3AEDC

Crystal structure of porcine heart mitochondrial complex ii bound with 2-iodo-n-phenyl-benzamide
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of porcine heart mitochondrial complex II bound with 2-Iodo-N-phenyl-benzamide
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
total genus 48
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3aedC01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3aedC02
2FBWC 3VR9C 2BS4C 1KF6C 3ABVC 3VRBD 4YTND 3VR8D 3AE6D 4KX6C 3AEFD 1YQ4D 3AEBD 1KF6D 2H89C 1ZP0C 3P4SC 1QLBC 1NEND 4YTMD 1K04A 3AE1D 3AE9C 1YQ4C 3P4SD 2WQYC 1ZP0D 1PV3A 1NENC 1KFYD 1KTMA 2ACZD 4YTMC 2B76C 2WDQC 3AE5C 2WDRD 1OW6A 2WU2D 4YSXD 4YSYC 3VR9D 5C2TC 2WQYD 1KFYC 2ACZC 3AE2C 3VR8C 2B76D 2WU2C 3AE5D 4YSXC 1E7PC 3SFEC 1NEKD 1YQ3D 2BS3C 3AE4D 4YSZC 3AE3C 4YXDD 4YTPD 1OW8A 3AE2D 4YT0C 3SFED 3P4QC 2BS2C 5C3JC 2WP9C 3AE8C 3B71A 4YTNC 4YXDC 3AE3D 3AE4C 4YTPC 3AEGC 3AEEC 3AEAD 3ABVD 3VRBC 1ZOYC 3AECC 2WDRC 5C3JD 1OW7A 2WP9D 3S9OA 2G3AA 3AEGD 3VRAC 3AE1C 2WDVC 3P4RD 3AE7C 2WU5C 2H88C 3SFDC 1YQ3C 1NEKC 3VRAD 3AE9D 3P4RC 3P4PD 4YT0D 3AE7D 4YSYD 2H88D 2WU5D 3AEDD 3AE6C 4KX6D 2WDQD 3AEFC 1L0VD 3AEBC 3AEAC 3AEED 5C2TD 2H89D 3P4PC 3CIRC 1ZOYD 3AECD 2WS3C 3AEDC 2FBWD 1K05A 1L0VC 2WDVD 3P4QD 4YSZD 3CIRD 2WS3D 3SFDD 3AE8D
chains in the Genus database with same CATH superfamily
2FBWC 3D71A 2C0WA 4ZMDA 2YMKA 1H88A 3P32A 1VDFA 3A2AA 1OZHA 1KZUB 1SQVJ 1NJIQ 1ZW0A 3H25A 2IFNA 1KF6D 2WSCH 3WU2H 2YNYA 2WPVB 1OIPA 5AW7B 1T3JA 3TGUE 1NU1D 1YQ4C 4GOFA 1M1JB 2K1AA 2XV5A 5DJUB 3BASA 4I7ZB 1P84H 3L75G 2WDRD 2L91A 1M7LA 3T97A 1VQMP 4NPEA 1NTMJ 3AE3C 3GF7A 1BCCD 3SWKA 1FAVA 3CL3D 2C9NY 3OAKA 3VP9A 3B71A 4YXDC 1FBMA 1SQQJ 1YJ9P 1JY2O 5KJ7D 3ABVD 3VRBC 2FXPA 2QIWA 3S9OA 1YTZT 2H7HA 3P8CE 3MD0A 3P7KA 1ZXGA 2YKQA 1NHLA 3CXHI 2IBZI 1GK6A 1L0LJ 1QX8A 3W67A 2KI7B 4H13D 2AEMA 1PP9D 4ZKUA 1GU4A 4WY4B 1L4AC 3U1AA 2O3JA 3V4QA 1SQBJ 4K3AA 2E74D 4N78E 2E75B 4DHIB 1T3UA 2QEXP 2Z4EA 3E1IA 1RHZB 3SSUA 4IFDK 2J58A 1AQTA 3RL0g 3GLMA 3BATA 3CD6P 2PRRA 1BGYD 1ZP0C 1VQ4P 3P4SC 5BU5A 1LT9B 3H1LD 2GA1A 1VQ5P 3QH9A 1QVGO 3H1LG 4PJ0E 1SQBG 3MTUE 2FYUK 4AQRD 2OARA 1VQNP 5CCHA 3BCCD 1SQXD 3SFEC 4C7RA 3V2QA 1SQVG 4YSZC 2D2CD 4WY4D 1QLED 1T8ZA 1U57A 1OWAA 4OWFA 3M9BA 3BCCJ 2M5AB 2KS1A 4IFMA 3S1KA 2G3AA 2WSEH 1QGKB 2WMMA 1GMJA 3Q3DA 1J2JB 1BSHA 4Y99B 2BCCG 2VRSA 1GL2D 2YKPA 4Z1MH 1EC5A 2H8PD 3RGUA 3GF3A 1X0TA 4LC1A 1BE3G 4IOIH 5CBOA 1RE4A 1FJPA 3V4WA 3H32A 3A0HH 5C2TD 3TF5A 5CJ4A 3VMAA 1NGMB 1M1JA 3L75E 3M0DC 1JY2P 1FE6A 1ZMEC 4GOEA 3I56P 2BCCJ 2POHA 3C1LA 3PLNA 1LWUA 3Q2YA 4YXWH 1SQXE 2H89C 2K9YA 2QJYC 1VQPP 2I8DA 2JP3A 1DEEG 1SQPE 3HUSC 1JTHA 1KFYD 3HE5B 4YTMC 1BE3E 1N7SC 2K9JA 5AVVB 3L73E 1JY3N 1URQB 1AJYA 3U1CA 1LJ2A 1PP9G 4MN4C 3BVHA 4WB4A 5E79E 2IYOA 4YT0C 1FDOA 4KHXA 1FZFA 2Y0CA 5KLIC 2WTYA 4YTNC 1OFCX 3RK2D 1PGJA 2YXRB 1LTTC 2Q6QA 3PH0A 4H44D 1MFZA 3V2PA 2WT7A 2OYIC 3WU2E 1GL2C 5KAFE 1JTHB 1M8OB 3M9QA 2KLUA 2N1TB 3K5BA 2K9JB 3P4RC 4YT0D 2ZFCA 1NOHA 3JSVC 2NZ2A 3L74G 2HLOA 2WSSH 4L73A 1L0VD 1U7JA 3L74D 2A45H 1KQFB 2ZYAA 1FOSF 1G2CA 1PZQA 3PHLA 2FBWD 3H1JE 3RK2B 1JB0J 1HF9A 2WDVD 5E79H 4YSZD 3GW6A 2O01H 2QSIA 1KYOE 2BCCE 1LP1B 2ZYGA 1J1EB 1EDLA 4KX6C 5TISE 5APTA 4H13B 1DD4A 3P8MC 4TLFA 2O1JA 1Q7YQ 3OW2O 3A5TA 1NVOA 1SQQG 3P4SD 1ZP0D 1PV3A 1IFDA 1PIXA 2B76C 4GKGA 1FZCA 5DJTB 3CXHE 1YBKA 4YSXD 3N7NA 1KILC 4HKZH 1WRGA 3H6PA 3L72G 2A06D 2D2CC 2N9YB 5AVWB 1NTKD 3ZDMA 2WT7B 1BE3J 1USEA 1HWTC 3SFED 4GODA 4D6TE 1KYOH 3E1RA 1JY3O 1VQ7P 5C3JD 2E75C 3G3ZA 2PP6A 1H0TA 3A0BE 3L70E 4I7ZC 2IZ0A 4HYTB 3KDPB 3CX5I 1EXIA 4U3FG 1VF5B 1KB9E 2HYNA 4EIJA 3L72D 1KQSO 3M06A 1N7SB 2JEEA 3VMZA 1SP4A 1ZOYD 2WWWA 3FX0A 1HJBA 1L0VC 2OTKE 