3AEDC

Crystal structure of porcine heart mitochondrial complex ii bound with 2-iodo-n-phenyl-benzamide
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with 2-Iodo-N-phenyl-benzamide
rcsb
total genus 48
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3aedC01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3aedC02
4YSZC 4YSXC 2WP9D 2BS3C 1YQ4C 1PV3A 3AE7C 3AEDD 3AE2D 2WDVC 3AE5C 1OW8A 5C2TC 3AE1D 2ACZC 2WS3D 3VRBC 1YQ3C 4YT0C 4YXDD 2WU2D 3AEGC 1KF6D 3P4RC 4YSZD 3AEFC 4KX6C 2WQYC 3AE9D 1E7PC 3ABVC 3P4SC 3AE7D 2BS4C 3AE6C 3AEAC 4YTND 3VRAC 3VR8D 1OW6A 3SFDD 2ACZD 1ZP0C 3SFEC 1NEND 1KFYC 4YTPD 5C3JC 3AEEC 2H89C 3AE3C 1NEKC 2G3AA 3P4QD 3AEBC 1K05A 2B76D 3AEFD 1KTMA 1K04A 3P4SD 4YSYC 1QLBC 3CIRC 3AE8C 2WU5C 2WDQC 1L0VC 4YSXD 1YQ4D 3AECC 1ZOYC 2WDRC 2FBWC 2WDVD 3AE5D 4YTMC 2H88C 2H89D 3AE3D 3AEED 5C2TD 3P4PC 3AE4C 2WP9C 3VRBD 1YQ3D 4YT0D 3CIRD 3AEDC 3AEGD 3P4RD 4KX6D 2WQYD 3ABVD 3AE1C 3AE6D 2WS3C 3AEAD 1ZOYD 3S9OA 3VR9C 3VRAD 4YXDC 1OW7A 2BS2C 2WU2C 1KF6C 1ZP0D 3SFED 3AE9C 1KFYD 5C3JD 1NEKD 4YTNC 3AEBD 3VR8C 3SFDC 4YSYD 3B71A 1NENC 3VR9D 2WU5D 3AE8D 3AE2C 4YTPC 2WDQD 1L0VD 3AECD 3P4QC 2B76C 2WDRD 2FBWD 4YTMD 2H88D 3P4PD 3AE4D
chains in the Genus database with same CATH superfamily
4YSZC 2ZT9B 2YKOA 3IN6A 3O6QA 4DZOA 2QSIA 1SQVG 2WZ7A 3TDKA 4YXDD 4R4LA 2E75B 3P4RC 1HJ0A 4D6TJ 3RBXA 4EDFA 3GHGA 1IFPA 1FBMA 4PJ0H 1PP9J 1NEND 3HTKB 3I55P 2QA4P 2H43A 1BSNA 5AW6B 1HWTC 2KB7P 5AW4B 1PL5A 1SFCD 3TSIA 2WU5C 1Z56A 1NTKG 1NH4A 3AECC 1P84H 4OWFA 3L75J 1GL2D 1SQVK 5BU8B 2H88C 1NU1E 3Q2YA 1ZR4A 1NYHA 3EQ2A 4RO0A 1AQTA 1IO4A 1BCCG 2QJYB 3H1JE 3VYIA 2P10A 1CW5A 1N7SC 2O01N 3L74E 3GG2A 1GU5A 3IF4A 2Y0CA 2FFDC 3E7KA 4PJ0E 2N1TC 1NEKD 1LTJA 1AVYA 4I6LA 3QWOC 2M5AB 4TLFA 3NMDA 1K9MQ 3B71A 1GW4A 2WDQD 5B5EH 3SWKA 3TYYA 2E76B 3BCCE 2M3EA 3B5NA 4KT0J 1OVUA 4WY4B 3FGAD 1LWUB 1CI6A 1Y9BA 1PGPA 4JPZB 1AA0A 3G71P 3AEFC 3U1CA 3V6IA 1KILC 2Z5HA 3T97A 1RE3A 3L72G 4LLHA 1NU1D 1AQ5A 3E1IA 1LTBC 4DT0A 1U7JA 1VF5D 3AE3C 4WB4A 1HGZA 2QEXP 1JTHA 2J58A 5B5EE 3P4SD 2W6AA 1LT9C 3L71D 3O8ZA 2HG5D 4KHXA 4NPEA 3L74D 4BRYB 1SS1A 3JCUH 1ZMEC 1KQLA 1NTME 3AEED 3G6EP 1VQ4P 2IZ1A 3CCLP 4FJVA 4HKZH 1AV1A 3P4RD 3AE1C 3L70G 2HLOA 5DJUB 5KLVK 3CPWO 4RKUJ 2KSEA 1P84D 3H1HE 2R3SA 3CC4P 3HD7B 3R4YA 3CC7P 3H1JJ 1NO4A 2E75C 1DIPA 1KQGB 2WU5D 3AE2C 1KB9I 2FXOA 4GODA 2PAJA 3AECD 3C1LA 4C7NA 1FZCA 3JCUE 1J1DC 4BWNA 2Z4EA 2H88D 2WTYA 2PRRA 2OYIB 1R5LA 2BCCG 3F5HA 1PFIA 1N7SD 1NTZE 4RJTA 4KJMA 3BCCJ 3HE4B 1N86A 4KX6C 1RE4C 3V2RA 1SQXE 1YHQP 2WSCH 3ABVC 2N1TD 4DHJA 2LKMA 3V5BA 4I7ZB 2QJYC 1EZVE 2YKPA 1M1JA 3H1KD 4LDTA 2N9YB 3L4FA 1FJPA 2H8PD 3CWBG 2WPVB 3A2AA 2GA1A 1L0NE 2QJKB 3V4WA 1W2EA 3LIDA 1JUNA 1T3UA 5KLIB 4WWIA 4R4MA 3WUVA 2IBZE 4I2LC 1BGYG 1SFCB 2E76C 3AEDC 1VQLP 2HODA 1GL2B 3BVHA 3A0HH 4EI2A 2Q5UA 2ZYDA 3CMEP 2KK7A 1NTMJ 3RBZA 1E5WA 1LWUC 3L71G 3JC22 2XKMA 3PJSK 4U3FD 5CMZA 2IZ0A 3M06A 2ZYAA 2K9YA 3CCMP 2B76C 3GF7A 3H1HJ 1FDMA 1SQXD 1KYOI 2NPSA 5E79H 3HUSA 2JP3A 1EZVD 1G1JA 2A06E 5AW2B 1USDA 1KQFB 3AE1D 1JOCA 3U59A 2Y9ZA 3V2NA 1J2JB 2KZJA 3A0HE 1LTTC 1GD2E 2AXTH 3H1IJ 2ZXXA 5AVVB 4JYCA 4DHIB 4L75A 1R8EA 2E75D 2I1JA 5BU5A 5EFWB 3HRNA 1N73B 4YXWH 1NTZJ 1L4AA 1SQQJ 1KILA 1PGJA 3WU2E 3P7KA 1DEEG 2K9JA 1KTMA 1EXIA 1LTAC 3HD7C 4NPDA 2CK3H 4L73A 1FE6A 2O3JA 2WMMA 2KNCA 1VF5B 4YTMC 2H89D 2XNDH 2FYUJ 1NWQA 2WP9C 1L0NJ 2DW3A 3H1KG 4KX6D 3ABVD 2AXTE 1L2PA 5AVQB 5K5GB 3TGUE 1H0TA 2JWDA 1QEXA 4W7YA 2MJZA 2OYIC 3E1RA 1QVFO 3RL0g 1TFFA 2A06D 1SP4A 1OMIA 1UIIA 1NTKE 2H7HA 1M7LA 2WSCJ 2OARA 1VQ9P 3PTZA 1NKNA 3MUDC 1KMIZ 2E76D 3AEDD 1SQBJ 4K35A 3HTKA 4U3FG 5KLIC 2KLVA 1BE3G 1ZRTE 1URQD 2NRGA 3AEAC 2KSJA 5APQA 1G1IA 4IL6H 1OW6A 