D;  3AE6 C;  2WDV D;  1YQ4 D;  4YSY C;  3AEG C;  4YSX C;  3P4P C;  5C2T C;  1ZOY C;  3P4Q C;  4YT0 C;  2WQY C;  1KF6 C;  3VRB D;  2BS3 C;  4KX6 C;  3AEE C;  1OW8 A;  4YTN C;  1NEN C;  3P4R C;  3P4S D;  2FBW D;  1PV3 A;  1L0V D;  1NEK C;  3VR8 C;  3AE7 C;  2B76 C;  1OW7 A;  3AE1 D;  3VR9 C;  3CIR C;  3VRA C;  3AE5 D;  2WS3 D;  3SFD D;  1KFY D;  2WU2 D;  3AEF C;  2WU5 C;  3AE3 D;  3AE8 C;  3AE6 D;  1KTM A;  3AE9 C;  4YSY D;  3AEG D;  4YSX D;  4YXD C;  3P4P D;  3AEB C;  1ZOY D;  5C2T D;  3P4Q D;  3AEB D;  4YT0 D;  1KF6 D;  2WQY D;  4KX6 D;  3AEE D;  4YTN D;  3B71 A;  3AE4 C;  1NEN D;  3P4R D;  4YSZ C;  1E7P C;  1NEK D;  3ABV C;  3VR8 D;  3AE7 D;  3ABV D;  2H88 C;  3SFE C;  2B76 D;  3VR9 D;  3CIR D;  3VRA D;  1YQ3 C;  3AED C;  3AE2 C;  1K05 A;  3AEF D;  2WU5 D;  3AE8 D;  2WP9 C;  3AE9 D;  1K04 A;  3AEC C;  4YXD D;  2WDQ C;  1ZP0 C;  3AEA C;  3AE4 D;  4YSZ D;  2BS4 C;  2H89 C;  2WDR C;  2ACZ C;  2BS2 C;  4YTP C;  2H88 D;  3SFE D;  5C3J C;  4YTM C;  2WDV C;  1YQ4 C; 
#chains in the Genus database with same CATH topology
 2FXM A;  1JCD A;  1M1J C;  1KIL A;  2R5B A;  1NOH A;  1SQV D;  2OYO A;  1Q82 Q;  1DEE G;  2KP8 A;  3M9Q A;  1H0T B;  5APW A;  3WMM 0;  3AE1 C;  4WB4 A;  1EDL A;  3M0D C;  1YTZ I;  2YNY A;  3A5T A;  3RL0 C;  2QM7 A;  1RF1 C;  1YTZ T;  1USD A;  3RL0 g;  1MKM A;  2ZXE B;  2W90 A;  1KB9 D;  2Y9Y A;  1L0V D;  1GDT A;  3EQ2 A;  1KB9 H;  2SPZ A;  1SQB G;  1K8A Q;  3HE4 A;  3Q2Y A;  1Q7Y Q;  1HJB A;  2OAR A;  3LIE A;  3AE8 C;  2Y9Z A;  1QVG O;  1K73 Q;  1N7S A;  1RF1 A;  4CPG A;  1NU1 G;  1M8O B;  2N9Y B;  4YTN D;  3IF4 A;  5L8R J;  3VR8 D;  4W7Z A;  3ABV D;  1BE3 D;  1OVU A;  4KJM A;  1PGJ A;  1KZU B;  2QJP C;  1IFP A;  5AVU B;  3KZI E;  1SQX E;  2ZT9 C;  3CI9 A;  1FDO A;  4D6T D;  5B66 E;  3AE9 D;  2W6A A;  3VMZ A;  2JEE A;  1L0L E;  5AVT B;  4DJG A;  2I1K A;  5E79 H;  4YTP C;  4K35 A;  2WDV C;  1A02 J;  1SQV J;  2HFE D;  5CBN A;  2K9J A;  3H1I E;  1N73 A;  3AE2 D;  3SWK A;  1SQB K;  1UII A;  2E75 B;  3E7K A;  3H1L D;  2FFD C;  3IAO A;  4C7N A;  2G3A A;  3SFD C;  2KI7 B;  1G1I A;  3VMX A;  2M3B A;  1P84 I;  1S5L H;  