1NTZJ 3CCEP 2Q3EA 3TGUJ 3FXEA 4C46A 2JO1A 1EDKA 1X9VA 2JDIH 5AVYB 2K3RA 3PJSK 1CW5A 3AEBD 3G9RA 2QVAA 1QLBC 2FFDC 4OGQC 3L71E 2FYUG 5KAIH 4N3YB 2WU2D 1AQ5A 1KFNA 5CMZA 3A0HE 3CWBE 2W6JH 1LGHB 1RF1C 2QJPC 5CCHC 1YIJP 4I1LA 1EZVE 2OYIA 3FWLA 3CMEP 3S4RA 2B9BA 2WDRC 1L2PA 2HODB 4AUWA 3VYIA 1NTMK 3PTZA 4D6TJ 5CCGA 1UIIA 1S72P 1LT1A 3JC22 1WT6A 3T97B 4EI2A 1T6AA 2QJYB 2Y0DA 2ZVNB 4DJGA 1JCDA 1E79H 4H44B 2E74C 3FWNA 3D6ZA 1LTJC 1LT9C 2W8ZA 5APUA 1EDIA 4W7ZA 2R5DA 1NU1E 1GL2A 2M0BA 3G6EP 1S3JA 3VN0A 4XE5B 2IYPA 2N1TD 2V7QH 1GU5A 5AVRB 2ZFYA 1YQ4D 2KSEA 3HD7B 2YIUB 1HVVA 5AW3B 2ZT9C 4UB6H 2KYVA 1PGQA 1Y47A 1N73C 2C9LY 4YSYC 2BCCD 2P7JA 2WQYD 4R4MA 1NTZG 5AW8B 1L0NJ 2QE7H 2WU2C 3FXDA 4H0LB 1J1DB 3MUDC 3HE5A 1NU1G 1VPCA 4YTPD 1A02F 1OXZA 1RQVA 2WP9C 1YYCA 5B66H 1P84D 4GIFA 1KQGB 2BEZF 1NAYA 2FXOA 2WSFH 1LTSC 3IFMA 1N8RQ 1G1IA 2H88C 1USDA 1DD3A 5AVQB 2QRXA 1L4AA 4QMAA 1YHQP 5APWA 2WDQD 4PD4D 4ZNCA 3SWYA 1M1KQ 1KV4A 3AECD 3P4PC 1BGYG 1IK7A 2PAJA 3H1KG 3P4QD 1NTMD 4R4LA 3AE8D 1S5LX 3CCQP 1NTKJ 3D70A 4B86A 2LR2A 1QEXA 2FFDA 2Y9YA 3HE4B 5KLVK 2FYUD 2Q3IA 2P67A 1IZNB 1L0LG 3AE6D 1JNMA 3M91A 2XKMA 1K04A 2M3BA 5KLVD 2Q7CA 4WY4C 2E43A 3H1JJ 1YJWP 4N78D 2YO3A 3B4SA 3CCRP 3V6IA 2ACZD 3H32B 1RF0A 2N9BA 3KPEA 2R32A 3C8VA 1L4AD 4YSXC 3HUSA 2QM7A 1BCCJ 3AE4D 2R3CA 2V4HA 2AXTE 1IC2A 3L74J 1R8EA 1Y9BA 3TK1A 1EDJA 3TNUB 2WVRA 2KSJA 1YITP 1OW7A 1BCCG 3E7KA 4Y28J 3BCCE 1VQ8P 2XZRA 3D6YA 3QWOC 3VRAC 4IFFA 1SS1A 2M3EA 2HPCB 2WU5C 1K73Q 2O1KA 1BCCE 1JOCA 3RL0B 5CCHD 3L75D 1RQUA 3I55P 3RL0D 3H1JG 3MHVA 1KILD 3HUSB 3AEAC 1Q82Q 3CIRC 3HD7A 1FDMA 3L35A 4H13C 3JCUH 1SQPD 2LKMA 1SQXJ 1KYOI 5GTIH 4OH8B 2W6BA 3CC7P 1SQBK 1DEBA 2J5UA 1XTCC 2ITAA 5L8RJ 5AVZB 4TT3H 1PPJE 2ZYDA 1RH5B 2R5BA 3CX5H 3LIEA 2LXBA 1NWQA 3H1ID 3PP5A 1X79B 4JYCA 2R44A 3EWKA 5APQA 1NENC 2B88A 3VMXA 1NTZK 1OW6A 3A7OA 3TNUA 5KLVG 1ZN5A 2M5AA 2ACZC 3R4YA 2E74B 3VR8C 3M9HA 1FZCC 5TJHA 1L0LK 3Q5PA 5C39A 1TFFA 2O01N 1GK4A 1S1CX 3MP7B 4WVZA 2QJKB 3L73D 1KC8Q 3CI9A 1JY2N 3CX5E 4L75A 3RBZA 1OX3A 2WPSA 2FYNC 2YIUC 1NTZE 4AYCA 1CI6A 1LTGC 3AE7C 3CMAP 3RL0C 2BASA 2FKWB 1URQC 2NPSC 2XDJA 3AE9D 1YJNP 3P4PD 2YXQB 2WU5D 1R5SA 1YI2P 2OQQA 3RK3C 4DCKA 2QA4P 1SQQD 4CPGA 2A45G 1LWUB 3KQGA 2R3SA 2OYHA 1JY3P 4W80A 5CBNA 3L4FA 1AA0A 4L74A 1PP9J 3L71G 1SQVE 2W83C 3AEFD 3CWBD 4RJTA 5KLVJ 3NTNA 2YKOA 2IBZD 1VL2A 1CZQA 1VF5D 5KAFH 1KILA 2PGDA 1N2DC 2IDBA 2KS1B 1IFPA 1MZ9A 4ASVA 2FYNB 3TYYA 4D6TD 2WDQC 2E76D 4Y99C 2WITA 2RH0A 1T2KD 4XFJA 4RO0A 3GMAA 1VQOP 1U7MA 3AE2C 3LW5H 2B76D 1DH3A 2IBZG 4JQ0D 3CWBG 2RN0A 4GT1A 1NYHA 3H1KJ 4YTPC 3B5NA 2RKLA 5B5EH 1SQQE 2WP9D 5TISH 1IFNA 1SFCD 3RK2C 3H1LJ 1IK9A 3AE1C 3H1IJ 1FC2C 2L5GB 2HFED 3MZWB 2OYHB 3H1HG 3USSA 3AE7D 3R2PA 2H88D 1NKZB 3PRJA 3CXHH 2Q1KA 2ZJSE 3W68A 3AEFC 2KK7A 1S9KE 2KZJA 1KB9I 1SFCA 3L70D 1JMBA 1SQQK 1LTAC 2YO2A 2XU6A 2H43A 3V2RA 3VP8A 2WS3D 3KZIH 3L73G 4NPFX 3VR8D 1KILE 3MUDA 3VONA 2P58A 5KJ7C 3L74E 1FOSE 1A02J 4FJVA 1PGOA 2Q9IA 3A0BH 3H1JD 1BDDA 4K35A 4WBAA 4RESB 1S5LE 1KB9H 1RF0C 5K5GB 4PV1C 2KP8A 2WQYC 2A45I 1BSNA 5C2TC 1FZBA 3WMM0 5AW0B 2E5TA 1DX7A 4U3FJ 1BGYE 1BDCA 4LDTA 3L70J 1LTJB 3AE8C 4KJMA 1IFJA 3AE4C 3AEEC 2I1KA 5CCGC 5APSA 1T2KC 1L0NK 3AEGD 3GHGA 2WDVC 1SQXG 4DOJA 4DDIA 3L72J 1JO5A 5KAIE 4PV1B 1N86A 1ZRTE 2KNCA 1QL2A 2JWAA 1UIXA 3HTKA 4D6TG 1AVYA 2KUBA 1W2BO 1OVRA 1MV8A 1N7LA 2KOGA 4OVNF 4LLHA 3TGUG 3L37A 5AW1B 1KQLA 2V7QJ 3SFDD 2WSFJ 1BE3D 4HH2A 4KT0J 3CCSP 2SPZA 3KHUA 1RF1A 2NRGA 3GHGB 1FZGA 1VQ6P 1S2EA 4PV1D 2CK3H 3Q1MA 1HGVA 2GM4A 1M57D 1NTKE 3M0AA 3AE9C 4W7YA 1L0NE 1N73A 2OYHC 4ASWA 2B89A 2JR8A 4DHZA 3L70G 2FXMA 3VR9D 1W2EA 1KFYC 2P1JA 2I1JA 2W6AA 4H0LD 4M3LA 2BS3C 1VQKP 3IAOA 4DDGA 3CPWO 3P4QC 