3AEDC

Crystal structure of porcine heart mitochondrial complex ii bound with 2-iodo-n-phenyl-benzamide
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of porcine heart mitochondrial complex II bound with 2-Iodo-N-phenyl-benzamide
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
total genus 48
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3aedC01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3aedC02
3B71A 2WDQD 4YTPC 2WU5C 1NEND 1YQ3C 1ZP0D 3AE8D 2H88C 2BS4C 3VR9C 4YTMD 4YXDC 2ACZD 3ABVD 2BS2C 3AEAD 4KX6C 4YSXC 1ZOYD 3AEDD 3SFDC 1QLBC 4YSZC 5C2TC 3AE7C 3VRAD 3P4SD 4YTNC 4YTMC 1OW6A 2WU2D 1OW8A 4YSXD 1YQ3D 1E7PC 2H88D 2WU5D 1OW7A 2WQYD 2H89D 1K05A 3SFED 2ACZC 1L0VD 4YXDD 3AEED 2WDQC 3AE2D 1KTMA 1ZP0C 3AE6D 1NENC 2FBWD 2WDRC 3CIRC 4YT0C 1K04A 3AE3C 1NEKC 3VRBD 3AECC 3AE9C 5C2TD 2G3AA 3ABVC 2WDVC 2WP9D 1YQ4D 3AEDC 2B76C 1KF6D 3AE8C 3VR8D 3AE6C 3SFEC 3AEBC 3AE2C 3AEEC 2WU2C 1KFYC 3S9OA 5C3JD 3AE4C 3AEFC 1KF6C 2H89C 2BS3C 3AE9D 3VRAC 3AEGD 1YQ4C 3P4PC 3AE5C 2WDVD 2WP9C 2B76D 4YT0D 3VRBC 2WDRD 3AEFD 2WS3C 3P4RD 3AE1C 3VR9D 3CIRD 1KFYD 3AE4D 5C3JC 3AEBD 2WQYC 3P4QD 4YTPD 3AE1D 1PV3A 1L0VC 3VR8C 4YSYD 3AECD 2WS3D 3P4RC 3AEGC 3P4SC 4YTND 3AE7D 3AE5D 3AEAC 4KX6D 1ZOYC 1NEKD 3AE3D 3SFDD 4YSZD 4YSYC 2FBWC 3P4PD 3P4QC
chains in the Genus database with same CATH superfamily
3RK3B 3IN6A 1KQFB 3L72D 1YTZT 1CW5A 3MZWB 5AVVB 3AEAD 1NTZJ 1ZOYD 4YSZC 3FWLA 2B87B 4YTNC 1KB9D 1HTLC 2HODB 2K3RA 3HE4A 2WU5D 2Q7CA 3HD7D 3II6A 1YIJP 3H1JJ 2NZ2A 5DJUB 2O01J 2G3AA 1YITP 2WDVC 2B76C 4GODA 1SP4A 1JUNA 4OGQD 3AE8C 2I1KA 1LNQA 3HRNA 3PH0A 3JCUE 2HODA 3AEEC 3BASA 5C3JD 1SFCD 1L0LK 2B88A 3VONA 4TT3H 3VRAC 2KSJA 4OVNF 2WDVD 4IFFA 1LWUB 1S3JA 2WS3C 2E75C 1HF9A 3AE4D 2AXCA 2V4HA 1RE3A 2OYIB 1OWAA 1HUCA 1BDCA 2KIKA 2E5TA 2N9BA 2A06D 2YO3A 2BEQD 2ZT9D 5KAFH 3D71A 1SQQE 2WPRA 1XTGB 