2JWA A;  3L74 J;  2QJY B;  4DCK A;  1NU1 K;  4ZNC A;  3JCU E;  1VQ6 P;  4H44 D;  2YXR B;  3V2Q A;  2BCC G;  2KZJ A;  3L72 E;  4UB6 E;  3RK2 D;  3CWB G;  2B76 C;  1OW7 A;  1QL2 A;  1BDC A;  3Q1M A;  4PV1 C;  3L71 J;  1HGZ A;  1KTM A;  4B86 A;  3L70 E;  2QEX P;  3E1I A;  1ZOY D;  4EIJ A;  3M9H A;  3D71 A;  4EI2 A;  2OTK E;  4ZMD A;  3TGU D;  4RES B;  3H1J G;  1EDI A;  5CCH C;  1LTB C;  2A45 H;  1NTZ E;  2WP9 C;  1G2C A;  4XFJ A;  4W80 A;  2WDQ C;  2A06 E;  4YSZ D;  2C0W A;  3H1K D;  3M0A A;  4YTM C;  1PZQ A;  3CX5 D;  3V6I A;  1NKN A;  2AEM A;  5KLI C;  3CX5 H;  5GTI H;  5CCH A;  5KAI E;  1YQ3 D;  2OYI C;  3H1L J;  1KYO D;  3OW2 O;  1KYO H;  3LW5 H;  2WU2 C;  3L4F A;  1M7L A;  1QX8 A;  1SQQ G;  2BEQ D;  1KB9 E;  3T97 B;  3CCQ P;  2Q6Q A;  2KB7 P;  2QSI A;  3G9R A;  1NTK G;  2QVA A;  4LGD E;  1VQP P;  1BGY D;  3WUU A;  3AE7 C;  2FYU D;  2KZI A;  3BCC G;  1SP4 A;  2ZFC A;  3GMA A;  4NPD A;  2WPR A;  1SFC B;  1AJY A;  4N78 D;  1NAF A;  1VL2 A;  1HWT C;  1VQM P;  2YXQ B;  1BE3 E;  2M5A B;  3L36 A;  1FZC C;  1L0N E;  1H0T A;  5TIS E;  3ABV C;  2JWD A;  1YJ9 P;  1CI6 A;  1FJP A;  2FYZ A;  3MHV A;  4D6T E;  2IBZ D;  3HUS A;  1RH5 B;  3H1I G;  4ASW A;  5CBO A;  1OIP A;  2AEJ A;  4L75 A;  2WSF H;  3H1K J;  3KPE A;  3D6Z A;  1SQQ K;  1SQB J;  2H88 D;  3C8V A;  4MN4 C;  3CXH E;  3G3Z A;  3P4S C;  1EZV D;  3A7O A;  1HH0 A;  3Q3D A;  1CZQ A;  5GTH E;  1AVY A;  1SQX K;  1PFI A;  4OWF A;  3P8C D;  3L70 G;  3GLM A;  1WT6 A;  2W8Z A;  4ZKP A;  5APT A;  5H2F H;  4U3F E;  3AE1 D;  3TF5 A;  3EFG A;  1OX3 A;  3CIR C;  3LID A;  3RL0 B;  4DHJ A;  1URQ B;  1GK4 A;  3RL0 D;  5KTB A;  2LR2 A;  2PP6 A;  1GU5 A;  4YXD C;  5CMZ A;  2O01 N;  3TGU E;  3C1L A;  3PJS K;  1EQ7 A;  1NJI Q;  3UIA A;  1PP9 J;  3RBZ A;  1SQV G;  1L2P A;  1GK6 A;  3HD7 B;  1GMJ A;  1RQU A;  3CCR P;  1BCC E;  3H32 B;  3AE8 D;  4Y28 J;  1HJ0 A;  4I7Z C;  1S9K E;  1PPJ G;  1EXI A;  2WT7 A;  4I1L A;  2YKQ A;  4ZKU A;  2O01 J;  4H0L B;  2FYN C;  5BVZ A;  1N7L A;  4H13 C;  4C7R A;  2KLU A;  1LT1 A;  3JSV C;  3B5N C;  2Q7C A;  2QJK C;  1KYO E;  2NPS A;  2W6J H;  1QEX A;  1JEK A;  3CME