4D6TE 1LJ2A 1N7SB 3HE5A 3M0DA 1S9KD 1H8AA 1IFNA 4IOIH 1PP9E 2A45H 2IPPA 2B76D 3H1LG 2FY8A 4B86A 4DOJA 1IFIA 3F89A 1H88A 1A02J 2WWWA 2OYHB 2B88A 1OVRA 5KAFH 5APTA 2AEMA 3VTPC 3CIRD 2M5AA 2GUSA 1E79H 4H0LD 2ZYGA 2Q7CA 3L72E 3VMAA 3OAKA 1ZOYD 3S9OA 1FDIA 1SQVJ 3BATA 2PP6A 3AE9C 2K3RA 4IL6E 4WY4A 2KS1B 3CXHI 1VQKP 3LW5J 3HD7D 1J1EB 1KB9E 3TGUJ 1M1KQ 5CBOA 1N8RQ 4EOTA 4ZKPA 4YTMD 1DD4A 3A5TA 2W27A 2WP9D 4IL6X 3BRVB 1LT9B 1NTKJ 3V4QA 2BEZF 1PGQA 5KAFE 3USSA 1CSBA 3H32A 2P1JA 2R5DA 3LIEA 1PP9D 1JB0J 2JO1A 1IJDB 2KOGA 1PZQA 1FOSE 2POHA 3P4SC 1RF0A 1WT6A 3L75D 2JJLA 3AEEC 1KD1Q 4YSYC 1QLBC 2B89A 3AE8C 4IFFA 5AVUB 1ZN5A 3H6PA 1HH0A 1DD3A 4GOFA 2R32A 5TISH 1J1DB 3W67A 3PHLA 2V7QJ 3GLMA 2QIWA 3G4SP 3AEAD 4PD4D 3IFMA 4JYBA 4ASVA 2R5BA 2W83C 2KUBA 3G3ZA 3L72J 1QX8A 1JO5A 1T3JA 1S1CX 3D71A 1BGYE 3CCQP 1ZXGA 1HF9A 4IFDK 2FXMA 2YMKA 1NKZB 2C9LY 5TISE 2Z5IA 2WSEJ 1L0LE 1FJKA 2XU6A 1U57A 1VL2A 4YPCA 3WUUA 4UB6H 1M8OB 2OYHC 5CCGC 1SQPG 1X22A 1N2DC 3AE9D 3TNUA 3FX0A 3L70J 2SPZA 1OXZA 3VMXA 4EIJA 1RH5B 3CX5I 1SFCA 4N78E 4WVZA 1URQB 3RK2B 1W5CE 1GL2A 2IDBA 2HR3A 1SQPK 1J1EC 5KLVG 3SSUA 2AEJA 2KLUA 4UB6E 3OJAB 4K3AA 3H1JD 3L75G 1RF1B 2BCCJ 1HUCA 1DX7A 1QLED 1FOSF 3GF3A 2HPCA 3H25A 2QRXA 4H0LB 1T6AA 3VR8C 5AVSB 1KORA 1PPJE 1JNMA 4YSYD 3AE8D 5APUA 1EQ7A 2YMYA 1EC5A 3CWBJ 2A45G 1G2CB 3BCCD 3CLQA 3L37A 2KP8A 5AW8B 3AE5C 5C2TC 1N73A 4NPFX 1BGYJ 1FZFA 4XE5B 3L73E 1PIXA 4DHZA 2KI7B 2WQYC 1S5LE 3H1IE 2M3BA 1L0LJ 2L91A 4GT1A 1OZHA 4ZMDA 1WRGA 2H89C 1LTGC 3A7OA 1SQQE 3N4XA 5C39A 2AEFA 2QJPB 1L0VC 2MKVA 1VPCA 3UIAA 1NTMD 5AVYB 5CCGD 3I56P 2FYUE 1PPJD 2LXCB 2CPBA 4Y99C 1M90Q 5KJ7C 4BXLA 3CCSP 3A3YB 3H1LE 3H1HD 4H44C 1NGMB 1VQ5P 4YTNC 2RH0A 3RGUA 3CXHE 3M9BA 4N3YB 5TJHA 2O1KA 1NU1G 1YBKA 1LT1A 3EFFK 1UIXA 2WPSA 4EYYQ 3SWYA 1HGVA 4PV1C 3B5NB 2OTJP 3H1JG 4JBZA 4O9BA 3L74G 1URQC 1EXJA 1CI6B 1N7SA 3RK2C 1OW8A 2JR8A 4GDOA 2Q3EA 3WU2H 2FFDA 1SQBE 4XA4A 1NTZD 3NFQA 5AW5B 1SQQD 4GKGA 2N1TA 2WT7A 2W8ZA 2YIUB 3MTUE 4DDIA 4ZNCA 1S2EA 3KPEA 1USEA 4MN4C 2E5YA 3CCUP 3CCRP 1OX3A 3Q5RA 1NU1K 1MZ9A 5CJ4A 3VR8D 1IFDA 1RF1C 1ZP0C 1Q82Q 1JTHB 3L73J 2FKWB 2FYUD 3WMM0 3CI9A 1L0ND 3CIRC 4C46A 3LW5H 2IFMA 4H0LC 5CCHC 5CJ0A 2W6JH 2BEQD 1ZOYC 3AE5D 3SWFA 2IBZD 5C2TD 3P4PC 1X9VA 1YTZT 1LTIC 4DCKA 2WQYD 1XTGB 3B8EB 2WVRA 1ZV8A 2J59M 4W80A 3D6YA 1P84I 2WITA 1JY3N 1N7LA 1OW7A 5KKZB 1KF6C 2QM8A 1SQVE 1NHLA 1BE3J 2E43A 1HBWA 1LT9A 4OGQC 2NZ2A 3SFDC 3CX5H 3Q3DA 1NTMG 4DDGA 3GHGC 4C7NB 1L0VD 1SQBD 1FZCB 3VOPA 4U7JA 2IX7C 3H1LJ 2Y0DA 2RKLA 1PV3A 1FAVA 3BASA 3VONA 1LP1B 2YO3A 3H1HG 2QJPC 3TF5A 5BVZA 1VQMP 5GTIH 5KJ7D 1R5SA 1FZEA 2V7QH 3FWNA 4H44D 3C9IA 1BCCE 1QL1A 4YTND 1M1JB 1NTMK 1YJWP 3GW6A 2ACZD 1TU3F 4N6JA 1DEBA 3CX5E 4A7PA 1KFNA 1FS0E 4PV1D 4UB8E 2Q9IA 3FWLA 1YITP 4ZKUA 2VRSA 1NTZG 2OYOA 3KHUA 3RK2D 1SQVD 2ZVOB 1CZQA 1SQXG 1M57D 1DH3A 2QVAA 1RE4A 3MIWA 3I5CA 3V2QA 3B5NC 1EZVG 2WSEH 2HODB 1JM0A 2D2CC 4JF7A 4AQRD 5GTIE 1KB9H 1VQOP 1EDIA 3NXSA 3TGUD 1L0NG 1ZP0D 1MKMA 3RK3E 2YIUC 2IBZG 1NTZK 1RE3C 3CL3D 1NTKD 1KC8Q 5CCHD 3N7NA 5APXA 1SQXK 2K1AA 2NPSB 3M91A 4QMAA 3HUSB 3CCVP 3P4PD 3W68A 1BSHA 1A02F 2WDVC 2P58A 1JY3P 4GIFA 2R3CA 1VQ7P 3CX5D 1L0NK 1JY3O 1LWUA 3VRBC 2N9BA 1URQA 2O1JA 1KF6D 2BS4C 1ZRTD 1AJYA 5DJTB 3VRAC 2PFXA 3K5BA 4OGQD 3SFDD 4WBAA 1LTSC 1L4AB 2JKVA 3SFEC 4D6TD 3L70E 3MZWB 2K9JB 1IZNB 4H13D 5KKZC 2A06G 1YI2P 1BCCJ 4OVNF 4IFMA 2KXPB 1EDJA 2IFNA 2KNCB 5L8RJ 4HH2A 4BRYA 1KN7A 2FBWC 2WPRA 5APSA 1FZCC 1RQVA 2WSFJ 2XV5A 2YXRB 2M0BA 1H0TB 1FZAA 3L72D 2E74B 2ZXEB 1SQPJ 3FXEA 1EDLA 2UWJE 2BCCE 1G2CA 1KYOH 4L76A 3HD7A 2FXPA 2ITAA 1YJ9P 3BRTB 4YTPC 1M1JC 1KB9D 4C7RA 1OVVA 1IK7A 3G9RA 3CWBE 4YSXC 5AW9B 2O01J 3A0BH 2XNXA 5AVRB 3TGUG 