3H1LE 3CCRP 5CCHA 3Q5SA 3GHGC 3VTPC 4JQ0D 4H44C 4DJGA 2IBZD 1VDFA 3HE5B 1L4AD 1KFNA 1P84D 2RKLA 3SFDC 2WITA 1S1CX 1XTCC 1SFCA 1JY2N 2O1KA 3I5CA 2D2CB 1IFIA 4NPEA 5KLVG 2N1TC 3AE2D 1FDOA 1PZQA 3M0DA 2QJPC 2K9JB 3GHGB 1BE3J 4I7ZC 4N78D 3RBXA 1VQPP 3VMAA 2IBZE 1URQD 2FYUE 3AE9C 1URQB 2QIWA 1NJIQ 3V2NA 1NHLA 1Q81Q 1DD3A 3AEBC 1VF5B 2XNDH 3MTUE 1L0LE 4GOEA 1URQC 4K35A 3GW6A 1K9MQ 4RJTA 2WPQA 2B76D 2WSCJ 3B5NB 3VRBC 1KYOE 4BRYA 1SQBG 1SLQA 4YPCA 2C9LY 4LDTA 3KDPB 1NTZG 4DHZA 3S4RA 3T97A 3TGUE 1PP9E 1M57D 2AEMA 3O6QA 3TNUA 3KQGA 1IFMA 1UIIA 1SQBJ 3G3ZA 2WS3D 3RK2D 3L35A 3L4FA 5AVUB 3H1KJ 1T6AA 4ZNCA 2ZVNB 5BU8B 4U3FE 4KJMA 4YSYC 2OYHB 2C9NY 1AQTA 1RF1B 2A06E 4YTMD 2ACZD 1IFPA 1R5SA 4IOIH 3GF7A 5KKZC 1JY2O 3A7OA 1LWUA 2WSSH 3I56P 4K3AA 1KFMA 1WT6A 1RE3C 1NENC 2W90A 2YKQA 4KT0J 1VQ9P 4PV1D 1T3JA 5APSA 3JC22 5CCHC 1N7SD 5C2TD 2FFDC 1YQ4D 2M5AA 4JBZA 1Q7YQ 1S2EA 4N78E 1DEBA 3HD7C 3CXHI 1SQXK 1GU4A 3VMYA 3IR9A 3OW2O 2FXPA 1N7SA 2R5DA 1L0LD 4ASWA 4R4MA 1M90Q 4CPGA 2NRGA 2IBZG 2OQQA 3P4QD 4RO0A 1QL1A 1N73A 4JF7A 3L74G 4A7PA 1P84I 4WWIA 1QX8A 2FFDA 2W83C 1Q90D 3P4QC 2WDQD 1S9KE 3AE8D 3CC2P 1N7LA 1PGJA 5APUA 1GMJA 4DDGA 1E5WA 2KOGA 2YNYA 1OZHA 3FXDA 1KILE 4IFMA 5AW9B 2RMZA 4JYCA 2WQYD 1RE4C 3MUDC 3RL0D 4DHJA 3MHVA 5E79H 1ZP0C 1NO4A 1YHQP 2GUSA 2YKPA 1K04A 1NEKC 2Q6QA 4XFJA 1FZFA 2WZ7A 2BCCG 2NPSA 3A3YB 1VQNP 3CCSP 3H1JD 3AE2C 2M3EA 1RF1A 4DOJA 3Q5PA 1EZVI 2JEEA 4U7JA 3V5BA 3AEGD 2ITAA 3AE5C 2YMYA 1YTZI 4UB8E 1SQQG 1NTMJ 3FX0A 2WVRA 3TSIA 2M0BA 3CIRD 1SQPK 2KXPB 4JPZB 2V7QH 1NAYA 1BCCG 4U3FG 1KB9I 3H32A 3KPEA 4Z1MH 3KHUA 3H6PA 1SQVK 1MKMA 1NTMD 2FYNC 2YMKA 4C7NA 2WSFH 3CC7P 1YQ3C 4D6TJ 1AVOA 1BGYJ 3LIDA 3V2RA 2BS2C 1MV8A 1ZR4A 3VOPA 1BGYD 1QVGO 4I6MC 1BSHA 3SSUA 4O9BA 3P4SD 4ASVA 3NMDA 1S9KD 3RK2C 3IAOA 1NU1K 1CI6A 3S1KA 3FGAD 1OVVA 1L0ND 2C0WA 5AVYB 1GL2A 1NVOA 1NTME 4YT0C 3L36A 