P;  2IZ0 A;  2Z4E A;  2ZT9 D;  1PGP A;  1WMK A;  2PGD A;  1NVO A;  1VF5 B;  2HYN A;  3AE5 C;  1LTJ C;  1KFY C;  2O3J A;  2R5D A;  3CCS P;  4YTP D;  1L0L D;  3B5N A;  2WDV D;  1BGY E;  5CCG A;  3L75 D;  1GTW A;  1BSH A;  2JKV A;  1FC2 C;  1KQF B;  1VQO P;  1JY2 P;  4N78 E;  5KLV E;  3WU2 E;  2FFD B;  2H7H A;  1SQV K;  4Y99 B;  4DHZ A;  1LTJ A;  3SFD D;  1W2E A;  1USE A;  4HYT B;  3R2P A;  3U1A A;  1YHQ P;  1JTH A;  4DDI A;  3MZW B;  1JM0 A;  4BRY B;  1KQG B;  2XZR A;  1JY2 N;  2Y0E A;  2B76 D;  1ZR2 A;  1Q90 D;  4PV1 D;  3L72 D;  2OQQ A;  1VDF A;  1LT9 B;  1FZE A;  3A0B H;  3H1L G;  5AVW B;  1DD4 A;  1LTA C;  1ZP0 C;  3QH9 A;  3CC7 P;  1KIL E;  1Q86 Q;  1FDI A;  3BAT A;  5DJU B;  2FXP A;  1JCC A;  1YYC A;  1KIL C;  5CCH D;  3VRB C;  2N1T B;  1SQX J;  2WP9 D;  2Q3I A;  1KV4 A;  2M5A A;  1FU1 A;  2CK3 H;  1NTZ D;  1L0L J;  1ZN5 A;  2IYP A;  2WDQ D;  1R8E A;  1GD2 E;  4YTM D;  4OGQ C;  1LNQ A;  2A06 D;  3CCE P;  2OYH C;  3SWF A;  3KHU A;  3P4P C;  3H1I J;  2J5U A;  3QWO C;  1ZME C;  3OAK A;  2HPC B;  5KAI H;  4JF7 A;  3VRA C;  2WU2 D;  4XA4 A;  2C9L Y;  1PIX A;  1TU3 F;  2KS1 A;  1LJ2 A;  1N7S C;  2D2C C;  2OYH A;  1NTM E;  3H1K G;  4PD4 E;  1E7P C;  3AE7 D;  5K5G B;  3L72 J;  2WSE H;  3A3Y B;  4GOF A;  1J1D C;  3AED C;  3OA7 A;  1M56 D;  1OWA A;  1KQS O;  3VMY A;  3L70 J;  2HLO A;  3GHG B;  2GUS A;  3USS A;  2G8Y A;  2R3C A;  2H89 C;  2KXP B;  3V5B A;  1LWU A;  3TNU B;  1L0N D;  1DH3 A;  2FYU G;  5M1B A;  1AQ5 A;  5TIS H;  1N73 C;  4TT3 H;  1L4A A;  1NTZ J;  4WBA A;  2QRX A;  2WSC H;  1HVV A;  2WS3 C;  1T6A A;  3L75 E;  2WTY A;  4DDG A;  4LLH A;  3AE6 C;  3VMA A;  2K1A A;  3HD7 A;  3HTK B;  4HH2 A;  2IBZ G;  4IFF A;  3P4S D;  3CD6 P;  1PP9 G;  3A0H H;  3O6Q B;  4BWN A;  3VR9 C;  2CPS A;  3SWY A;  3CXH D;  3CXH H;  1JUN A;  2DW3 A;  3Q5R A;  2WU5 C;  2YIU B;  2KLV A;  4H44 B;  5GTH H;  3MTU E;  1IFD A;  3RK2 B;  3GG2 A;  3HE5 A;  2E76 C;  3A0B E;  5KJ7 A;  3NMD A;  3ZDM A;  3VP9 A;  3CIR D;  2FYU K;  1EZV G;  2KIK A;  2I1J A;  4U3F D;  3ITK A;  1ZRT E;  1SQP E;  3BRV B;  4YXD D;  1BE3 J;  3RK3 E;  3N4X A;  3TSI A;  1L0N