2BS2C 1ZRTD 1HGZA 3HE4A 3UIAA 2W90A 4IL6H 1SQBD 1EQ7A 1JM0A 5KKZC 3AECC 1PL5A 2E76C 3TSIA 2KNCB 1NU1J 1N73B 1L0NG 3IF4A 2NPSB 1VF5C 1DIPA 3II6A 1R5LA 4YSYD 1D7MA 5AW9B 3AEED 2OGUA 2E75D 2FYZA 1K9MQ 3NXSA 5AVXB 3H1IE 3H1LE 1L0ND 2MKVA 1HJ0A 2ZXXA 2FY8A 2N1TC 3O6QA 1HBWA 2M8RA 3OA7A 3VR9C 2HG5D 2BS4C 1KF6C 4BXLA 5B5EE 3V2NA 5CJ0A 3EFFK 1VQLP 1Q86Q 4WY4A 1S9KD 3ITKA 1Q90D 3OJAB 4C7NB 3G4SP 1NEND 3CCUP 2JKVA 5EFWB 2J59M 1S4XA 3VOPA 4WWIA 2QJKC 1LTIC 3GG2A 4JPZB 1XTGB 4PD4I 3KXDA 4U7JA 5KLVE 2Q5UA 4LGDE 2ZXEB 3L72E 3TGUD 1OMIA 3O6QB 3NMDA 3KZIE 3L36A 1SQPJ 2OYOA 3F5HA 2KIKA 2IPPA 4I6LA 2G8YA 2PFXA 4EYYQ 1FS0E 4C7NA 1GL2B 4EDFA 2DW3A 2IFMA 2E42A 3H1KE 3LW5J 3B8EB 1MUUA 3FGAD 1SQVK 2QG4A 3CCJP 4U3FE 3CCLP 1LT9A 1EZVI 2KLVA 3H1HD 1Q2NA 3AEBC 1PPJD 2H89D 2E5YA 4DHJA 3MGNA 2K88A 2UWJE 3GHGC 3L71J 3RK3B 4YTND 4PD4E 1JEKA 2N1TA 2W27A 1GDTA 1H8AA 4HJGH 2ZT9B 1ZR2A 2CPBA 5KJ7A 2OTLP 2FYUE 4BRYA 3CLQA 1FZEA 2QM8A 1L0LE 3AE5D 2AXCA 2WZ7A 1LP1A 1G1JA 1RE3C 3JCUE 2WSCJ 5C3JC 2XNDH 5AVSB 4PD4H 1ZOYC 1EZVG 5M1BA 1URQA 5AVTB 1AVOA 3CC4P 1KILB 2FFDB 2JJLA 1GD2E 1SQPK 2ZVOB 3RBXA 1YQ3C 3F89A 3V5BA 1SFCC 3VRAD 4I2LC 2C0XA 1CSBA 1IO4A 1IFMA 1SQBE 3AEDD 1FJKA 1KYOD 2B87A 3AE6C 1J1EC 1SQVD 2AEJA 4YPCA 5GTHE 1FU1A 1Y8AA 3AEDC 3EQ2A 2WPQA 3BCCG 1K05A 1M56D 4H0LC 3TDKA 1P84I 1RY3A 1VQ9P 2WSEJ 1EXJA 1GW4A 4IL6E 4DZOA 3C9IA 1JCCA 3ABVC 3VRBD 1PP9E 2P2UA 1AFOA 4BWNA 2IZ1A 1L0LD 5AW6B 3EFGA 4BRYB 4XA4A 3AE1D 1MFTA 1N7SD 4RKUJ 4IL6X 1KD1Q 3AE5C 1SFCB 2HPCA 3Q5SA 1JUNA 5GTHH 1OVVA 3CWBJ 2RMZA 1CI6B 4EOTA 1MKMA 4UB8H 3AE2D 1NTKK 1LNQA 4H44C 2JWDA 1ZR4A 1NH4A 5AW5B 3B5ND 1J1DC 3AEAD 3H1IG 3CC2P 1PFIA 2NPSD 3N4XA 2B87B 3B5NC 5CCGD 1KFMA 3Q5RA 1K8AQ 1NO4A 2ZT9D 4JBZA 2P10A 1H89A 1GZLA 1NEKC 2KZIA 3WUVA 4UB6E 4JF7A 3HD7C 1P84E 4I6MC 1SLQA 3CX5D 2NPSA 2WS3C 1H0TB 2GUSA 3B5NB 1FZCB 2XNXA 3VMYA 4UB8E 5KKZB 1KORA 5B66E 3H1HE 1M90Q 3CCVP 1FDIA 1ZLLA 2Y0EA 1IFIA 3WUTA 4YTMD 1HUCA 3G71P 5CHXA 3L75J 3MIWA 5KTBA 1KTMA 3HTKB 1JMMA 5BU8B 1RE3A 2Z5IA 3M0DA 1SVFA 5BVZA 3BRTB 1E7PC 1WMKA 1W5CE 1NEKD 3P8CD 5APXA 1G2CB 1N7SA 1GTWA 1KB9D 1OW8A 2KXPB 5H2FH 2BEQD 3HRNA 1RF1B 4DT0A 3U59A 2Z5HA 3IN6A 1NTKG 1S5LH 2IX7C 2GUVA 4OGQD 4PJ0H 2OYIB 1TU3F 4OGQB 1BGYJ 4L76A 5AW2B 1NU1K 5AVUB 3I5CA 1GW3A 1KN7A 1OVUA 3L71D 4NPDA 2AXTH 3CIRD 4O9BA 5H2FE 3CCMP 1PGPA 2HR3A 1X8YA 1HH0A 1NAFA 1FZAA 1ZV8A 2K37A 2Y9ZA 1L4AB 2CPSA 3RK3E 1YTZI 1IJDB 2E76B 1LWUC 3SWFA 1PPJG 1NTME 3IR9A 2WPRA 2HODA 1EZVD 1LTJA 3LIDA 2YMYA 2KB7P 1E5WA 5APVA 1SQXK 3KYQA 4N6JA 4A7PA 1NTZD 1QVFO 2QJPB 3H1KD 3L73J 1YQ3D 2LXCB 4YXDD 5APYA 1NKNA 1Z56A 5AW4B 1RE4C 1Q81Q 3VTPC 5GTIE 1HTLC 2D2CB 3O8ZA 2A06G 4U3FD 3AE3D 3CXHD 3AEGC 4HB1A 2MJZA 1KMIZ 2A06E 3BRVB 1X22A 1M1JC 3P4RD 3H1HJ 3WUUA 3NFQA 2O01J 4ZKPA 3SFDC 1NTMG 2OTJP 3A3YB 2ZAEB 4KX6D 1LTBC 1AV1A 2AEFA 3HD7D 2FYUJ 1QL1A 3RK3D 4GDOA 5KLIB 2IBZE 1SQPG 4JYBA 1URQD
chains in the Genus database with same CATH topology
1S5LX 2E75B 2FBWC 1KORA 2JO1A 3D71A 3O6QA 2WSFJ 1EXJA 2QSIA 3D70A 2YMKA 1ZMEC 3VR9C 2BS4C 1KF6C 3ABVC 3VRBD 4KT0J 4YTND 2J5UA 5L8RJ 3VR8D 1KILE 4TT3H 3AE6D 3RL0g 3GLMA 1FDIA 4KX6C 3AEFD 3H25A 1Q90D 3Q2YA 1YQ4D 3AEBD 1KF6D 4PV1D 2H89C 2K9YA 3G9RA 2QJYC 1DD4A 1ZP0C 4H13B 3RK3E 3Q1MA 1QLBC 3P4SC 1NEND 1VL2A 4YTMD 1K04A 2WPVB 3AE1D 2JP3A 2ZT9B 1VF5D 4OGQC 2E76B 3AE9C 2ZT9C 4RKUJ 2IDBA 1YQ4C 4IL6X 4PV1C 3EWKA 3SFDD 3P4SD 2WQYC 1ZP0D 1PV3A 1NENC 1KFYD 1KTMA 2ACZD 1PIXA 4YTMC 2B76C 4I7ZB 2WDQC 3AE5C 2WDRD 1OW6A 2WU2D 4YSXD 4YSYC 2E76D 3VR9D 2QJKC 5C2TC 3Q5SA 2WQYD 3C8VA 4R4MA 4XFJA 1AJYA 1KFYC 3GMAA 2ACZC 3R4YA 3AE2C 2E74B 3VR8C 2B76D 2WU2C 3AE5D 4YSXC 2D2CC 1E7PC 3SFEC 1WMKA 4H0LD 4U7JA 1NEKD 4H0LB 1YQ3D 2BS3C 3AE4D 4YSZC 