2R5BA 2HR3A 1S72P 1YBKA 1Q82Q 5B5EH 1NWQA 1PP9J 2P7JA 2MJZA 4DDIA 1KFYC 3I55P 2OYHA 4RKUJ 2OTLP 2HLOA 2QRXA 1NH4A 1USEA 1L0NE 2QM8A 1JTHA 1CSBA 1FZCC 1OVRA 1N7SB 3FXEA 1T3UA 1J1DB 1SFCB 4HJGH 4ZMDA 4H44D 4I7ZB 3MP7B 2YXRB 3EFGA 3IF4A 4HB1A 3IFMA 5APYA 1ZRTD 1PIXA 4PD4E 4YTND 3AE5D 1JMBA 3D6YA 1AVYA 3HUSC 3V4WA 1EZVG 1KQSO 3A5TA 3CCMP 1HGZA 2FKWB 2HPCB 2KS1A 3VR9C 2H8PD 2WSCH 1FZGA 1RQUA 1LJ2A 1EDJA 1FZCA 3H1LJ 1W2BO 3GLMA 3L70J 4PD4D 1KB9H 1OFCX 3CWBE 2XKMA 3W67A 3AEED 2WDQC 4OGQC 1USDA 3G6EP 3H1IJ 2KK7A 2Y9ZA 3A0BE 2K37A 2J59M 3WMM0 1H8AA 1ZR2A 2I1JA 3D6ZA 1E79H 1IZNB 3M9HA 2ZXXA 3SFEC 2W8ZA 5GTHH 3O6QB 5KLIC 1U57A 3TNUB 3BCCD 1VQKP 1RF0A 1U7MA 1MFTA 2WTYA 4AQRD 2LXCB 4WY4B 4LLHA 4PV1B 4YT0D 2P2UA 2FYUJ 3GG2A 4U3FJ 1P84E 1MUUA 3H1IG 2WQYC 1X0TA 3U59A 4Y99B 3BCCJ 1JB0J 2XV5A 1KC8Q 2Z5HA 3TGUD 1GTWA 1FOSF 1NEKD 2AXTH 2OTKE 1PPJD 2N1TD 1BDDA 3CCEP 2VRSA 2NPSB 2BCCJ 2A45G 4IL6H 2KZJA 4WBAA 3CMEP 3B5NA 1P84H 1N7SC 5C2TC 1N8RQ 4OH8B 1OW8A 3BVHA 1K05A 3Q2YA 1KB9E 5AW1B 2ZVOB 1L0VD 1LTGC 2IZ0A 5AVXB 2RH0A 1NKZB 3VP9A 2Q5UA 2KUBA 1M7LA 4C46A 1IK7A 1IC2A 1NOHA 1S4XA 1FDMA 4M3LA 5CCGC 1LTIC 2KYVA 1KZUB 1FC2C 1SQPE 3AEFC 4OWFA 4D6TD 5BVZA 5AVWB 3P4PC 4W7ZA 3B4SA 2LKMA 1EZVD 3H1LG 2P67A 5AVQB 3AEFD 2A45I 2QJKB 1EQ7A 3BCCE 1VQ5P 5AVTB 1VQ4P 2CK3H 4C7NB 1YJNP 4W80A 2FYNB 2J58A 1HVVA 1M1KQ 1KN7A 3E7KA 3TDKA 1KQGB 1SQPD 2XDJA 3AE3D 1VF5C 1FAVA 1FJKA 3WU2H 2YIUC 3TGUJ 1JY2P 1G1JA 1NEND 1W5CE 1ZP0D 1DIPA 2HFED 2O1JA 2Z5IA 3V6IA 1N73B 3ABVD 2POHA 2QVAA 3P7KA 3CWBG 1CI6B 1VQLP 2WT7B 1YJWP 1SQVJ 1W2EA 1MZ9A 2H89D 4GOFA 1QLED 4UB6E 5KLIB 3OJAB 1M1JB 3H1HE 2QE7H 1L0NJ 5BU5A 1FDIA 1LT9A 5KJ7C 1K73Q 1SQXD 2A45H 2D2CD 3M9QA 2FYUD 1ZN5A 2Q9IA 3VR8D 1NU1J 1Y8AA 1ZLLA 3KZIH 5APQA 3PLNA 4Y99C 1JY3P 1L4AB 1RQVA 5TJHA 3AE9D 5B66H 1DX7A 3L73D 1KQLA 1PPJG 3VN0A 1NTKD 2PFXA 3H1HD 2O01N 3AE1C 3L71G 