J;  3IFM A;  2ZYD A;  2BS4 C;  1P84 H;  2ACZ C;  3RK3 C;  3VON A;  1GL2 C;  1KMI Z;  4UB8 H;  4KT0 J;  4D6T J;  1LTT C;  2WSC J;  1MUU A;  1ZXG A;  2AXT H;  1IFN A;  5CHX A;  1NGM B;  2Q1K A;  3M91 A;  4H13 B;  1T3J A;  1BCC D;  1S9K D;  3CL3 D;  1WRG A;  2QJK B;  4H13 D;  5CJ4 A;  1GL2 A;  3AE3 C;  3B5N D;  4YSX C;  2P1J A;  1RF0 C;  1LT9 A;  2P58 A;  3AEE C;  4WY4 C;  3Q5S A;  1MV8 A;  1M57 D;  1NH4 A;  3Q5P A;  1Y8A A;  2MJZ A;  3AE5 D;  2V7Q H;  2XDJ A;  5AW5 B;  2XND H;  3VYI A;  1KFY D;  2LKM A;  1FZB A;  3E1R A;  1RF0 A;  1JOC A;  2N1T A;  1JNM A;  2Y0D A;  4WY4 A;  3U59 A;  3IN6 A;  1S1C X;  4JQ0 D;  3SFE C;  3L74 E;  3HUS C;  5KLV D;  2GA1 A;  1S3J A;  2IBZ I;  4JBZ A;  3WU2 H;  1SQX G;  4KHX A;  2FY8 A;  2POH A;  1L0L G;  2WZ7 A;  3R4Y A;  1H8A A;  3TGU J;  2J59 M;  2K88 A;  3VOP A;  3BAS A;  3L71 E;  2I8D A;  1RQV A;  5AW7 B;  5C3J C;  4IL6 E;  1Q81 Q;  1NAY A;  4AYC A;  1BCC J;  2Z5I A;  4GDO A;  3V4W A;  1S72 P;  1EZV I;  3H1H E;  1HF9 A;  1ZP0 D;  2P7J A;  1E5W A;  1DD3 A;  2P10 A;  1KIL B;  3A0H E;  4YSY C;  5APU A;  4GIF A;  4GOD A;  5C2T C;  3M06 A;  1KIL D;  1SS1 A;  3VRB D;  4EOT A;  4KX6 C;  3LW5 J;  3L35 A;  2IYO A;  1NKZ B;  2WPV B;  3L72 G;  2PRR A;  3CCM P;  5AW6 B;  4M3L A;  4AQR D;  2PFX A;  2KNC B;  2Q3E A;  1ZR4 A;  2BCC D;  2LXC B;  3GW6 A;  3AEF C;  3TNU A;  1M1J B;  3OJA B;  4OGQ D;  1JMB A;  1BGY J;  2JJL A;  2FYU J;  1L0L K;  3P4P D;  1VQ8 P;  1IFJ A;  1VQK P;  2E75 C;  3HE4 B;  3MUD A;  2N9B A;  1LTG C;  1JY3 P;  4OVN F;  2Q5U A;  3I55 P;  3PRJ A;  3CMA P;  3VRA D;  3V4Q A;  3O8Z A;  1N7S B;  1RF1 B;  2QJY C;  1NTZ G;  1P84 E;  1OVV A;  1N7S D;  2D2C D;  2RN0 A;  3FGA D;  3V2R A;  3AEC C;  3HTK A;  4UB8 E;  1LP1 B;  3AEA C;  2A06 G;  3L73 E;  3O6Q A;  1NTM D;  2AXT E;  2WDR C;  4PD4 D;  4RKU J;  4I6L A;  3F89 A;  4PD4 H;  2WSF J;  1JO5 A;  1FZF A;  2OGU A;  2NPS C;  3BRT B;  3C9I A;  1JY3 N;  4DOJ A;  5AVY B;  1M90 Q;  3AED D;  2O1K A;  3B4S A;  4JYC A;  1MFT A;  1FOS E;  3VN0 A;  3TYY A;  2QJP B;  2H89 D;  1RE4 A;  2K9J B;  2W6B A;  2JO1 A;  5CCG C;  2QE7 H;  1H89 A;  2ZT9 B;  1FJK A;  