1AVOA 3B5ND 1IC2A 1BDCA 2D2CD 3L70D 2WPQA 5APVA 2B87B 2HYNA 2OYIA 5KLVJ 3WUTA 1GK4A 4AUWA 3D70A 2J5UA 2QG4A 4M3LA 1S3JA 3HE4A 3AE7D 1K73Q 1PGOA 3HE5B 4Y99B 1QGKB 1KYOE 2RN0A 3L36A 3VP9A 3AEBC 1YTZI 4H44B 3MUDA 3L71E 2GM4A 2B9BA 3MHVA 2WDRC 2WDVD 2BCCD 2LR2A 3A0BE 1X0TA 4PV1B 1Q81Q 1NTKK 3VRBD 2NPSC 3HUSC 4D6TG 1X8YA 3CD6P 5AVXB 1GU4A 1FDOA 2WSSH 3VRAD 1PP9G 1P84E 1MFZA 3SFED 3CWBD 3QH9A 1T2KC 1OFCX 4Y28J 1YIJP 3VR9D 1VQPP 1RY3A 2I1KA 1SLQA 1BGYD 1L4AC 1VDFA 2FBWD 2ZJSE 4LC1A 5KAIH 1JCDA 1BDDA 1NAYA 1S5LH 2QE7H 1KYOD 3H32B 2YKQA 1W2BO 2Q3IA 3V2PA 1L0LD 1YQ3C 1WMKA 3RL0C 3AEGC 4YSZD 2KIKA 1E7PC 5B66H 1GTWA 3CC2P 5AW1B 2ZFCA 5AW7B 2XDJA 3H1KE 2W6BA 3O6QB 3M0AA 2OQQA 4YTPD 2P7JA 4LGDE 5C3JC 2BASA 2E74C 2QM7A 4I6MC 3ZDMA 4N78D 5AVWB 2ZT9C 4OGQB 3D6ZA 1JCCA 2FYNB 4YSXD 1GW3A 1NU1J 5KAIE 3GHGB 1S72P 4H13B 2V4HA 3CCEP 2A45I 1NJIQ 1JEKA 3CXHH 2G8YA 3L71J 1ZLLA 3L74J 1KILE 2C0XA 4PD4I 2E5TA 5B66E 1YYCA 4U3FE 3RK3B 1MV8A 1S5LX 3Q5SA 2ZFYA 3CCJP 3AEBD 1S4XA 3OA7A 1LP1A 1AFOA 1BE3E 3KDPB 2KYVA 2OTKE 3P4QC 3M0DC 4HB1A 1IK9A 1VQNP 1VQ8P 2WDRD 1EDKA 3VMZA 2PGDA 2CPSA 3GMAA 1XTCC 3PRJA 3P8MC 2BS3C 1LTJB 3MGNA 4TT3H 1H89A 3IAOA 1FC2C 2NPSD 3JSVC 3CMAP 2R44A 2ACZC 4ASWA 2JWAA 3L73D 1X79B 3TNUB 2OTLP 3B4SA 1T2KD 2D2CB 3TK1A 3M9QA 3S4RA 3H1ID 1T8ZA 3KZIH 2G3AA 1K05A 3AEFD 1L4AD 3C8VA 5APYA 1KILD 1K04A 4WY4C 1L0LG 4OH8B 3T97B 3H1KJ 2Q1KA 2JDIH 2IYPA 1KFMA 2Q6QA 2OYHA 5CCGA 3AE3D 1QVGO 3KXDA 3BCCG 5APWA 1YQ3D 1HTLC 2P2UA 1BE3D 3PH0A 3RL0D 3AEGD 2HFED 2YNYA 1GDTA 2XZRA 2M8RA 1Q7YQ 2WS3C 1SVFA 2HPCB 1KV4A 2WU2C 2ZAEB 4RESB 3H1LD 4XFJA 5C3JD 2P67A 2E74D 3KZIE 1L0LK 2IYOA 1RF0C 2ZT9D 2KS1A 3CXHD 2YO2A 2AXCA 1IFJA 4U3FJ 1KZUB 2E42A 1D7MA 2C0WA 1YQ4C 5AW0B 3AE2D 2I8DA 1JY2N 2FYZA 1NAFA 2FYNC 4AYCA 3PLNA 5AVZB 3ITKA 1SQXJ 2WSFH 5CHXA 4YT0C 4UB8H 4H13C 1PPJG 3KYQA 3FXDA 1NVOA 3AE6C 5E79E 1S9KE 1NOHA 1KFYC 1OIPA 1Y8AA 3S1KA 3P4QD 3MP7B 1YJNP 3RK3C 5GTHH 1FU1A 3Q1MA 3L73G 1QL2A 1M56D 3U1AA 5AW3B 3AE4C 2K88A 4CPGA 2O01H 3H1IG 5H2FH 3MD0A 1K8AQ 1Y47A 4I7ZC 1VQ6P 1KQSO 4GOEA 1LTJC 5CBNA 1Q90D 4YXDC 1LGHB 2BS2C 4Z1MH 1MFTA 3OW2O 1SQQG 3VMYA 1SQPE 1ZR2A 2QJKC 1MUUA 3VN0A 4WY4D 1NENC 2B87A 1HVVA 1GZLA 3P32A 4HJGH 5M1BA 2KZIA 2Y9YA 4W7ZA 1RHZB 5GTHE 2FYUG 2JEEA 3Q5PA 1HJBA 1SFCC 4I1LA 1Q86Q 3AE7C 3R2PA 1GL2C 5AVTB 2FFDB 5KJ7A 1GMJA 5H2FE 2WT7B 2WS3D 2N1TB 1SQQK 3VP8A 2WU2D 3P8CE 2YXQB 4PD4H 1FZBA 5KLVE 2RMZA 1BCCD 1EZVI 3KQGA 1JMMA 3L75E 3M9HA 1FZGA 2FYUK 1GK6A 1NEKC 3EWKA 2L5GB 1IFMA 2Y0EA 1JY2P 2WDQC 1LNQA 1YQ4D 1SQBG 2IBZI 1JY2O 1ZW0A 3NTNA 1SQPD 1OWAA 4JQ0D 1KILB 4DJGA 1RQUA 4YT0D 4L74A 2LXBA 3II6A 5KTBA 3AE6D 3VR9C 4PD4E 1RF1A 1N73C 3EFGA 3L35A 1KFYD 2OGUA 3RL0B 4HYTB 2K37A 5CCHA 3RK3D 1SQBK 1VF5C 2GUVA 3IR9A 2C9NY 1Q2NA 3P8CD 2W90A 2ZVNB 5KLVD 1JMBA 3PP5A 1U7MA 3AE4D
chains in the Genus database with same CATH topology
2YMKA 4KT0J 4YSZC 1KMIZ 2ZT9B 4YSXC 2JP3A 2WP9D 2BS3C 1YQ4C 4IL6X 2O01J 2E76D 3IN6A 1PV3A 4TT3H 3AE7C 2BEZF 2WSEJ 3FGAD 3IAOA 1EXJA 3O6QA 3AEDD 3AE2D 2WDVC 3AE5C 2D2CD 1OW8A 5C2TC 1U57A 1VL2A 2QJPC 2FYNC 1KQFB 4GDOA 2QSIA 1GMJA 5KLIC 3AE1D 1Y9BA 1JB0J 2ACZC 2WS3D 2JO1A 1YQ3C 3VRBC 1WMKA 1PIXA 4YT0C 4YXDD 2WU2D 3D70A 3AEGC 4H13C 4R4LA 2E75B 2J5UA 1KF6D 3P4RC 3AEFC 4YSZD 4KX6C 2WQYC 3AE9D 1HJ0A 1ZRTE 1E7PC 3ABVC 4H44D 3P4SC 3AE7D 2BS4C 2D2CB 3AE6C 3AEAC 1AJYA 4YTND 1NEKC 3VRAC 4I7ZB 2QJYC 4OGQD 3Q5RA 3VR8D 1OW6A 3SFDD 1R8EA 2E75D 2ACZD 1ZP0C 3SFEC 1NEND 1TU3F 2OQQA 1KFYC 4YTPD 5C3JC 1VF5D 3AEEC 2H89C 3AE3C 3EWKA 2G3AA 2E74C 2WPVB 3AEBC 1K05A 4H13D 2B76D 3AEFD 3P4QD 4H44B 5KKZC 4PV1D 1KTMA 3C8VA 1EXIA 1K04A 2ZT9C 3P4SD 1PL5A 4YSYC 1QLBC 3CIRC 3AE8C 4OGQB 3D6ZA 2WU5C 4H0LC 2WDQC 5L8RJ 