4ZKPA 1KORA 1HGVA 2QEXP 5APXA 1D7MA 2Y0EA 1SQQD 4YTPD 3AE1D 1QEXA 2PAJA 1SQVE 4YSYD 2ZYAA 3PJSK 2FFDB 2ZFCA 2W6JH 3M91A 1RHZB 3L37A 4KX6D 1QL2A 4HYTB 3CX5D 4GIFA 3TK1A 5H2FH 3L75D 2BASA 3B71A 5KAIH 1BCCJ 2Z4EA 1LT9B 1TU3F 1CZQA 2WWWA 2H88C 1PGOA 1RF0C 2L91A 4KX6C 5CJ0A 5AVSB 3L72J 1QLBC 4AYCA 2WMMA 3L75J 3T97B 1FU1A 3L72G 1LTBC 2YO2A 4GKGA 1Q2NA 2E42A 1NAFA 4L76A 3RBZA 1N86A 2ACZC 1BGYE 2E74B 1GU5A 1HJ0A 1R5LA 1G2CB 1FS0E 3CX5H 3U1CA 2DW3A 2RN0A 2OYIC 2UWJE 4GDOA 3CD6P 2WP9D 3VMXA 1BE3E 3HTKB 2LR2A 2B9BA 2QM7A 1PL5A 3L74D 2WSEH 1A02F 3G9RA 2FXOA 1LP1A 2WP9C 3RK2B 2JR8A 3B5NC 1GW4A 5M1BA 1GD2E 4C7RA 2L5GB 4WB4A 3P4RD 1AV1A 1RE4A 1NU1G 1BE3D 1K8AQ 1L0VC 2YXQB 2K88A 2WPVB 1M8OB 2ZAEB 2QA4P 3P4SC 2GUVA 5CHXA 3P4PD 3CXHE 4H0LB 3PTZA 2ZFYA 3LIEA 5K5GB 1LP1B 3H1KE 5KLVJ 2E75D 3L71E 1BSNA 1SQVG 1GDTA 1URQA 3OA7A 5KLVD 3USSA 2BCCD 1Q86Q 2HYNA 1OW6A 3H1JG 1ZW0A 3RK3C 3CCQP 4YSXD 5AW2B 2H88D 2R3CA 5GTIH 2GM4A 1QGKB 1VQ6P 5EFWB 3SFED 1KYOI 1KTMA 1U7JA 1AQ5A 1HBWA 1HJBA 1VF5D 3HE4B 1SQQK 3A0HE 1PP9D 1OX3A 2W6AA 3JCUH 3WUVA 3CPWO 4QMAA 3L71D 3RL0B 1L4AA 4PJ0E 3C8VA 3WUTA 5KAFE 3CXHH 3ABVC 2E76D 1JMMA 2W6BA 3GHGA 2GA1A 3CL3D 3M9BA 1LTSC 3ZDMA 4U3FD 2K9YA 1FZEA 1SQBD 1LTJC 2V7QJ 3AE4C 3QH9A 2XU6A 5CCHD 3BATA 1EDLA 1YQ4C 2CPSA 3L75G 1YYCA 1TFFA 5AW0B 4Y28J 1Y9BA 5GTIE 3L74E 4YXWH 1KILB 4EIJA 2QJPB 4H13C 3MD0A 4UB6H 2E75B 2WSFJ 3M0DC 1GL2C 2WT7A 2D2CC 2ZYGA 1LTAC 4N3YB 2ZJSE 2MKVA 3VR8C 1FZAA 3EQ2A 4H0LD 2O3JA 1SS1A 1ZOYC 2FXMA 5KJ7A 2YKOA 3NFQA 3SFDD 2M8RA 3C9IA 1OIPA 2K9JA 4IL6X 3H32B 5APVA 1L0LJ 2KNCB 1JY3N 3KYQA 3H1KD 1YQ3D 5L8RJ 3M0AA 3AE6D 2BCCE 4BXLA 2J5UA 1EDIA 1YI2P 3D70A 2Y9YA 4L75A 3AE3C 3PP5A 3G4SP 2KI7B 1LT1A 1IFJA 1J2JB 3HUSB 3NXSA 5KLVK 2IFNA 1BE3G 4KHXA 1IO4A 3CI9A 1J1EC 3N7NA 2Q3EA 1FZCB 1EDKA 4DZOA 1ZV8A 1PGPA 1RH5B 1SFCC 1OMIA 1SQBE 3PHLA 5AVRB 1KYOD 3MUDA 1BCCE 