4ASV A;  1KF6 C;  2BS3 C;  1NEN C;  2YKP A;  5AVV B;  4NPE A;  5KAF E;  3G6E P;  4C7N B;  5APX A;  1SQB E;  4IL6 X;  1NTK D;  2WS3 D;  1DX7 A;  1PL5 A;  2K3R A;  1NTZ K;  2BAS A;  1HBW A;  2YO2 A;  3P7K A;  1MFZ A;  3BCC D;  3TK1 A;  3AE6 D;  1LGH B;  2B9B A;  1BE3 G;  1RHZ B;  1NU1 E;  1G1J A;  4JYB A;  1L0N G;  4W7Y A;  1KOR A;  3CC4 P;  1IJD B;  3VR9 D;  4D6T G;  5BU5 A;  4L73 A;  3BVH A;  2HG5 D;  3M9B A;  5APY A;  3FXE A;  2FXO A;  1FAV A;  2VRS A;  2WU5 D;  1DEB A;  1TFF A;  1OZH A;  1NTM J;  2C9N Y;  2BEZ F;  3F5H A;  5AVR B;  2E76 D;  3H25 A;  4XE5 B;  4PV1 B;  1FDM A;  2YO3 A;  1JY2 O;  3V2P A;  1YQ4 C;  1SFC C;  2ITA A;  2CPB A;  3T97 A;  3NTN A;  1QLB C;  2FBW C;  1G2C B;  1AVO A;  3JC2 2;  4N3Y B;  3VTP C;  3H6P A;  3RK3 B;  1ZRT D;  1SQP D;  2OTJ P;  2ACZ D;  3RK3 D;  1GL2 D;  3SSU A;  1SFC A;  1Y9B A;  4U7J A;  5CJ0 A;  1JB0 J;  3AEG C;  4I2L C;  5B5E E;  1MZ9 A;  1H88 A;  3P4Q C;  4YT0 C;  2WQY C;  1L0N K;  1K9M Q;  1U7M A;  4FJV A;  1GU4 A;  1YJN P;  2BCC E;  4U3F G;  3RGU A;  3CWB E;  3D6Y A;  5C39 A;  2AEF A;  3L75 J;  5KLI B;  3AE3 D;  2K37 A;  3L37 A;  2OYI B;  5AVZ B;  4YSX D;  1IFI A;  2JP3 A;  2W83 C;  3TGU G;  1KQL A;  2J58 A;  1FBM A;  3AEE D;  4WY4 D;  1QL1 A;  4PJ0 E;  2Z5H A;  5AW2 B;  2H43 A;  2A45 G;  1KB9 I;  2RMZ A;  2IPP A;  2B87 B;  2YMK A;  1J1E C;  3H1J E;  4R4M A;  2UWJ E;  1GW4 A;  1W2B O;  1X0T A;  3MP7 B;  3KYQ A;  1BCC G;  4GT1 A;  1VQN P;  1CI6 B;  1QGK B;  2ZYG A;  1FOS F;  5KKZ C;  1PPJ D;  2B89 A;  2IX7 C;  3HUS B;  1LWU C;  3SFE D;  1IC2 A;  2KNC A;  3I5C A;  1X9V A;  2M8R A;  1LTS C;  1URQ C;  2V4H A;  1M1J A;  3L74 D;  1L4A C;  4EYY Q;  2KUB A;  1FZC B;  1SQP J;  3KXD A;  3KQG A;  3FWN A;  1E79 H;  3K5B A;  3M0D A;  1OVR A;  1KC8 Q;  1SQQ E;  5C3J D;  1BGY G;  3HD7 C;  2ZVN B;  3NXS A;  5AW3 B;  3L71 D;  4L74 A;  5AVX B;  1URQ A;  1NTK E;  1N2D C;  3W67 A;  3CLQ A;  1NEK C;  1IZN B;  5KLV G;  2ZFY A;  4IL6 H;  1IK9 A;  2WWW A;  4H0L C;  1LP1 A;  3CCV P;  3BCC E;  1IFM A;  1NYH A;  3A2A A;  3CXH I;  2K9Y A;  1HUC A;  3H1H D;  4NPF X;  4YSY D;  2XNX A;  5C2T D;  2Q9I A;  3H32 