2QJPC 3AE3C 4YXDD 4YTPD 3GF7A 1MKMA 1OW8A 1OMIA 3AE2D 3IAOA 3Q5PA 4YT0C 3SFED 1R8EA 3P4QC 2D2CD 2WSCJ 1FDOA 1Y9BA 4H44C 2BS2C 2BEQD 1RQVA 5C3JC 1NYHA 2WP9C 2D2CB 3AE8C 1U57A 5KLIC 3B71A 4YTNC 4YXDC 3AE3D 3AE4C 1S1CX 4YTPC 2G8YA 3AEGC 3AEEC 1KQGB 3AEAD 2BEZF 5KKZC 3ABVD 3VRBC 1ZOYC 3AECC 2WDRC 5C3JD 1OW7A 1PL5A 2E75C 2E76C 2FXPA 2QIWA 4H44D 5M1BA 4Y28J 2WP9D 1KMIZ 3S9OA 2G3AA 3AE8D 2FYNC 3D6YA 2YIUC 3AEGD 3VRAC 4I7ZC 3AE1C 2WDVC 3Q5RA 3IN6A 3P4RD 1GMJA 1EXIA 2O01J 3AE7C 1VF5B 2ZT9D 2WU5C 2H88C 3SFDC 2P10A 3Q3DA 1YQ3C 1NEKC 3LW5J 1VF5C 4OGQD 1DIPA 3FGAD 3VRAD 4PV1B 3AE9D 1ZRTE 1DD3A 4Z1MH 1RQUA 3T97B 3P4PD 3P4RC 1TU3F 3AE7D 4YT0D 3GF3A 4YSYD 2H88D 4OGQB 2WU5D 3AEDD 2OQQA 2NZ2A 3AE6C 4H13D 4KX6D 2WDQD 1UIXA 3AEFC 1L0VD 3AEBC 3AEAC 3AEED 5C2TD 2H89D 4H44B 3P4PC 3CIRC 1ZOYD 3AECD 2E74C 1KQFB 2WS3C 2E75D 3AEDC 3D6ZA 4H13C 4GDOA 2FBWD 1JB0J 1IK7A 1K05A 1L0VC 4H0LC 1HF9A 2WDVD 2E74D 3P4QD 4YSZD 3CIRD 4R4LA 2MKVA 2WS3D 1NGMB 2V7QJ 2WSEJ 1HJ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FBW C;  3VR9 C;  2BS4 C;  1KF6 C;  3ABV C;  3VRB D;  4YTN D;  3VR8 D;  3AE6 D;  4KX6 C;  3AEF D;  1YQ4 D;  3AEB D;  1KF6 D;  2H89 C;  1ZP0 C;  3P4S C;  1QLB C;  1NEN D;  4YTM D;  1K04 A;  3AE1 D;  3AE9 C;  1YQ4 C;  3P4S D;  2WQY C;  1ZP0 D;  1PV3 A;  1NEN C;  1KFY D;  1KTM A;  2ACZ D;  4YTM C;  2B76 C;  2WDQ C;  3AE5 C;  2WDR D;  1OW6 A;  2WU2 D;  4YSX D;  4YSY C;  3VR9 D;  5C2T C;  2WQY D;  1KFY C;  2ACZ C;  3AE2 C;  3VR8 C;  2B76 D;  2WU2 C;  3AE5 D;  4YSX C;  1E7P C;  3SFE C;  1NEK D;  1YQ3 D;  2BS3 C;  3AE4 D;  4YSZ C;  3AE3 C;  4YXD D;  4YTP D;  1OW8 A;  3AE2 D;  4YT0 C;  3SFE D;  3P4Q C;  2BS2 C;  5C3J C;  2WP9 C;  3AE8 C;  3B71 A;  4YTN C;  4YXD C;  3AE3 D;  3AE4 C;  4YTP C;  3AEG C;  3AEE C;  3AEA D;  3ABV D;  3VRB C;  1ZOY C;  3AEC C;  2WDR C;  5C3J D;  1OW7 A;  2WP9 D;  3S9O A;  2G3A A;  3AEG D;  3VRA C;  3AE1 C;  2WDV C;  3P4R D;  3AE7 C;  2WU5 C;  2H88 C;  3SFD C;  1YQ3 C;  1NEK C;  3VRA D;  3AE9 D;  3P4R C;  3P4P D;  4YT0 D;  3AE7 D;  4YSY D;  2H88 D;  2WU5 D;  3AED D;  3AE6 C;  4KX6 D;  2WDQ D;  3AEF C;  1L0V D;  3AEB C;  3AEA C;  3AEE D;  5C2T D;  2H89 D;  3P4P C;  3CIR C;  1ZOY D;  3AEC D;  2WS3 C;  3AED C;  2FBW D;  1K05 A;  1L0V C;  2WDV D;  3P4Q D;  4YSZ D;  3CIR D;  2WS3 D;  3SFD D;  3AE8 D; 
#chains in the Genus database with same CATH topology
 2FBW C;  3D71 A;  2C0W A;  4ZMD A;  2YMK A;  1H88 A;  3P32 A;  1VDF A;  3A2A A;  1OZH A;  1KZU B;  1SQV J;  1NJI Q;  1ZW0 A;  3H25 A;  2IFN A;  1KF6 D;  2WSC H;  3WU2 H;  2YNY A;  2WPV B;  1OIP A;  5AW7 B;  1T3J A;  3TGU E;  1NU1 D;  1YQ4 C;  4GOF A;  1M1J B;  2K1A A;  2XV5 A;  5DJU B;  3BAS A;  4I7Z B;  1P84 H;  3L75 G;  2WDR D;  2L91 A;  1M7L A;  3T97 A;  1VQM P;  4NPE A;  1NTM J;  3AE3 C;  3GF7 A;  1BCC D;  3SWK A;  1FAV A;  3CL3 D;  2C9N Y;  3OAK A;  3VP9 A;  3B71 A;  4YXD C;  1FBM A;  1SQQ J;  1YJ9 P;  1JY2 O;  5KJ7 D;  3ABV D;  3VRB C;  2FXP A;  2QIW A;  3S9O A;  1YTZ T;  2H7H A;  3P8C E;  3MD0 A;  3P7K A;  1ZXG A;  2YKQ A;  1NHL A;  3CXH I;  2IBZ I;  1GK6 A;  1L0L J;  1QX8 A;  3W67 A;  2KI7 B;  4H13 D;  2AEM A;  1PP9 D;  4ZKU A;  1GU4 A;  4WY4 B;  1L4A C;  3U1A A;  2O3J A;  3V4Q A;  1SQB J;  4K3A A;  2E74 D;  4N78 E;  2E75 B;  4DHI B;  1T3U A;  2QEX P;  2Z4E A;  3E1I A;  1RHZ B;  3SSU A;  4IFD K;  2J58 A;  1AQT A;  3RL0 g;  3GLM A;  3BAT A;  3CD6 P;  2PRR A;  1BGY D;  1ZP0 C;  1VQ4 P;  3P4S C;  5BU5 A;  1LT9 B;  3H1L D;  2GA1 A;  1VQ5 P;  3QH9 A;  1QVG O;  3H1L G;  4PJ0 E;  1SQB G;  3MTU E;  2FYU K;  4AQR D;  2OAR A;  1VQN P;  5CCH A;  3BCC D;  1SQX D;  3SFE C;  4C7R A;  3V2Q A;  1SQV G;  4YSZ C;  2D2C D;  4WY4 D;  1QLE D;  1T8Z