2XNXA 1JTHB 2N9YB 2K1AA 1EZVE 1PV3A 1AJYA 1L0LG 1NTZE 3AECD 4EOTA 1EXJA 1FOSE 3AE7D 1IFNA 3P8MC 1L4AC 2C0XA 1WRGA 4N6JA 2FBWC 2E5YA 1GK6A 1SQXJ 2WU5C 5AW8B 1LTJA 1PGQA 4L74A 2AXTE 2JDIH 1KV4A 4H0LC 5KTBA 2I8DA 2W27A 3TYYA 1JEKA 2E76B 2JO1A 1KD1Q 5KKZB 3VMZA 4H44B 1KILA 1LTTC 5CBOA 3CWBD 3CCLP 5AW3B 3A0HH 3CIRC 1FE6A 1JNMA 5CMZA 5AW4B 1H88A 1H0TA 2FYZA 3VYIA 3CCJP 1SQXE 2IBZI 3G71P 2QJYB 4R4LA 2QJYC 1KFYD 3L73G 5C3JC 4PJ0H 2N1TA 1ZRTE 1NU1E 2Y0CA 3L73E 2SPZA 1NTKG 3H1HG 1LTJB 1IK9A 4I1LA 2KB7P 1BCCD 3FWNA 2ZYDA 2HG5D 1YJ9P 1NKNA 1AFOA 2E43A 2ZXEB 1EC5A 1G1IA 1NTZD 4LC1A 2YIUB 5CCGA 3HD7A 1WMKA 1RF1C 3AEDD 3QWOC 3H25A 1KYOH 4WVZA 1L0NG 2H43A 4RESB 3WUUA 4YTMC 1E7PC 1JO5A 1VQOP 1BGYG 3O8ZA 1IFDA 3CCUP 4D6TG 1GZLA 4H13D 4HKZH 1G2CA 1J1DC 3H1LD 2IX7C 1VQ8P 1MFZA 2QSIA 4H13B 1JY3O 3K5BA 3H1IE 3WU2E 3HUSA 2JP3A 4GT1A 1NTKK 4EDFA 3U1AA 3P32A 1S5LX 1SQPG 3H1JE 1N2DC 3C1LA 1SQQJ 5AW6B 3L70D 4PD4I 4D6TE 2QG4A 1J1EB 3RL0g 3VR9D 1FZBA 1LWUC 2A06G 3EFFK 1M1JC 2NPSD 1JM0A 3SWYA 3E1RA 1JCDA 2H7HA 2M3BA 2OTJP 1FJPA 2N1TB 4WY4D 1S5LH 3HE5A 4NPFX 1R8EA 2NPSC 3Q5RA 3W68A 4UB8H 4YTPC 3UIAA 2OYOA 2PGDA 1Y47A 3MGNA 2Q1KA 4YXDC 3VP8A 4FJVA 1NTZK 3GMAA 3CXHD 2ZT9C 1NTMK 3AE7C 3VRAD 2O01H 3CC4P 2KLVA 1X9VA 2WU2D 1OW7A 2M5AB 4YXDD 3SWKA 5KLVE 2FBWD 3L71J 1X22A 3Q1MA 4DT0A 4W7YA 2WDRC 1ZXGA 2ZT9B 1RY3A 3L72E 3M06A 3V4QA 4I6LA 3LW5H 1S5LE 3AECC 2Y0DA 3HTKA 3NTNA 2PP6A 3B5ND 5B5EE 3L74J 1L0NK 1A02J 3S9OA 1OXZA 1VQ7P 1DEEG 3H1ID 2QJKC 2R3SA 2JKVA 1HH0A 1HWTC 3F89A 2KSEA 2P58A 3BCCG 3N4XA 4ZKUA 3CX5I 2IZ1A 4OGQB 3MIWA 3A0BH 3AEBD 3OAKA 3LW5J 3B8EB 3L70E 2KS1B 2B87A 2IDBA 3CWBJ 2IPPA 2KZIA 3A2AA 1VPCA 5H2FE 1LT9C 2E74D 1Z56A 2XZRA 2OGUA 5GTHE 4NPDA 1H0TB 3CLQA 3TGUG 1JOCA 3ITKA 1GK4A 1GL2B 2IYPA 3V2QA 1T8ZA 3P8CE 5CCGD 2LXBA 3E1IA 4XE5B 1PFIA 1M1JA 5C39A 1N73C 3L70G 3BRTB 1VL2A 5AW5B 4HH2A 5TISE 