1L0VC 2MKVA 3T97B 4YSXD 1ZMEC 1YQ4D 3AECC 2IDBA 2BEQD 4R4MA 3Q1MA 1ZOYC 2WDRC 1VF5B 2FBWC 2WDVD 3AE5D 1DD3A 4H13B 4YTMC 2H88C 3Q2YA 2H89D 3AE3D 3AEED 3P4PC 5C2TD 3AE4C 4PV1B 1NYHA 2WP9C 1RQVA 2WSFJ 2E76C 3VRBD 1YQ3D 1RQUA 4YT0D 3CIRD 2G8YA 3AEDC 3AEGD 2D2CC 2V7QJ 4H0LD 3P4RD 1KILE 4KX6D 2WQYD 3GLMA 2QIWA 4I7ZC 2P10A 3ABVD 3AE1C 1FDOA 3AE6D 2WS3C 3AEAD 1ZOYD 3S9OA 1FDIA 3VR9C 3VRAD 3D6YA 4RKUJ 2E74B 1Q90D 4YXDC 1OW7A 2BS2C 2WU2C 4Z1MH 3GF3A 1KF6C 3H25A 1ZP0D 3SFED 3AE9C 1S5LX 4H44C 1KFYD 1NGMB 5C3JD 2QJKC 4XFJA 4H0LB 3RL0g 3Q5SA 1NEKD 4YTNC 2E74D 3R4YA 3AEBD 1OMIA 1MKMA 2NZ2A 4OGQC 2FXPA 2YIUC 4Y28J 3RK3E 3SFDC 2E75C 3VR8C 2ZT9D 1KORA 3Q3DA 1DIPA 1KQGB 4YSYD 3B71A 1NENC 3LW5J 3VR9D 2WU5D 3AE8D 3AE2C 5M1BA 4YTPC 2WDQD 1L0VD 1VF5C 1S1CX 2K9YA 2WSCJ 1UIXA 4U7JA 3D71A 3AECD 3P4QC 2B76C 2E76B 3GF7A 1HF9A 4PV1C 2WDRD 2FBWD 3Q5PA 1IK7A 4YTMD 2H88D 3AE4D 3P4PD 1DD4A 3GMAA 3G9RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YSZ C;  4YSX C;  2WP9 D;  2BS3 C;  1YQ4 C;  1PV3 A;  3AE7 C;  3AED D;  3AE2 D;  2WDV C;  3AE5 C;  1OW8 A;  5C2T C;  3AE1 D;  2ACZ C;  2WS3 D;  3VRB C;  1YQ3 C;  4YT0 C;  4YXD D;  2WU2 D;  3AEG C;  1KF6 D;  3P4R C;  4YSZ D;  3AEF C;  4KX6 C;  2WQY C;  3AE9 D;  1E7P C;  3ABV C;  3P4S C;  3AE7 D;  2BS4 C;  3AE6 C;  3AEA C;  4YTN D;  3VRA C;  3VR8 D;  1OW6 A;  3SFD D;  2ACZ D;  1ZP0 C;  3SFE C;  1NEN D;  1KFY C;  4YTP D;  5C3J C;  3AEE C;  2H89 C;  3AE3 C;  1NEK C;  2G3A A;  3P4Q D;  3AEB C;  1K05 A;  2B76 D;  3AEF D;  1KTM A;  1K04 A;  3P4S D;  4YSY C;  1QLB C;  3CIR C;  3AE8 C;  2WU5 C;  2WDQ C;  1L0V C;  4YSX D;  1YQ4 D;  3AEC C;  1ZOY C;  2WDR C;  2FBW C;  2WDV D;  3AE5 D;  4YTM C;  2H88 C;  2H89 D;  3AE3 D;  3AEE D;  5C2T D;  3P4P C;  3AE4 C;  2WP9 C;  3VRB D;  1YQ3 D;  4YT0 D;  3CIR D;  3AED C;  3AEG D;  3P4R D;  4KX6 D;  2WQY D;  3ABV D;  3AE1 C;  3AE6 D;  2WS3 C;  3AEA D;  1ZOY D;  3S9O A;  3VR9 C;  3VRA D;  4YXD C;  1OW7 A;  2BS2 C;  2WU2 C;  1KF6 C;  1ZP0 D;  3SFE D;  3AE9 C;  1KFY D;  5C3J D;  1NEK D;  4YTN C;  3AEB D;  3VR8 C;  3SFD C;  4YSY D;  3B71 A;  1NEN C;  3VR9 D;  2WU5 D;  3AE8 D;  3AE2 C;  4YTP C;  2WDQ D;  1L0V D;  3AEC D;  3P4Q C;  2B76 C;  2WDR D;  2FBW D;  4YTM D;  2H88 D;  3P4P D;  3AE4 D; 
#chains in the Genus database with same CATH topology
 4YSZ C;  2ZT9 B;  2YKO A;  3IN6 A;  3O6Q A;  4DZO A;  2QSI A;  1SQV G;  2WZ7 A;  3TDK A;  4YXD D;  4R4L A;  2E75 B;  3P4R C;  1HJ0 A;  4D6T J;  3RBX A;  4EDF A;  3GHG A;  1IFP A;  1FBM A;  4PJ0 H;  1PP9 J;  1NEN D;  3HTK B;  3I55 P;  2QA4 P;  2H43 A;  1BSN A;  5AW6 B;  1HWT C;  2KB7 P;  5AW4 B;  1PL5 A;  1SFC D;  3TSI A;  2WU5 C;  1Z56 A;  1NTK G;  1NH4 A;  3AEC C;  1P84 H;  4OWF A;  3L75 J;  1GL2 D;  1SQV K;  5BU8 B;  2H88 C;  1NU1 E;  3Q2Y A;  1ZR4 A;  1NYH A;  3EQ2 A;  4RO0 A;  1AQT A;  1IO4 A;  1BCC G;  2QJY B;  3H1J E;  3VYI A;  2P10 A;  1CW5 A;  1N7S C;  2O01 N;  3L74 E;  3GG2 A;  1GU5 A;  3IF4 A;  2Y0C A;  2FFD C;  3E7K A;  4PJ0 E;  2N1T C;  1NEK D;  1LTJ A;  1AVY A;  4I6L A;  3QWO C;  2M5A B;  4TLF A;  3NMD A;  1K9M Q;  3B71 A;  1GW4 A;  2WDQ D;  5B5E H;  3SWK A;  3TYY A;  2E76 B;  3BCC E;  2M3E A;  3B5N A;  4KT0 J;  1OVU A;  4WY4 B;  3FGA D;  1LWU B;  1CI6 A;  1Y9B A;  1PGP A;  4JPZ B;  1AA0 A;  3G71 P;  3AEF C;  3U1C A;  3V6I A;  1KIL C;  2Z5H A;  3T97 A;  1RE3 A;  3L72 G;  4LLH A;  1NU1 D;  1AQ5 A;  3E1I A;  1LTB C;  4DT0 A;  1U7J A;  1VF5 D;  3AE3 C;  4WB4 A;  1HGZ A;  2QEX P;  1JTH A;  2J58 A;  5B5E E;  3P4S D;  2W6A A;  1LT9 C;  3L71 D;  3O8Z A;  2HG5 D;  4KHX A;  4NPE A;  3L74 D;  4BRY B;  1SS1 A;  3JCU H;  1ZME C;  1KQL A;  1NTM E;  3AEE D;  3G6E P;  1VQ4 P;  2IZ1 A;  