A;  1U57 A;  1OWA A;  4OWF A;  3M9B A;  3BCC J;  2M5A B;  2KS1 A;  4IFM A;  3S1K A;  2G3A A;  2WSE H;  1QGK B;  2WMM A;  1GMJ A;  3Q3D A;  1J2J B;  1BSH A;  4Y99 B;  2BCC G;  2VRS A;  1GL2 D;  2YKP A;  4Z1M H;  1EC5 A;  2H8P D;  3RGU A;  3GF3 A;  1X0T A;  4LC1 A;  1BE3 G;  4IOI H;  5CBO A;  1RE4 A;  1FJP A;  3V4W A;  3H32 A;  3A0H H;  5C2T D;  3TF5 A;  5CJ4 A;  3VMA A;  1NGM B;  1M1J A;  3L75 E;  3M0D C;  1JY2 P;  1FE6 A;  1ZME C;  4GOE A;  3I56 P;  2BCC J;  2POH A;  3C1L A;  3PLN A;  1LWU A;  3Q2Y A;  4YXW H;  1SQX E;  2H89 C;  2K9Y A;  2QJY C;  1VQP P;  2I8D A;  2JP3 A;  1DEE G;  1SQP E;  3HUS C;  1JTH A;  1KFY D;  3HE5 B;  4YTM C;  1BE3 E;  1N7S C;  2K9J A;  5AVV B;  3L73 E;  1JY3 N;  1URQ B;  1AJY A;  3U1C A;  1LJ2 A;  1PP9 G;  4MN4 C;  3BVH A;  4WB4 A;  5E79 E;  2IYO A;  4YT0 C;  1FDO A;  4KHX A;  1FZF A;  2Y0C A;  5KLI C;  2WTY A;  4YTN C;  1OFC X;  3RK2 D;  1PGJ A;  2YXR B;  1LTT C;  2Q6Q A;  3PH0 A;  4H44 D;  1MFZ A;  3V2P A;  2WT7 A;  2OYI C;  3WU2 E;  1GL2 C;  5KAF E;  1JTH B;  1M8O B;  3M9Q A;  2KLU A;  2N1T B;  3K5B A;  2K9J B;  3P4R C;  4YT0 D;  2ZFC A;  1NOH A;  3JSV C;  2NZ2 A;  3L74 G;  2HLO A;  2WSS H;  4L73 A;  1L0V D;  1U7J A;  3L74 D;  2A45 H;  1KQF B;  2ZYA A;  1FOS F;  1G2C A;  1PZQ A;  3PHL A;  2FBW D;  3H1J E;  3RK2 B;  1JB0 J;  1HF9 A;  2WDV D;  5E79 H;  4YSZ D;  3GW6 A;  2O01 H;  2QSI A;  1KYO E;  2BCC E;  1LP1 B;  2ZYG A;  1J1E B;  1EDL A;  4KX6 C;  5TIS E;  5APT A;  4H13 B;  1DD4 A;  3P8M C;  4TLF A;  2O1J A;  1Q7Y Q;  3OW2 O;  3A5T A;  1NVO A;  1SQQ G;  3P4S D;  1ZP0 D;  1PV3 A;  1IFD A;  1PIX A;  2B76 C;  4GKG A;  1FZC A;  5DJT B;  3CXH E;  1YBK A;  4YSX D;  3N7N A;  1KIL C;  4HKZ H;  1WRG A;  3H6P A;  3L72 G;  2A06 D;  2D2C C;  2N9Y B;  5AVW B;  1NTK D;  3ZDM A;  2WT7 B;  1BE3 J;  1USE A;  1HWT C;  3SFE D;  4GOD A;  4D6T E;  1KYO H;  3E1R A;  1JY3 O;  1VQ7 P;  5C3J D;  2E75 C;  3G3Z A;  2PP6 A;  1H0T A;  3A0B E;  3L70 E;  4I7Z C;  2IZ0 A;  4HYT B;  3KDP B;  3CX5 I;  1EXI A;  4U3F G;  1VF5 B;  1KB9 E;  2HYN A;  4EIJ A;  3L72 D;  1KQS O;  3M06 A;  1N7S B;  2JEE A;  3VMZ A;  1SP4 A;  1ZOY D;  2WWW A;  3FX0 A;  1HJB A;  1L0V C;  2OTK E;  1NTZ J;  3CCE P;  2Q3E A;  3TGU J;  3FXE A;  4C46 A;  2JO1 A;  1EDK A;  1X9V A;  2JDI H;  5AVY B;  2K3R A;  3PJS K;  1CW5 A;  3AEB D;  3G9R A;  2QVA A;  1QLB C;  2FFD C;  4OGQ C;  3L71 E;  2FYU G;  5KAI H;  4N3Y B;  2WU2 D;  1AQ5 A;  1KFN A;  5CMZ A;  3A0H E;  3CWB E;  2W6J H;  1LGH B;  1RF1 C;  2QJP C;  5CCH C;  1YIJ P;  4I1L A;  1EZV E;  2OYI A;  3FWL A;  3CME P;  3S4R A;  2B9B A;  2WDR C;  1L2P A;  2HOD B;  4AUW A;  3VYI A;  1NTM K;  3PTZ A;  4D6T J;  5CCG A;  1UII A;  1S72 P;  1LT1 A;  3JC2 2;  1WT6 A;  3T97 B;  4EI2 A;  1T6A A;  2QJY B;  2Y0D A;  2ZVN B;  4DJG A;  1JCD A;  1E79 H;  4H44 B;  2E74 C;  3FWN A;  3D6Z A;  1LTJ C;  1LT9 C;  2W8Z A;  5APU A;  1EDI A;  4W7Z A;  2R5D A;  1NU1 E;  1GL2 A;  2M0B A;  3G6E P;  1S3J A;  3VN0 A;  4XE5 B;  2IYP A;  2N1T D;  2V7Q H;  1GU5 A;  5AVR B;  2ZFY A;  1YQ4 D;  2KSE A;  3HD7 B;  2YIU B;  1HVV A;  5AW3 B;  2ZT9 C;  4UB6 H;  2KYV A;  1PGQ A;  1Y47 A;  1N73 C;  2C9L Y;  4YSY C;  2BCC D;  2P7J A;  2WQY D;  4R4M A;  1NTZ G;  5AW8 B;  1L0N J;  2QE7 H;  2WU2 C;  3FXD A;  4H0L B;  1J1D B;  3MUD C;  3HE5 A;  1NU1 G;  1VPC A;  4YTP D;  1A02 F;  1OXZ A;  1RQV A;  2WP9 C;  1YYC A;  5B66 H;  1P84 D;  4GIF A;  1KQG B;  2BEZ F;  1NAY A;  2FXO A;  2WSF H;  1LTS C;  3IFM A;  1N8R Q;  1G1I A;  2H88 C;  1USD A;  1DD3 A;  5AVQ B;  2QRX A;  1L4A A;  4QMA A;  1YHQ P;  5APW A;  2WDQ D;  4PD4 D;  4ZNC A;  3SWY A;  1M1K Q;  1KV4 A;  3AEC D;  3P4P C;  1BGY G;  1IK7 A;  2PAJ A;  3H1K G;  3P4Q D;  1NTM D;  4R4L A;  3AE8 D;  1S5L X;  3CCQ P;  1NTK J;  3D70 A;  4B86 A;  2LR2 A;  1QEX A;  2FFD A;  2Y9Y A;  3HE4 B;  5KLV K;  2FYU D;  2Q3I A;  2P67 A;  1IZN B;  1L0L G;  3AE6 D;  1JNM A;  3M91 A;  2XKM A;  1K04 A;  2M3B A;  5KLV D;  2Q7C A;  4WY4 C;  2E43 A;  3H1J J;  1YJW P;  4N78 D;  2YO3 A;  3B4S A;  3CCR P;  3V6I A;  2ACZ D;  3H32 B;  1RF0 A;  2N9B A;  3KPE A;  2R32 A;  3C8V A;  1L4A D;  4YSX C;  3HUS A;  2QM7 A;  1BCC J;  3AE4 D;  2R3C A;  2V4H A;  2AXT E;  1IC2 A;  3L74 J;  1R8E A;  1Y9B A;  3TK1 A;  1EDJ A;  3TNU B;  2WVR A;  2KSJ A;  1YIT P;  1OW7 A;  1BCC G;  3E7K A;  4Y28 J;  3BCC E;  1VQ8 P;  2XZR A;  3D6Y A;  3QWO C;  3VRA C;  4IFF A;  1SS1 A;  2M3E A;  2HPC B;  2WU5 C;  1K73 Q;  2O1K A;  1BCC E;  1JOC A;  3RL0 B;  5CCH D;  3L75 D;  1RQU A;  3I55 P;  3RL0 D;  3H1J G;  3MHV A;  1KIL D;  3HUS B;  3AEA C;  1Q82 Q;  3CIR C;  3HD7 A;  1FDM A;  3L35 A;  4H13 C;  3JCU H;  1SQP D;  2LKM A;  1SQX J;  1KYO I;  5GTI H;  4OH8 B;  2W6B A;  3CC7 P;  1SQB K;  1DEB A;  2J5U A;  1XTC C;  2ITA A;  5L8R J;  5AVZ B;  4TT3 H;  1PPJ E;  2ZYD A;  1RH5 B;  2R5B A;  3CX5 H;  3LIE A;  2LXB A;  1NWQ A;  3H1I D;  3PP5 A;  1X79 B;  4JYC A;  2R44 A;  3EWK A;  5APQ A;  1NEN C;  2B88 A;  3VMX A;  1NTZ K;  1OW6 A;  3A7O A;  3TNU A;  5KLV G;  1ZN5 A;  2M5A A;  2ACZ C;  3R4Y A;  2E74 B;  3VR8 C;  3M9H A;  1FZC C;  5TJH A;  1L0L K;  3Q5P A;  5C39 A;  1TFF A;  2O01 N;  1GK4 A;  1S1C X;  3MP7 B;  4WVZ A;  2QJK B;  3L73 D;  1KC8 Q;  3CI9 A;  1JY2 N;  3CX5 E;  4L75 A;  3RBZ A;  1OX3 A;  2WPS A;  2FYN C;  2YIU C;  1NTZ E;  4AYC A;  1CI6 A;  1LTG C;  3AE7 C;  3CMA P;  3RL0 C;  2BAS A;  2FKW B;  1URQ C;  2NPS C;  2XDJ A;  3AE9 D;  1YJN P;  3P4P D;  2YXQ B;  2WU5 D;  1R5S A;  1YI2 P;  2OQQ A;  3RK3 C;  4DCK A;  2QA4 P;  1SQQ D;  4CPG A;  2A45 G;  1LWU B;  3KQG A;  2R3S A;  2OYH A;  1JY3 P;  4W80 A;  5CBN A;  3L4F A;  1AA0 A;  4L74 A;  1PP9 J;  3L71 G;  1SQV E;  2W83 C;  3AEF D;  3CWB D;  4RJT A;  5KLV J;  3NTN A;  2YKO A;  2IBZ D;  1VL2 A;  1CZQ A;  1VF5 D;  5KAF H;  1KIL A;  2PGD A;  1N2D C;  2IDB A;  2KS1 B;  1IFP A;  1MZ9 A;  4ASV A;  2FYN B;  3TYY A;  4D6T D;  2WDQ C;  2E76 D;  4Y99 C;  2WIT A;  2RH0 A;  1T2K D;  4XFJ A;  4RO0 A;  3GMA A;  1VQO P;  1U7M A;  3AE2 C;  3LW5 H;  2B76 D;  1DH3 A;  2IBZ G;  4JQ0 D;  3CWB G;  2RN0 A;  4GT1 A;  1NYH A;  3H1K J;  4YTP C;  3B5N A;  2RKL A;  5B5E H;  1SQQ E;  2WP9 D;  5TIS H;  1IFN A;  1SFC D;  3RK2 C;  3H1L J;  1IK9 A;  3AE1 C;  3H1I J;  1FC2 C;  2L5G B;  2HFE D;  3MZW B;  2OYH B;  3H1H G;  3USS A;  3AE7 D;  3R2P A;  2H88 D;  1NKZ B;  3PRJ A;  3CXH H;  2Q1K A;  2ZJS E;  3W68 A;  3AEF C;  2KK7 A;  1S9K E;  2KZJ A;  1KB9 I;  1SFC A;  3L70 D;  1JMB A;  1SQQ K;  1LTA C;  2YO2 A;  2XU6 A;  2H43 A;  3V2R A;  3VP8 A;  2WS3 D;  3KZI H;  3L73 G;  4NPF X;  3VR8 D;  1KIL E;  3MUD A;  3VON A;  2P58 A;  5KJ7 C;  3L74 E;  1FOS E;  1A02 J;  4FJV A;  1PGO A;  2Q9I A;  3A0B H;  3H1J D;  1BDD A;  4K35 A;  4WBA A;  4RES B;  1S5L E;  1KB9 H;  1RF0 C;  5K5G B;  4PV1 C;  2KP8 A;  2WQY C;  2A45 I;  1BSN A;  5C2T C;  1FZB A;  3WMM 0;  5AW0 B;  2E5T A;  1DX7 A;  4U3F J;  1BGY E;  1BDC A;  4LDT A;  3L70 J;  1LTJ B;  3AE8 C;  4KJM A;  1IFJ A;  3AE4 C;  3AEE C;  2I1K A;  5CCG C;  5APS A;  1T2K C;  1L0N K;  3AEG D;  3GHG A;  2WDV C;  1SQX G;  4DOJ A;  4DDI A;  3L72 J;  1JO5 A;  5KAI E;  4PV1 B;  1N86 A;  1ZRT E;  2KNC A;  1QL2 A;  2JWA A;  1UIX A;  3HTK A;  4D6T G;  1AVY A;  2KUB A;  1W2B O;  1OVR A;  1MV8 A;  1N7L A;  2KOG A;  4OVN F;  4LLH A;  3TGU G;  3L37 A;  5AW1 B;  1KQL A;  2V7Q J;  3SFD D;  2WSF J;  1BE3 D;  4HH2 A;  4KT0 J;  3CCS P;  2SPZ A;  3KHU A;  1RF1 A;  2NRG A;  3GHG B;  