3AEDC 1NU1D 1KF6D 3P8CD 1GL2D 3L73J 1L2PA 2CPBA 1QVFO 1KF6C 5APWA 1NTKE 5KJ7D 2BS3C 3JSVC 2P10A 1SQBK 4PV1C 4TLFA 2FY8A 3F5HA 3KZIE 4WY4A 4MN4C 4IFDK 2R32A 4JYBA 1SQVD 1KILC 2BEZF 2IFMA 1UIXA 5APTA 3AEGC 5CJ4A 4PD4H 3CCVP 4AUWA 2KLUA 4DCKA 5B66E 4YSZD 4IL6E 1KILD 1EXIA 1X8YA 3R4YA 1PP9G 1X79B 4EYYQ 2BS4C 2WPSA 2OYHC 3KXDA 3GF3A 1OVUA 2E74C 5DJTB 3RK3D 4YSXC 2IYOA 2WSEJ 5KAIE 2JWAA 2FYUK 4WY4C 1SQPJ 2JJLA 3RGUA 1NTKJ 4LGDE 5AVZB 3TF5A 1IJDB 2JWDA 1SQXG 2HPCA 5E79E 2Q3IA 2FYUG 3PRJA 5AW7B 4L73A 3VRBD 2G8YA 1M56D 1AA0A 3RK3E 1H89A 5TISH 2AEFA 3CX5E 1VQMP 3AE6C 3BRVB 3L75E 2P1JA 2WU2C 3SWFA 5CBNA 2H89C 4DHIB 4B86A 2E76C 1GW3A 1LGHB 1JCCA 2WDRD 1T2KD 4XA4A 2KNCA 1NGMB 2PRRA 3HD7B 3CMAP 4BWNA 4EI2A 3V2PA 3Q3DA 3RL0C 3R2PA 2OARA 1NTMG 1FBMA 1T2KC 1NYHA 3P4RC 1DH3A 3H1KG 1PPJE 2KP8A 2OYIA 3AEAC 2B89A 3EWKA 1KMIZ 2R44A 4I2LC 2AEJA 1SVFA 4BRYB 1DD4A 3H1HJ 1ZMEC
chains in the Genus database with same CATH topology
2FYNC 3B71A 2YMKA 2WDQD 4YTPC 3IN6A 1KQFB 2WU5C 1TU3F 1NEND 1YQ3C 1ZP0D 1DIPA 4H44C 3AE8D 2H88C 1WMKA 2BS4C 2E75D 3VR9C 3GF3A 4YTMD 4YXDC 2ACZD 1GMJA 3ABVD 2BS2C 3AEAD 4KX6C 1RQUA 2E74C 4YSXC 1ZOYD 3AEDD 3GMAA 3GF7A 3H25A 3SFDC 2WSEJ 4IL6X 1QLBC 4YSZC 1KILE 2ZT9C 4H0LC 5KKZC 1S1CX 5C2TC 3AE7C 3T97B 3VRAD 3P4SD 4YTNC 3GLMA 4YTMC 1OW6A 2WU2D 1OW8A 4YSXD 2E76B 2D2CB 1E7PC 1YQ3D 2JO1A 3IAOA 2H88D 1OW7A 2WQYD 2WU5D 1K05A 3Q2YA 2H89D 3SFED 2ACZC 5L8RJ 1L0VD 3AEED 4H44B 2WDQC 3AE2D 4OGQC 1KTMA 4YXDD 1FDOA 3FGAD 4H13D 1ZP0C 2E74B 3AE6D 1NENC 1HJ0A 1VF5D 2QJPC 2FBWD 3Q1MA 2J5UA 4I7ZC 4KT0J 2WDRC 1VL2A 2NZ2A 2ZT9B 3CIRC 2QSIA 3D70A 4YT0C 1K04A 2O01J 3AE3C 4H13B 1NEKC 1IK7A 4PV1D 3VRBD 2G8YA 3C8VA 3D6ZA 1FDIA 3AE9C 3AECC 5C2TD 3RK3E 2G3AA 3ABVC 4GDOA 2E76D 2QIWA 4XFJA 1YQ4D 2WDVC 2WP9D 3AEDC 2B76C 2D2CD 4OGQD 1KF6D 2JP3A 3AE8C 3VR8D 3P4QC 3AE6C 1DD3A 3SFEC 3AEBC 2K9YA 1PL5A 1VF5B 