A;  3AEB D;  3GF3 A;  4KX6 D;  3MIW A;  3AE4 C;  3IR9 A;  5KJ7 C;  4AUW A;  1VF5 C;  2AXC A;  2FKW B;  2HOD B;  2M0B A;  2E74 C;  3I56 P;  1PGO A;  4JPZ B;  3AEF D;  1YBK A;  5AVQ B;  2JR8 A;  2WSE J;  1SVF A;  2E75 D;  1S2E A;  1VQ5 P;  3VP8 A;  4HB1 A;  4Y99 C;  1R5S A;  2BS2 C;  3S9O A;  1EXJ A;  3EWK A;  2OTL P;  4IFD K;  2WT7 B;  1GZL A;  1NWQ A;  1QLE D;  2A45 I;  5KLV K;  3WUV A;  1Z56 A;  3AEC D;  1JMM A;  1P84 D;  2FFD A;  3AEA D;  2WDR D;  1LTI C;  2NPS B;  1KFM A;  2WMM A;  4K3A A;  3PLN A;  4QMA A;  3L73 D;  4DHI B;  2NPS D;  1LT9 C;  3CX5 I;  4BXL A;  4I7Z B;  1FE6 A;  2B88 A;  1KFN A;  2LXB A;  3P4R C;  4O9B A;  2FYN B;  4BRY A;  1KYO I;  1RY3 A;  4Z1M H;  5BU8 B;  4IFM A;  2WPQ A;  3H1H J;  5DJT B;  3B5N B;  3G71 P;  5CCG D;  5AW4 B;  1NTM G;  2N1T C;  3CPW O;  1KF6 D;  1QVF O;  3B71 A;  1NEN D;  1T2K C;  4DT0 A;  1LTJ B;  1SQV E;  5AW9 B;  5AW1 B;  3TDK A;  1JTH B;  1SQB D;  1VQ9 P;  1ZW0 A;  5KAF H;  1VQ4 P;  2R44 A;  2ZXX A;  2QIW A;  1PPJ E;  1K04 A;  5AVS B;  1EDK A;  1AFO A;  4HKZ H;  4U3F J;  3PHL A;  4IOI H;  2L5G B;  1NU1 D;  1Y47 A;  2QA4 P;  2OYI A;  2GM4 A;  1N86 A;  1L0V C;  5TJH A;  1OW6 A;  1XTG B;  4A7P A;  1VQL P;  2E43 A;  2E42 A;  2JDI H;  3L75 G;  3L73 J;  2HPC A;  1FS0 E;  2B87 A;  3S4R A;  4DZO A;  1OFC X;  1NTM K;  1S4X A;  1YQ4 D;  1SFC D;  3W68 A;  2KOG A;  3CC2 P;  2E5Y A;  1KN7 A;  2WPS A;  1OW8 A;  4YTN C;  5APQ A;  2FBW D;  3VR8 C;  3II6 A;  1Q2N A;  3GHG C;  5AW0 B;  3FWL A;  1PP9 D;  1OMI A;  2NRG A;  5E79 E;  3AE9 C;  3MGN A;  3AEG D;  2PAJ A;  3KDP B;  3AEB C;  1NHL A;  3P4Q D;  1ZLL A;  4YT0 D;  2WQY D;  2V7Q J;  2HR3 A;  3MUD C;  1RE3 C;  1FZC A;  1PGQ A;  1M1K Q;  3GHG A;  1T3U A;  5B5E H;  1EDJ A;  2NZ2 A;  4EDF A;  4GKG A;  2O01 H;  3P8M C;  2MKV A;  4OGQ B;  2KS1 B;  1NTK K;  1X79 B;  3CWB D;  2OYH B;  3AE2 C;  2XV5 A;  1K05 A;  3H1L E;  3S1K A;  3FXD A;  1S5L E;  2ZVO B;  2W27 A;  1SQP G;  4TLF A;  1KD1 Q;  1NU1 J;  2P2U A;  1EC5 A;  2ZJS E;  1RE3 A;  4L76 A;  3PP5 A;  5KLV J;  1J1E B;  2H8P D;  1OXZ A;  2WVR A;  5APV A;  4PD4 I;  4HJG H;  4PJ0 H;  1YI2 P;  2D2C B;  