3CCL P;  4FJV A;  4HKZ H;  1AV1 A;  3P4R D;  3AE1 C;  3L70 G;  2HLO A;  5DJU B;  5KLV K;  3CPW O;  4RKU J;  2KSE A;  1P84 D;  3H1H E;  2R3S A;  3CC4 P;  3HD7 B;  3R4Y A;  3CC7 P;  3H1J J;  1NO4 A;  2E75 C;  1DIP A;  1KQG B;  2WU5 D;  3AE2 C;  1KB9 I;  2FXO A;  4GOD A;  2PAJ A;  3AEC D;  3C1L A;  4C7N A;  1FZC A;  3JCU E;  1J1D C;  4BWN A;  2Z4E A;  2H88 D;  2WTY A;  2PRR A;  2OYI B;  1R5L A;  2BCC G;  3F5H A;  1PFI A;  1N7S D;  1NTZ E;  4RJT A;  4KJM A;  3BCC J;  3HE4 B;  1N86 A;  4KX6 C;  1RE4 C;  3V2R A;  1SQX E;  1YHQ P;  2WSC H;  3ABV C;  2N1T D;  4DHJ A;  2LKM A;  3V5B A;  4I7Z B;  2QJY C;  1EZV E;  2YKP A;  1M1J A;  3H1K D;  4LDT A;  2N9Y B;  3L4F A;  1FJP A;  2H8P D;  3CWB G;  2WPV B;  3A2A A;  2GA1 A;  1L0N E;  2QJK B;  3V4W A;  1W2E A;  3LID A;  1JUN A;  1T3U A;  5KLI B;  4WWI A;  4R4M A;  3WUV A;  2IBZ E;  4I2L C;  1BGY G;  1SFC B;  2E76 C;  3AED C;  1VQL P;  2HOD A;  1GL2 B;  3BVH A;  3A0H H;  4EI2 A;  2Q5U A;  2ZYD A;  3CME P;  2KK7 A;  1NTM J;  3RBZ A;  1E5W A;  1LWU C;  3L71 G;  3JC2 2;  2XKM A;  3PJS K;  4U3F D;  5CMZ A;  2IZ0 A;  3M06 A;  2ZYA A;  2K9Y A;  3CCM P;  2B76 C;  3GF7 A;  3H1H J;  1FDM A;  1SQX D;  1KYO I;  2NPS A;  5E79 H;  3HUS A;  2JP3 A;  1EZV D;  1G1J A;  2A06 E;  5AW2 B;  1USD A;  1KQF B;  3AE1 D;  1JOC A;  3U59 A;  2Y9Z A;  3V2N A;  1J2J B;  2KZJ A;  3A0H E;  1LTT C;  1GD2 E;  2AXT H;  3H1I J;  2ZXX A;  5AVV B;  4JYC A;  4DHI B;  4L75 A;  1R8E A;  2E75 D;  2I1J A;  5BU5 A;  5EFW B;  3HRN A;  1N73 B;  4YXW H;  1NTZ J;  1L4A A;  1SQQ J;  1KIL A;  1PGJ A;  3WU2 E;  3P7K A;  1DEE G;  2K9J A;  1KTM A;  1EXI A;  1LTA C;  3HD7 C;  4NPD A;  2CK3 H;  4L73 A;  1FE6 A;  2O3J A;  2WMM A;  2KNC A;  1VF5 B;  4YTM C;  2H89 D;  2XND H;  2FYU J;  1NWQ A;  2WP9 C;  1L0N J;  2DW3 A;  3H1K G;  4KX6 D;  3ABV D;  2AXT E;  1L2P A;  5AVQ B;  5K5G B;  3TGU E;  1H0T A;  2JWD A;  1QEX A;  4W7Y A;  2MJZ A;  2OYI C;  3E1R A;  1QVF O;  3RL0 g;  1TFF A;  2A06 D;  1SP4 A;  1OMI A;  1UII A;  1NTK E;  2H7H A;  1M7L A;  2WSC J;  2OAR A;  1VQ9 P;  3PTZ A;  1NKN A;  3MUD C;  1KMI Z;  2E76 D;  3AED D;  1SQB J;  4K35 A;  3HTK A;  4U3F G;  5KLI C;  2KLV A;  1BE3 G;  1ZRT E;  1URQ D;  2NRG A;  3AEA C;  2KSJ A;  5APQ A;  1G1I A;  4IL6 H;  1OW6 A;  4D6T E;  1LJ2 A;  1N7S B;  3HE5 A;  3M0D A;  1S9K D;  1H8A A;  1IFN A;  4IOI H;  1PP9 E;  2A45 H;  2IPP A;  2B76 D;  3H1L G;  2FY8 A;  4B86 A;  4DOJ A;  1IFI A;  3F89 A;  1H88 A;  1A02 J;  2WWW A;  2OYH B;  2B88 A;  1OVR A;  5KAF H;  5APT A;  2AEM A;  3VTP C;  3CIR D;  2M5A A;  2GUS A;  1E79 H;  4H0L D;  2ZYG A;  2Q7C A;  3L72 E;  3VMA A;  3OAK A;  1ZOY D;  3S9O A;  1FDI A;  1SQV J;  3BAT A;  2PP6 A;  3AE9 C;  2K3R A;  4IL6 E;  4WY4 A;  2KS1 B;  3CXH I;  1VQK P;  3LW5 J;  3HD7 D;  1J1E B;  1KB9 E;  3TGU J;  1M1K Q;  5CBO A;  1N8R Q;  4EOT A;  4ZKP A;  4YTM D;  1DD4 A;  3A5T A;  2W27 A;  2WP9 D;  4IL6 X;  3BRV B;  1LT9 B;  1NTK J;  3V4Q A;  2BEZ F;  1PGQ A;  5KAF E;  3USS A;  1CSB A;  3H32 A;  2P1J A;  2R5D A;  3LIE A;  1PP9 D;  1JB0 J;  2JO1 A;  1IJD B;  2KOG A;  1PZQ A;  1FOS E;  2POH A;  3P4S C;  1RF0 A;  1WT6 A;  3L75 D;  2JJL A;  3AEE C;  1KD1 Q;  4YSY C;  1QLB C;  2B89 A;  3AE8 C;  4IFF A;  5AVU B;  1ZN5 A;  3H6P A;  1HH0 A;  1DD3 A;  4GOF A;  2R32 A;  5TIS H;  1J1D B;  3W67 A;  3PHL A;  2V7Q J;  3GLM A;  2QIW A;  3G4S P;  3AEA D;  4PD4 D;  3IFM A;  4JYB A;  4ASV A;  2R5B A;  2W83 C;  2KUB A;  3G3Z A;  3L72 J;  1QX8 A;  1JO5 A;  1T3J A;  1S1C X;  3D71 A;  1BGY E;  3CCQ P;  1ZXG A;  1HF9 A;  4IFD K;  2FXM A;  2YMK A;  1NKZ B;  2C9L Y;  5TIS E;  2Z5I A;  2WSE J;  1L0L E;  1FJK A;  2XU6 A;  1U57 A;  1VL2 A;  4YPC A;  3WUU A;  