1FZG A;  1VQ6 P;  1S2E A;  4PV1 D;  2CK3 H;  3Q1M A;  1HGV A;  2GM4 A;  1M57 D;  1NTK E;  3M0A A;  3AE9 C;  4W7Y A;  1L0N E;  1N73 A;  2OYH C;  4ASW A;  2B89 A;  2JR8 A;  4DHZ A;  3L70 G;  2FXM A;  3VR9 D;  1W2E A;  1KFY C;  2P1J A;  2I1J A;  2W6A A;  4H0L D;  4M3L A;  2BS3 C;  1VQK P;  3IAO A;  4DDG A;  3CPW O;  3P4Q C;  2BS2 C;  1ZRT D;  1HGZ A;  3HE4 A;  3UIA A;  2W90 A;  4IL6 H;  1SQB D;  1EQ7 A;  1JM0 A;  5KKZ C;  3AEC C;  1PL5 A;  2E76 C;  3TSI A;  2KNC B;  1NU1 J;  1N73 B;  1L0N G;  3IF4 A;  2NPS B;  1VF5 C;  1DIP A;  3II6 A;  1R5L A;  4YSY D;  1D7M A;  5AW9 B;  3AEE D;  2OGU A;  2E75 D;  2FYZ A;  1K9M Q;  3NXS A;  5AVX B;  3H1I E;  3H1L E;  1L0N D;  2MKV A;  1HJ0 A;  2ZXX A;  2FY8 A;  2N1T C;  3O6Q A;  1HBW A;  2M8R A;  3OA7 A;  3VR9 C;  2HG5 D;  2BS4 C;  1KF6 C;  4BXL A;  5B5E E;  3V2N A;  5CJ0 A;  3EFF K;  1VQL P;  1Q86 Q;  4WY4 A;  1S9K D;  3ITK A;  1Q90 D;  3OJA B;  4C7N B;  3G4S P;  1NEN D;  3CCU P;  2JKV A;  5EFW B;  2J59 M;  1S4X A;  3VOP A;  4WWI A;  2QJK C;  1LTI C;  3GG2 A;  4JPZ B;  1XTG B;  4PD4 I;  3KXD A;  4U7J A;  5KLV E;  2Q5U A;  4LGD E;  2ZXE B;  3L72 E;  3TGU D;  1OMI A;  3O6Q B;  3NMD A;  3KZI E;  3L36 A;  1SQP J;  2OYO A;  3F5H A;  2KIK A;  2IPP A;  4I6L A;  2G8Y A;  2PFX A;  4EYY Q;  1FS0 E;  4C7N A;  1GL2 B;  4EDF A;  2DW3 A;  2IFM A;  2E42 A;  3H1K E;  3LW5 J;  3B8E B;  1MUU A;  3FGA D;  1SQV K;  2QG4 A;  3CCJ P;  4U3F E;  3CCL P;  1LT9 A;  1EZV I;  2KLV A;  3H1H D;  1Q2N A;  3AEB C;  1PPJ D;  2H89 D;  2E5Y A;  4DHJ A;  3MGN A;  2K88 A;  2UWJ E;  3GHG C;  3L71 J;  3RK3 B;  4YTN D;  4PD4 E;  1JEK A;  2N1T A;  2W27 A;  1GDT A;  1H8A A;  4HJG H;  2ZT9 B;  1ZR2 A;  2CPB A;  5KJ7 A;  2OTL P;  2FYU E;  4BRY A;  3CLQ A;  1FZE A;  2QM8 A;  1L0L E;  3AE5 D;  2AXC A;  2WZ7 A;  1LP1 A;  1G1J A;  1RE3 C;  3JCU E;  2WSC J;  5C3J C;  2XND H;  5AVS B;  4PD4 H;  1ZOY C;  1EZV G;  5M1B A;  1URQ A;  5AVT B;  1AVO A;  3CC4 P;  1KIL B;  2FFD B;  2JJL A;  1GD2 E;  1SQP K;  2ZVO B;  3RBX A;  1YQ3 C;  3F89 A;  3V5B A;  1SFC C;  3VRA D;  4I2L C;  2C0X A;  1CSB A;  1IO4 A;  1IFM A;  1SQB E;  3AED D;  1FJK A;  1KYO D;  2B87 A;  3AE6 C;  1J1E C;  1SQV D;  2AEJ A;  4YPC A;  5GTH E;  1FU1 A;  1Y8A A;  3AED C;  3EQ2 A;  2WPQ A;  3BCC G;  1K05 A;  1M56 D;  4H0L C;  3TDK A;  1P84 I;  1RY3 A;  1VQ9 P;  2WSE J;  1EXJ A;  1GW4 A;  4IL6 E;  4DZO A;  3C9I A;  1JCC A;  3ABV C;  3VRB D;  1PP9 E;  2P2U A;  1AFO A;  4BWN A;  2IZ1 A;  1L0L D;  5AW6 B;  3EFG A;  4BRY B;  4XA4 A;  3AE1 D;  1MFT A;  1N7S D;  4RKU J;  4IL6 X;  1KD1 Q;  3AE5 C;  1SFC B;  2HPC A;  3Q5S A;  1JUN A;  5GTH H;  1OVV A;  3CWB J;  2RMZ A;  1CI6 B;  4EOT A;  1MKM A;  4UB8 H;  3AE2 D;  1NTK K;  1LNQ A;  4H44 C;  2JWD A;  1ZR4 A;  1NH4 A;  5AW5 B;  3B5N D;  1J1D C;  3AEA D;  3H1I G;  3CC2 P;  1PFI A;  2NPS D;  3N4X A;  2B87 B;  3B5N C;  5CCG D;  1KFM A;  3Q5R A;  1K8A Q;  1NO4 A;  2ZT9 D;  4JBZ A;  2P10 A;  1H89 A;  1GZL A;  1NEK C;  2KZI A;  3WUV A;  4UB6 E;  4JF7 A;  3HD7 C;  1P84 E;  4I6M C;  1SLQ A;  3CX5 D;  2NPS A;  2WS3 C;  1H0T B;  2GUS A;  3B5N B;  1FZC B;  2XNX A;  3VMY A;  4UB8 E;  5KKZ B;  1KOR A;  5B66 E;  3H1H E;  1M90 Q;  3CCV P;  1FDI A;  1ZLL A;  2Y0E A;  1IFI A;  3WUT A;  4YTM D;  1HUC A;  3G71 P;  5CHX A;  3L75 J;  3MIW A;  5KTB A;  1KTM A;  3HTK B;  1JMM A;  5BU8 B;  1RE3 A;  2Z5I A;  3M0D A;  1SVF A;  5BVZ A;  3BRT B;  1E7P C;  1WMK A;  1W5C E;  1NEK D;  3P8C D;  5APX A;  1G2C B;  1N7S A;  1GTW A;  1KB9 D;  1OW8 A;  2KXP B;  5H2F H;  2BEQ D;  3HRN A;  1RF1 B;  4DT0 A;  3U59 A;  2Z5H A;  3IN6 A;  1NTK G;  1S5L H;  2IX7 C;  2GUV A;  4OGQ D;  4PJ0 H;  2OYI B;  1TU3 F;  4OGQ B;  1BGY J;  4L76 A;  5AW2 