5KLIC 1U57A 3AE2C 3AEEC 2WU2C 1KFYC 3S9OA 2V7QJ 5C3JD 4RKUJ 3G9RA 3AE4C 3AEFC 1KF6C 1S5LX 2H89C 1RQVA 4TT3H 3Q5PA 4U7JA 2BS3C 2QJKC 3AE9D 3AEGD 3VRAC 1YQ4C 3P4PC 3AE5C 2E76C 2WDVD 2WP9C 2B76D 2P10A 4PV1B 2FXPA 4YT0D 2WSCJ 4PV1C 5M1BA 3VRBC 4Y28J 2WDRD 3AEFD 2WS3C 1Y9BA 3RL0g 4R4LA 3AE1C 1OMIA 2QJYC 2E75C 3CIRD 3P4RD 3VR9D 1KFYD 1HF9A 4H13C 4R4MA 1KORA 1NGMB 4OGQB 3AE4D 5C3JC 2OQQA 4H44D 1ZRTE 2E75B 4I7ZB 3AEBD 2WQYC 2WSFJ 3P4QD 2BEZF 3Q3DA 3O6QA 4YTPD 2D2CC 3LW5J 3AE1D 1PV3A 1L0VC 2MKVA 1AJYA 3VR8C 1UIXA 4YSYD 3AECD 1JB0J 2IDBA 2WPVB 2WS3D 1PIXA 4H0LD 1EXJA 1NYHA 2BEQD 2ZT9D 4Z1MH 3D71A 3P4RC 3AEGC 3P4SC 4YTND 3AE7D 3AE5D 3AEAC 1KQGB 4KX6D 1ZOYC 3EWKA 1KMIZ 2E74D 3D6YA 1Q90D 1NEKD 1MKMA 3Q5SA 3AE3D 1R8EA 3SFDD 4YSYC 4YSZD 1DD4A 1VF5C 2FBWC 4H0LB 3Q5RA 3P4PD 2YIUC 1EXIA 1ZMEC 3R4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B71 A;  2WDQ D;  4YTP C;  2WU5 C;  1NEN D;  1YQ3 C;  1ZP0 D;  3AE8 D;  2H88 C;  2BS4 C;  3VR9 C;  4YTM D;  4YXD C;  2ACZ D;  3ABV D;  2BS2 C;  3AEA D;  4KX6 C;  4YSX C;  1ZOY D;  3AED D;  3SFD C;  1QLB C;  4YSZ C;  5C2T C;  3AE7 C;  3VRA D;  3P4S D;  4YTN C;  4YTM C;  1OW6 A;  2WU2 D;  1OW8 A;  4YSX D;  1YQ3 D;  1E7P C;  2H88 D;  2WU5 D;  1OW7 A;  2WQY D;  2H89 D;  1K05 A;  3SFE D;  2ACZ C;  1L0V D;  4YXD D;  3AEE D;  2WDQ C;  3AE2 D;  1KTM A;  1ZP0 C;  3AE6 D;  1NEN C;  2FBW D;  2WDR C;  3CIR C;  4YT0 C;  1K04 A;  3AE3 C;  1NEK C;  3VRB D;  3AEC C;  3AE9 C;  5C2T D;  2G3A A;  3ABV C;  2WDV C;  2WP9 D;  1YQ4 D;  3AED C;  2B76 C;  1KF6 D;  3AE8 C;  3VR8 D;  3AE6 C;  3SFE C;  3AEB C;  3AE2 C;  3AEE C;  2WU2 C;  1KFY C;  3S9O A;  5C3J D;  3AE4 C;  3AEF C;  1KF6 C;  2H89 C;  2BS3 C;  3AE9 D;  3VRA C;  3AEG D;  1YQ4 C;  3P4P C;  3AE5 C;  2WDV D;  2WP9 C;  2B76 D;  4YT0 D;  3VRB C;  2WDR D;  3AEF D;  2WS3 C;  3P4R D;  3AE1 C;  3VR9 D;  3CIR