4UB6 H;  1M8O B;  2OYH C;  5CCG C;  1SQP G;  1X22 A;  1N2D C;  3AE9 D;  3TNU A;  3FX0 A;  3L70 J;  2SPZ A;  1OXZ A;  3VMX A;  4EIJ A;  1RH5 B;  3CX5 I;  1SFC A;  4N78 E;  4WVZ A;  1URQ B;  3RK2 B;  1W5C E;  1GL2 A;  2IDB A;  2HR3 A;  1SQP K;  1J1E C;  5KLV G;  3SSU A;  2AEJ A;  2KLU A;  4UB6 E;  3OJA B;  4K3A A;  3H1J D;  3L75 G;  1RF1 B;  2BCC J;  1HUC A;  1DX7 A;  1QLE D;  1FOS F;  3GF3 A;  2HPC A;  3H25 A;  2QRX A;  4H0L B;  1T6A A;  3VR8 C;  5AVS B;  1KOR A;  1PPJ E;  1JNM A;  4YSY D;  3AE8 D;  5APU A;  1EQ7 A;  2YMY A;  1EC5 A;  3CWB J;  2A45 G;  1G2C B;  3BCC D;  3CLQ A;  3L37 A;  2KP8 A;  5AW8 B;  3AE5 C;  5C2T C;  1N73 A;  4NPF X;  1BGY J;  1FZF A;  4XE5 B;  3L73 E;  1PIX A;  4DHZ A;  2KI7 B;  2WQY C;  1S5L E;  3H1I E;  2M3B A;  1L0L J;  2L91 A;  4GT1 A;  1OZH A;  4ZMD A;  1WRG A;  2H89 C;  1LTG C;  3A7O A;  1SQQ E;  3N4X A;  5C39 A;  2AEF A;  2QJP B;  1L0V C;  2MKV A;  1VPC A;  3UIA A;  1NTM D;  5AVY B;  5CCG D;  3I56 P;  2FYU E;  1PPJ D;  2LXC B;  2CPB A;  4Y99 C;  1M90 Q;  5KJ7 C;  4BXL A;  3CCS P;  3A3Y B;  3H1L E;  3H1H D;  4H44 C;  1NGM B;  1VQ5 P;  4YTN C;  2RH0 A;  3RGU A;  3CXH E;  3M9B A;  4N3Y B;  5TJH A;  2O1K A;  1NU1 G;  1YBK A;  1LT1 A;  3EFF K;  1UIX A;  2WPS A;  4EYY Q;  3SWY A;  1HGV A;  4PV1 C;  3B5N B;  2OTJ P;  3H1J G;  4JBZ A;  4O9B A;  3L74 G;  1URQ C;  1EXJ A;  1CI6 B;  1N7S A;  3RK2 C;  1OW8 A;  2JR8 A;  4GDO A;  2Q3E A;  3WU2 H;  2FFD A;  1SQB E;  4XA4 A;  1NTZ D;  3NFQ A;  5AW5 B;  1SQQ D;  4GKG A;  2N1T A;  2WT7 A;  2W8Z A;  2YIU B;  3MTU E;  4DDI A;  4ZNC A;  1S2E A;  3KPE A;  1USE A;  4MN4 C;  2E5Y A;  3CCU P;  3CCR P;  1OX3 A;  3Q5R A;  1NU1 K;  1MZ9 A;  5CJ4 A;  3VR8 D;  1IFD A;  1RF1 C;  1ZP0 C;  1Q82 Q;  1JTH B;  3L73 J;  2FKW B;  2FYU D;  3WMM 0;  3CI9 A;  1L0N D;  3CIR C;  4C46 A;  3LW5 H;  2IFM A;  4H0L C;  5CCH C;  5CJ0 A;  2W6J H;  2BEQ D;  1ZOY C;  3AE5 D;  3SWF A;  2IBZ D;  5C2T D;  3P4P C;  1X9V A;  1YTZ T;  1LTI C;  4DCK A;  2WQY D;  1XTG B;  3B8E B;  2WVR A;  1ZV8 A;  2J59 M;  4W80 A;  3D6Y A;  1P84 I;  2WIT A;  1JY3 N;  1N7L A;  1OW7 A;  5KKZ B;  1KF6 C;  2QM8 A;  1SQV E;  1NHL A;  1BE3 J;  2E43 A;  1HBW A;  1LT9 A;  4OGQ C;  2NZ2 A;  3SFD C;  3CX5 H;  3Q3D A;  1NTM G;  4DDG A;  3GHG C;  4C7N B;  1L0V D;  1SQB D;  1FZC B;  3VOP A;  4U7J A;  2IX7 C;  3H1L J;  2Y0D A;  2RKL A;  1PV3 A;  1FAV A;  3BAS A;  3VON A;  1LP1 B;  2YO3 A;  3H1H G;  2QJP C;  3TF5 A;  5BVZ A;  1VQM P;  5GTI H;  5KJ7 D;  1R5S A;  1FZE A;  2V7Q H;  3FWN A;  4H44 D;  3C9I A;  1BCC E;  1QL1 A;  4YTN D;  1M1J B;  1NTM K;  1YJW P;  3GW6 A;  2ACZ D;  1TU3 F;  4N6J A;  1DEB A;  3CX5 E;  4A7P A;  1KFN A;  1FS0 E;  4PV1 D;  4UB8 E;  2Q9I A;  3FWL A;  1YIT P;  4ZKU A;  2VRS A;  1NTZ G;  2OYO A;  3KHU A;  3RK2 D;  1SQV D;  2ZVO B;  1CZQ A;  1SQX G;  1M57 D;  1DH3 A;  2QVA A;  1RE4 A;  3MIW A;  3I5C A;  3V2Q A;  3B5N C;  1EZV G;  2WSE H;  2HOD B;  1JM0 A;  2D2C C;  4JF7 A;  4AQR D;  5GTI E;  1KB9 H;  1VQO P;  1EDI A;  3NXS A;  3TGU D;  1L0N G;  1ZP0 D;  1MKM A;  3RK3 E;  2YIU C;  2IBZ G;  1NTZ K;  1RE3 C;  3CL3 D;  1NTK D;  1KC8 Q;  5CCH D;  3N7N A;  5APX A;  1SQX K;  2K1A A;  2NPS B;  3M91 A;  4QMA A;  3HUS B;  3CCV P;  3P4P D;  3W68 A;  1BSH A;  1A02 F;  2WDV C;  2P58 A;  1JY3 P;  4GIF A;  2R3C A;  1VQ7 P;  3CX5 D;  1L0N K;  1JY3 O;  1LWU A;  3VRB C;  2N9B A;  1URQ A;  2O1J A;  1KF6 D;  2BS4 C;  1ZRT D;  1AJY A;  5DJT B;  3VRA C;  2PFX A;  3K5B A;  4OGQ D;  3SFD D;  4WBA A;  1LTS C;  1L4A B;  2JKV A;  3SFE C;  4D6T D;  3L70 E;  3MZW B;  2K9J B;  1IZN B;  4H13 D;  5KKZ C;  2A06 G;  1YI2 P;  1BCC J;  4OVN F;  4IFM A;  2KXP B;  1EDJ A;  2IFN A;  2KNC B;  