2YIU C;  2YMY A;  1VPC A;  1DIP A;  4H44 C;  2QM8 A;  2RH0 A;  2L91 A;  3H1J D;  3RBX A;  3RK2 C;  3PTZ A;  4N6J A;  2P67 A;  5KKZ B;  1N8R Q;  3D70 A;  1LWU B;  2HOD A;  1RE4 C;  2WSS H;  2IZ1 A;  2KYV A;  1UIX A;  1J1D B;  4LDT A;  1L4A B;  2E5T A;  1W5C E;  1AQT A;  1ZOY C;  1JY3 O;  1URQ D;  1U7J A;  1L4A D;  3NFQ A;  3U1C A;  2R3S A;  2GUV A;  1AV1 A;  3EFF K;  2ZYA A;  1BSN A;  2Y0C A;  3B8E B;  1A02 F;  3WUT A;  2IFN A;  1T8Z A;  5EFW B;  1N73 B;  1SQP K;  4RJT A;  3HD7 D;  2KSJ A;  3H1K E;  1IO4 A;  2O1J A;  1XTC C;  1SQQ D;  3CX5 E;  3CCJ P;  1YJW P;  5GTI E;  3G4S P;  1GW3 A;  4YSZ C;  1NEK D;  1VQ7 P;  2BCC J;  3CWB J;  4H0L D;  3L74 G;  2XU6 A;  3GF7 A;  2C0X A;  1YQ3 C;  4OH8 B;  3N7N A;  2IFM A;  3HE5 B;  1CSB A;  3V2N A;  2YKO A;  3KZI H;  1SQX D;  3AE4 D;  1CW5 A;  5KJ7 D;  2E74 B;  3L71 G;  1VF5 D;  5B66 H;  4RO0 A;  3CCL P;  2XKM A;  2E74 D;  3H1J J;  1BDD A;  2FYU E;  3P32 A;  3MD0 A;  2KSE A;  4LC1 A;  2RKL A;  1YIJ P;  1J2J B;  4GOE A;  2E76 B;  2KK7 A;  3H1I D;  1X22 A;  3H1H G;  3FX0 A;  4I6M C;  1NO4 A;  1U57 A;  3CCU P;  1S5L X;  4WVZ A;  2WIT A;  1HGV A;  2IBZ E;  1PV3 A;  2QG4 A;  1PP9 E;  3JCU H;  1GL2 B;  5APS A;  1FZA A;  1D7M A;  2IDB A;  4UB6 H;  1SQQ J;  1YIT P;  4YXW H;  3PH0 A;  1NTK J;  3P4R D;  4YPC A;  3HRN A;  2H88 C;  3L70 D;  1ZV8 A;  5AW8 B;  4R4L A;  3BCC J;  1FZG A;  1EZV E;  4C46 A;  1R5L A;  2R32 A;  4WY4 B;  4WWI A;  1HTL C;  2N1T D;  1IK7 A;  1AA0 A;  3L73 G;  3P8C E;  1X8Y A;  2M3E A;  1T2K D;  2ZAE B;  1SLQ A;  5H2F E; 
#chains in the Genus database with same CATH homology
 2QJK C;  4KT0 J;  5KLI C;  3S9O A;  2WSF J;  3EWK A;  1FDI A;  1EXJ A;  3C8V A;  2FXP A;  5M1B A;  2WSC J;  2D2C B;  2YIU C;  1DIP A;  3VRB C;  1YQ3 D;  3AED D;  4H44 C;  4TT3 H;  3AE2 D;  1QLB C;  3P4S C;  2FBW C;  2ZT9 D;  1L0V C;  1NGM B;  2WP9 D;  2E75 B;  1OW6 A;  4GDO A;  3Q3D A;  3AEC D;  1WMK A;  2E76 B;  3AE1 C;  1VF5 B;  3D70 A;  4H13 B;  3IAO A;  3AE5 C;  1HF9 A;  1ZP0 D;  2WDQ D;  2WS3 C;  2G3A A;  3AEA D;  3SFD C;  1KFY C;  2WU2 C;  1U57 A;  2H89 D;  2WDR D;  1R8E A;  4H13 D;  2ACZ D;  4YSZ D;  1UIX A;  1S5L X;  1DD3 A;  2P10 A;  4YTP D;  2BEQ D;  3AE3 C;  5C3J D;  3AE6 C;  4OGQ C;  3T97 B;  4YTM D;  2WDV D;  1Y9B A;  2JO1 A;  3G9R A;  2QSI A;  1YQ4 D;  4U7J A;  4YSY C;  1JB0 J;  3AEG C;  4YSX C;  2ZT9 B;  3P4P C;  5C2T C;  1ZOY C;  3P4Q C;  4I7Z B;  4YT0 C;  3GLM A;  2WQY C;  1KQF B;  3RL0 g;  1KF6 C;  1MKM A;  4H44 D;  2J5U A;  2BS3 C;  3AEE C;  1OW8 A;  3LW5 J;  4KX6 C;  4YTN C;  1NEN C;  3P4R C;  3P4S D;  2FBW D;  1PV3 A;  1ZME C;  1L0V D;  1NEK C;  3VR8 C;  2WPV B;  3AE7 C;  4IL6 X;  3Q5S A;  4H0L C;  1OW7 A;  3D6Y A;  2B76 C;  3Q2Y A;  3AE1 D;  4Z1M H;  3VR9 C;  3Q1M A;  3CIR C;  3Q5P A;  3VRA C;  3AE5 D;  2WS3 D;  3GMA A;  4PV1 C;  1NYH A;  1PL5 A;  3SFD D;  1AJY A;  1KFY D;  2WU2 D;  2IDB A;  1PIX A;  1OMI A;  2K9Y A;  3Q5R A;  3AEF C;  1TU3 F;  2WU5 C;  1VL2 A;  3AE3 D;  3AE8 C;  4OGQ D;  3AE6 D;  4H44 B;  3AE9 C;  1KTM A;  2D2C C;  4YSY D;  3AEG D;  4YSX D;  2JP3 A;  4YXD C;  3P4P D;  3AEB C;  1ZOY D;  5C2T D;  3P4Q D;  1KQG B;  3AEB D;  4YT0 D;  1KF6 D;  2WQY D;  3GF3 A;  4KX6 D;  2E75 C;  2V7Q J;  3AEE D;  4YTN D;  3B71 A;  3AE4 C;  3D71 A;  1NEN D;  5L8R J;  3IN6 A;  1E7P C;  3P4R D;  2E76 C;  1S1C X;  1KOR A;  3ABV C;  1NEK D;  3VR8 D;  1VF5 C;  3AE7 D;  3ABV D;  2H88 C;  3SFE C;  4H0L D;  2B76 D;  2NZ2 A;  4RKU J;  2E74 C;  2YMK A;  4R4L A;  3VR9 D;  4YSZ C;  2QJP C;  3CIR D;  3VRA D;  3GF7 A;  4R4M A;  2MKV A;  4OGQ B;  1Q90 D;  4PV1 D;  2OQQ A;  1GMJ A;  1YQ3 C;  3AED C;  3AE2 C;  1K05 A;  2QJY C;  1RQU A;  3AEF D;  2ZT9 C;  1DD4 A;  2WU5 D;  1FDO A;  3AE8 D;  2QIW A;  1ZRT E;  2WP9 C;  4Y28 J;  3AE9 D;  1HJ0 A;  4I7Z C;  2D2C D;  3FGA D;  1EXI A;  1K04 A;  3AEC C;  4YXD D;  2WSE J;  3RK3 E;  1IK7 A;  2O01 J;  4XFJ A;  3R4Y A;  4H0L B;  2FYN C;  1ZP0 C;  2E75 D;  3AEA C;  2WDQ C;  2BEZ F;  2G8Y A;  3AE4 D;  3D6Z A;  3O6Q A;  5KKZ C;  3H25 A;  2E74 B;  2E76 D;  2H89 C;  2BS4 C;  4H13 C;  2ACZ C;  1VF5 D;  2WDR C;  3VRB D;  2BS2 C;  4PV1 B;  1KIL E;  1RQV A;  4YTP C;  2H88 D;  3SFE D;  5C3J C;  4YTM C;  1KMI Z;  2WDV C;  1YQ4 C;  2E74 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...