B;  1NU1 K;  5AVU B;  3I5C A;  1GW3 A;  1KN7 A;  1OVU A;  3L71 D;  4NPD A;  2AXT H;  3CIR D;  4O9B A;  5H2F E;  3CCM P;  1PGP A;  2HR3 A;  1X8Y A;  1HH0 A;  1NAF A;  1FZA A;  1ZV8 A;  2K37 A;  2Y9Z A;  1L4A B;  2CPS A;  3RK3 E;  1YTZ I;  1IJD B;  2E76 B;  1LWU C;  3SWF A;  1PPJ G;  1NTM E;  3IR9 A;  2WPR A;  2HOD A;  1EZV D;  1LTJ A;  3LID A;  2YMY A;  2KB7 P;  1E5W A;  5APV A;  1SQX K;  3KYQ A;  4N6J A;  4A7P A;  1NTZ D;  1QVF O;  2QJP B;  3H1K D;  3L73 J;  1YQ3 D;  2LXC B;  4YXD D;  5APY A;  1NKN A;  1Z56 A;  5AW4 B;  1RE4 C;  1Q81 Q;  3VTP C;  5GTI E;  1HTL C;  2D2C B;  3O8Z A;  2A06 G;  4U3F D;  3AE3 D;  3CXH D;  3AEG C;  4HB1 A;  2MJZ A;  1KMI Z;  2A06 E;  3BRV B;  1X22 A;  1M1J C;  3P4R D;  3H1H J;  3WUU A;  3NFQ A;  2O01 J;  4ZKP A;  3SFD C;  1NTM G;  2OTJ P;  3A3Y B;  2ZAE B;  4KX6 D;  1LTB C;  1AV1 A;  2AEF A;  3HD7 D;  2FYU J;  1QL1 A;  3RK3 D;  4GDO A;  5KLI B;  2IBZ E;  1SQP G;  4JYB A;  1URQ D; 
#chains in the Genus database with same CATH homology
 1S5L X;  2E75 B;  2FBW C;  1KOR A;  2JO1 A;  3D71 A;  3O6Q A;  2WSF J;  1EXJ A;  2QSI A;  3D70 A;  2YMK A;  1ZME C;  3VR9 C;  2BS4 C;  1KF6 C;  3ABV C;  3VRB D;  4KT0 J;  4YTN D;  2J5U A;  5L8R J;  3VR8 D;  1KIL E;  4TT3 H;  3AE6 D;  3RL0 g;  3GLM A;  1FDI A;  4KX6 C;  3AEF D;  3H25 A;  1Q90 D;  3Q2Y A;  1YQ4 D;  3AEB D;  1KF6 D;  4PV1 D;  2H89 C;  2K9Y A;  3G9R A;  2QJY C;  1DD4 A;  1ZP0 C;  4H13 B;  3RK3 E;  3Q1M A;  1QLB C;  3P4S C;  1NEN D;  1VL2 A;  4YTM D;  1K04 A;  2WPV B;  3AE1 D;  2JP3 A;  2ZT9 B;  1VF5 D;  4OGQ C;  2E76 B;  3AE9 C;  2ZT9 C;  4RKU J;  2IDB A;  1YQ4 C;  4IL6 X;  4PV1 C;  3EWK A;  3SFD D;  3P4S D;  2WQY C;  1ZP0 D;  1PV3 A;  1NEN C;  1KFY D;  1KTM A;  2ACZ D;  1PIX A;  4YTM C;  2B76 C;  4I7Z B;  2WDQ C;  3AE5 C;  2WDR D;  1OW6 A;  2WU2 D;  4YSX D;  4YSY C;  2E76 D;  3VR9 D;  2QJK C;  5C2T C;  3Q5S A;  2WQY D;  3C8V A;  4R4M A;  4XFJ A;  1AJY A;  1KFY C;  3GMA A;  2ACZ C;  3R4Y A;  3AE2 C;  2E74 B;  3VR8 C;  2B76 D;  2WU2 C;  3AE5 D;  4YSX C;  2D2C C;  1E7P C;  3SFE C;  1WMK A;  4H0L D;  4U7J A;  1NEK D;  4H0L B;  1YQ3 D;  2BS3 C;  3AE4 D;  4YSZ C;  2QJP C;  3AE3 C;  4YXD D;  4YTP D;  3GF7 A;  1MKM A;  1OW8 A;  1OMI A;  3AE2 D;  3IAO A;  3Q5P A;  4YT0 C;  3SFE D;  1R8E A;  3P4Q C;  2D2C D;  2WSC J;  1FDO A;  1Y9B A;  4H44 C;  2BS2 C;  2BEQ D;  1RQV A;  5C3J C;  1NYH A;  2WP9 C;  2D2C B;  3AE8 C;  1U57 A;  5KLI C;  3B71 A;  4YTN C;  4YXD C;  3AE3 D;  3AE4 C;  1S1C X;  4YTP C;  2G8Y A;  3AEG C;  3AEE C;  1KQG B;  3AEA D;  2BEZ F;  5KKZ C;  3ABV D;  3VRB C;  1ZOY C;  3AEC C;  2WDR C;  5C3J D;  1OW7 A;  1PL5 A;  2E75 C;  2E76 C;  2FXP A;  2QIW A;  4H44 D;  5M1B A;  4Y28 J;  2WP9 D;  1KMI Z;  3S9O A;  2G3A A;  3AE8 D;  2FYN C;  3D6Y A;  2YIU C;  3AEG D;  3VRA C;  4I7Z C;  3AE1 C;  2WDV C;  3Q5R A;  3IN6 A;  3P4R D;  1GMJ A;  1EXI A;  2O01 J;  3AE7 C;  1VF5 B;  2ZT9 D;  2WU5 C;  2H88 C;  3SFD C;  2P10 A;  3Q3D A;  1YQ3 C;  1NEK C;  3LW5 J;  1VF5 C;  4OGQ D;  1DIP A;  3FGA D;  3VRA D;  4PV1 B;  3AE9 D;  1ZRT E;  1DD3 A;  4Z1M H;  1RQU A;  3T97 B;  3P4P D;  3P4R C;  1TU3 F;  3AE7 D;  4YT0 D;  3GF3 A;  4YSY D;  2H88 D;  4OGQ B;  2WU5 D;  3AED D;  2OQQ A;  2NZ2 A;  3AE6 C;  4H13 D;  4KX6 D;  2WDQ D;  1UIX A;  3AEF C;  1L0V D;  3AEB C;  3AEA C;  3AEE D;  5C2T D;  2H89 D;  4H44 B;  3P4P C;  3CIR C;  1ZOY D;  3AEC D;  2E74 C;  1KQF B;  2WS3 C;  2E75 D;  3AED C;  3D6Z A;  4H13 C;  4GDO A;  2FBW D;  1JB0 J;  1IK7 A;  1K05 A;  1L0V C;  4H0L C;  1HF9 A;  2WDV D;  2E74 D;  3P4Q D;  4YSZ D;  3CIR D;  4R4L A;  2MKV A;  2WS3 D;  1NGM B;  2V7Q J;  2WSE J;  1HJ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...