5L8R J;  4HH2 A;  4BRY A;  1KN7 A;  2FBW C;  2WPR A;  5APS A;  1FZC C;  1RQV A;  2WSF J;  2XV5 A;  2YXR B;  2M0B A;  1H0T B;  1FZA A;  3L72 D;  2E74 B;  2ZXE B;  1SQP J;  3FXE A;  1EDL A;  2UWJ E;  2BCC E;  1G2C A;  1KYO H;  4L76 A;  3HD7 A;  2FXP A;  2ITA A;  1YJ9 P;  3BRT B;  4YTP C;  1M1J C;  1KB9 D;  4C7R A;  1OVV A;  1IK7 A;  3G9R A;  3CWB E;  4YSX C;  5AW9 B;  2O01 J;  3A0B H;  2XNX A;  5AVR B;  3TGU G;  1AVO A;  3B5N D;  1IC2 A;  1BDC A;  2D2C D;  3L70 D;  2WPQ A;  5APV A;  2B87 B;  2HYN A;  2OYI A;  5KLV J;  3WUT A;  1GK4 A;  4AUW A;  3D70 A;  2J5U A;  2QG4 A;  4M3L A;  1S3J A;  3HE4 A;  3AE7 D;  1K73 Q;  1PGO A;  3HE5 B;  4Y99 B;  1QGK B;  1KYO E;  2RN0 A;  3L36 A;  3VP9 A;  3AEB C;  1YTZ I;  4H44 B;  3MUD A;  3L71 E;  2GM4 A;  2B9B A;  3MHV A;  2WDR C;  2WDV D;  2BCC D;  2LR2 A;  3A0B E;  1X0T A;  4PV1 B;  1Q81 Q;  1NTK K;  3VRB D;  2NPS C;  3HUS C;  4D6T G;  1X8Y A;  3CD6 P;  5AVX B;  1GU4 A;  1FDO A;  2WSS H;  3VRA D;  1PP9 G;  1P84 E;  1MFZ A;  3SFE D;  3CWB D;  3QH9 A;  1T2K C;  1OFC X;  4Y28 J;  1YIJ P;  3VR9 D;  1VQP P;  1RY3 A;  2I1K A;  1SLQ A;  1BGY D;  1L4A C;  1VDF A;  2FBW D;  2ZJS E;  4LC1 A;  5KAI H;  1JCD A;  1BDD A;  1NAY A;  1S5L H;  2QE7 H;  1KYO D;  3H32 B;  2YKQ A;  1W2B O;  2Q3I A;  3V2P A;  1L0L D;  1YQ3 C;  1WMK A;  3RL0 C;  3AEG C;  4YSZ D;  2KIK A;  1E7P C;  5B66 H;  1GTW A;  3CC2 P;  5AW1 B;  2ZFC A;  5AW7 B;  2XDJ A;  3H1K E;  2W6B A;  3O6Q B;  3M0A A;  2OQQ A;  4YTP D;  2P7J A;  4LGD E;  5C3J C;  2BAS A;  2E74 C;  2QM7 A;  4I6M C;  3ZDM A;  4N78 D;  5AVW B;  2ZT9 C;  4OGQ B;  3D6Z A;  1JCC A;  2FYN B;  4YSX D;  1GW3 A;  1NU1 J;  5KAI E;  3GHG B;  1S72 P;  4H13 B;  2V4H A;  3CCE P;  2A45 I;  1NJI Q;  1JEK A;  3CXH H;  2G8Y A;  3L71 J;  1ZLL A;  3L74 J;  1KIL E;  2C0X A;  4PD4 I;  2E5T A;  5B66 E;  1YYC A;  4U3F E;  3RK3 B;  1MV8 A;  1S5L X;  3Q5S A;  2ZFY A;  3CCJ P;  3AEB D;  1S4X A;  3OA7 A;  1LP1 A;  1AFO A;  1BE3 E;  3KDP B;  2KYV A;  2OTK E;  3P4Q C;  3M0D C;  4HB1 A;  1IK9 A;  1VQN P;  1VQ8 P;  2WDR D;  1EDK A;  3VMZ A;  2PGD A;  2CPS A;  3GMA A;  1XTC C;  3PRJ A;  3P8M C;  2BS3 C;  1LTJ B;  3MGN A;  4TT3 H;  1H89 A;  3IAO A;  1FC2 C;  2NPS D;  3JSV C;  3CMA P;  2R44 A;  2ACZ C;  4ASW A;  2JWA A;  3L73 D;  1X79 B;  3TNU B;  2OTL P;  3B4S A;  1T2K D;  2D2C B;  3TK1 A;  3M9Q A;  3S4R A;  3H1I D;  1T8Z A;  3KZI H;  2G3A A;  1K05 A;  3AEF D;  1L4A D;  3C8V A;  5APY A;  1KIL D;  1K04 A;  4WY4 C;  1L0L G;  4OH8 B;  3T97 B;  3H1K J;  2Q1K A;  2JDI H;  2IYP A;  1KFM A;  2Q6Q A;  2OYH A;  5CCG A;  3AE3 D;  1QVG O;  3KXD A;  3BCC G;  5APW A;  1YQ3 D;  1HTL C;  2P2U A;  1BE3 D;  3PH0 A;  3RL0 D;  3AEG D;  2HFE D;  2YNY A;  1GDT A;  2XZR A;  2M8R A;  1Q7Y Q;  2WS3 C;  1SVF A;  2HPC B;  1KV4 A;  2WU2 C;  2ZAE B;  4RES B;  3H1L D;  4XFJ A;  5C3J D;  2P67 A;  2E74 D;  3KZI E;  1L0L K;  2IYO A;  1RF0 C;  2ZT9 D;  2KS1 A;  3CXH D;  2YO2 A;  2AXC A;  1IFJ A;  4U3F J;  1KZU B;  2E42 A;  1D7M A;  2C0W A;  1YQ4 C;  5AW0 B;  3AE2 D;  2I8D A;  1JY2 N;  2FYZ A;  1NAF A;  2FYN C;  4AYC A;  3PLN A;  5AVZ B;  3ITK A;  1SQX J;  2WSF H;  5CHX A;  4YT0 C;  4UB8 H;  4H13 C;  1PPJ G;  3KYQ A;  3FXD A;  1NVO A;  3AE6 C;  5E79 E;  1S9K E;  1NOH A;  1KFY C;  1OIP A;  1Y8A A;  3S1K A;  3P4Q D;  3MP7 B;  1YJN P;  3RK3 C;  5GTH H;  1FU1 A;  3Q1M A;  3L73 G;  1QL2 A;  1M56 D;  3U1A A;  5AW3 B;  3AE4 C;  2K88 A;  4CPG A;  2O01 H;  3H1I G;  5H2F H;  3MD0 A;  1K8A Q;  1Y47 A;  4I7Z C;  1VQ6 P;  1KQS O;  4GOE A;  1LTJ C;  5CBN A;  1Q90 D;  4YXD C;  1LGH B;  2BS2 C;  4Z1M H;  1MFT A;  3OW2 O;  1SQQ G;  3VMY A;  1SQP E;  1ZR2 A;  2QJK C;  1MUU A;  3VN0 A;  4WY4 D;  1NEN C;  2B87 A;  1HVV A;  1GZL A;  3P32 A;  4HJG H;  5M1B A;  2KZI A;  2Y9Y A;  4W7Z A;  1RHZ B;  5GTH E;  2FYU G;  2JEE A;  3Q5P A;  1HJB A;  1SFC C;  4I1L A;  1Q86 Q;  3AE7 C;  3R2P A;  1GL2 C;  5AVT B;  2FFD B;  5KJ7 A;  1GMJ A;  5H2F E;  2WT7 B;  2WS3 D;  2N1T B;  1SQQ K;  3VP8 A;  2WU2 D;  3P8C E;  2YXQ B;  4PD4 H;  1FZB A;  5KLV E;  2RMZ A;  1BCC D;  1EZV I;  3KQG A;  1JMM A;  3L75 E;  3M9H A;  1FZG A;  2FYU K;  1GK6 A;  1NEK C;  3EWK A;  2L5G B;  1IFM A;  2Y0E A;  1JY2 P;  2WDQ C;  1LNQ A;  1YQ4 D;  1SQB G;  2IBZ I;  1JY2 O;  1ZW0 A;  3NTN A;  1SQP D;  1OWA A;  4JQ0 D;  1KIL B;  4DJG A;  1RQU A;  4YT0 D;  4L74 A;  2LXB A;  3II6 A;  5KTB A;  3AE6 D;  3VR9 C;  4PD4 E;  1RF1 A;  1N73 C;  3EFG A;  3L35 A;  1KFY D;  2OGU A;  3RL0 B;  4HYT B;  2K37 A;  5CCH A;  3RK3 D;  1SQB K;  1VF5 C;  2GUV A;  3IR9 A;  2C9N Y;  1Q2N A;  3P8C D;  2W90 A;  2ZVN B;  5KLV D;  1JMB A;  3PP5 A;  1U7M A;  3AE4 D; 
#chains in the Genus database with same CATH homology
 2YMK A;  4KT0 J;  4YSZ C;  1KMI Z;  2ZT9 B;  4YSX C;  2JP3 A;  2WP9 D;  2BS3 C;  1YQ4 C;  4IL6 X;  2O01 J;  2E76 D;  3IN6 A;  1PV3 A;  4TT3 H;  3AE7 C;  2BEZ F;  2WSE J;  3FGA D;  3IAO A;  1EXJ A;  3O6Q A;  3AED D;  3AE2 D;  2WDV C;  3AE5 C;  2D2C D;  1OW8 A;  5C2T C;  1U57 A;  1VL2 A;  2QJP C;  2FYN C;  1KQF B;  4GDO A;  2QSI A;  1GMJ A;  5KLI C;  3AE1 D;  1Y9B A;  1JB0 J;  2ACZ C;  2WS3 D;  2JO1 A;  1YQ3 C;  3VRB C;  1WMK A;  1PIX A;  4YT0 C;  4YXD D;  2WU2 D;  3D70 A;  3AEG C;  4H13 C;  4R4L A;  2E75 B;  2J5U A;  1KF6 D;  3P4R C;  3AEF C;  4YSZ D;  4KX6 C;  2WQY C;  3AE9 D;  1HJ0 A;  1ZRT E;  1E7P C;  3ABV C;  4H44 D;  3P4S C;  3AE7 D;  2BS4 C;  2D2C B;  3AE6 C;  3AEA C;  1AJY A;  4YTN D;  1NEK C;  3VRA C;  4I7Z B;  2QJY C;  4OGQ D;  3Q5R A;  3VR8 D;  1OW6 A;  3SFD D;  1R8E A;  2E75 D;  2ACZ D;  1ZP0 C;  3SFE C;  1NEN D;  1TU3 F;  2OQQ A;  1KFY C;  4YTP D;  5C3J C;  1VF5 D;  3AEE C;  2H89 C;  3AE3 C;  3EWK A;  2G3A A;  2E74 C;  2WPV B;  3AEB C;  1K05 A;  4H13 D;  2B76 D;  3AEF D;  3P4Q D;  4H44 B;  5KKZ C;  4PV1 D;  1KTM A;  3C8V A;  1EXI A;  1K04 A;  2ZT9 C;  3P4S D;  1PL5 A;  4YSY C;  1QLB C;  3CIR C;  3AE8 C;  4OGQ B;  3D6Z A;  2WU5 C;  4H0L C;  2WDQ C;  5L8R J;  1L0V C;  2MKV A;  3T97 B;  4YSX D;  1ZME C;  1YQ4 D;  3AEC C;  2IDB A;  2BEQ D;  4R4M A;  3Q1M A;  1ZOY C;  2WDR C;  1VF5 B;  2FBW C;  2WDV D;  3AE5 D;  1DD3 A;  4H13 B;  4YTM C;  2H88 C;  3Q2Y A;  2H89 D;  3AE3 D;  3AEE D;  3P4P C;  5C2T D;  3AE4 C;  4PV1 B;  1NYH A;  2WP9 C;  1RQV A;  2WSF J;  2E76 C;  3VRB D;  1YQ3 D;  1RQU A;  4YT0 D;  3CIR D;  2G8Y A;  3AED C;  3AEG D;  2D2C C;  2V7Q J;  4H0L D;  3P4R D;  1KIL E;  4KX6 D;  2WQY D;  3GLM A;  2QIW A;  4I7Z C;  2P10 A;  3ABV D;  3AE1 C;  1FDO A;  3AE6 D;  2WS3 C;  3AEA D;  1ZOY D;  3S9O A;  1FDI A;  3VR9 C;  3VRA D;  3D6Y A;  4RKU J;  2E74 B;  1Q90 D;  4YXD C;  1OW7 A;  2BS2 C;  2WU2 C;  4Z1M H;  3GF3 A;  1KF6 C;  3H25 A;  1ZP0 D;  3SFE D;  3AE9 C;  1S5L X;  4H44 C;  1KFY D;  1NGM B;  5C3J D;  2QJK C;  4XFJ A;  4H0L B;  3RL0 g;  3Q5S A;  1NEK D;  4YTN C;  2E74 D;  3R4Y A;  3AEB D;  1OMI A;  1MKM A;  2NZ2 A;  4OGQ C;  2FXP A;  2YIU C;  4Y28 J;  3RK3 E;  3SFD C;  2E75 C;  3VR8 C;  2ZT9 D;  1KOR A;  3Q3D A;  1DIP A;  1KQG B;  4YSY D;  3B71 A;  1NEN C;  3LW5 J;  3VR9 D;  2WU5 D;  3AE8 D;  3AE2 C;  5M1B A;  4YTP C;  2WDQ D;  1L0V D;  1VF5 C;  1S1C X;  2K9Y A;  2WSC J;  1UIX A;  4U7J A;  3D71 A;  3AEC D;  3P4Q C;  2B76 C;  2E76 B;  3GF7 A;  1HF9 A;  4PV1 C;  2WDR D;  2FBW D;  3Q5P A;  1IK7 A;  4YTM D;  2H88 D;  3AE4 D;  3P4P D;  1DD4 A;  3GMA A;  3G9R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...