D;  1KFY D;  3AE4 D;  5C3J C;  3AEB D;  2WQY C;  3P4Q D;  4YTP D;  3AE1 D;  1PV3 A;  1L0V C;  3VR8 C;  4YSY D;  3AEC D;  2WS3 D;  3P4R C;  3AEG C;  3P4S C;  4YTN D;  3AE7 D;  3AE5 D;  3AEA C;  4KX6 D;  1ZOY C;  1NEK D;  3AE3 D;  3SFD D;  4YSZ D;  4YSY C;  2FBW C;  3P4P D;  3P4Q C; 
#chains in the Genus database with same CATH topology
 3RK3 B;  3IN6 A;  1KQF B;  3L72 D;  1YTZ T;  1CW5 A;  3MZW B;  5AVV B;  3AEA D;  1NTZ J;  1ZOY D;  4YSZ C;  3FWL A;  2B87 B;  4YTN C;  1KB9 D;  1HTL C;  2HOD B;  2K3R A;  3HE4 A;  2WU5 D;  2Q7C A;  3HD7 D;  3II6 A;  1YIJ P;  3H1J J;  2NZ2 A;  5DJU B;  2O01 J;  2G3A A;  1YIT P;  2WDV C;  2B76 C;  4GOD A;  1SP4 A;  1JUN A;  4OGQ D;  3AE8 C;  2I1K A;  1LNQ A;  3HRN A;  3PH0 A;  3JCU E;  2HOD A;  3AEE C;  3BAS A;  5C3J D;  1SFC D;  1L0L K;  2B88 A;  3VON A;  4TT3 H;  3VRA C;  2KSJ A;  4OVN F;  2WDV D;  4IFF A;  1LWU B;  1S3J A;  2WS3 C;  2E75 C;  1HF9 A;  3AE4 D;  2AXC A;  2V4H A;  1RE3 A;  2OYI B;  1OWA A;  1HUC A;  1BDC A;  2KIK A;  2E5T A;  2N9B A;  2A06 D;  2YO3 A;  2BEQ D;  2ZT9 D;  5KAF H;  3D71 A;  1SQQ E;  2WPR A;  1XTG B;  3H1L E;  3CCR P;  5CCH A;  3Q5S A;  3GHG C;  3VTP C;  4JQ0 D;  4H44 C;  4DJG A;  2IBZ D;  1VDF A;  3HE5 B;  1L4A D;  1KFN A;  1P84 D;  2RKL A;  3SFD C;  2WIT A;  1S1C X;  1XTC C;  1SFC A;  1JY2 N;  2O1K A;  3I5C A;  2D2C B;  1IFI A;  4NPE A;  5KLV G;  2N1T C;  3AE2 D;  1FDO A;  1PZQ A;  3M0D A;  2QJP C;  2K9J B;  3GHG B;  1BE3 J;  4I7Z C;  4N78 D;  3RBX A;  1VQP P;  3VMA A;  2IBZ E;  1URQ D;  2FYU E;  3AE9 C;  1URQ B;  2QIW A;  1NJI Q;  3V2N A;  1NHL A;  1Q81 Q;  1DD3 A;  3AEB C;  1VF5 B;  2XND H;  3MTU E;  1L0L E;  4GOE A;  1URQ C;  4K35 A;  3GW6 A;  1K9M Q;  4RJT A;  2WPQ A;  2B76 D;  2WSC J;  3B5N B;  3VRB C;  1KYO E;  4BRY A;  1SQB G;  1SLQ A;  4YPC A;  2C9L Y;  4LDT A;  3KDP B;  1NTZ G;  4DHZ A;  3S4R A;  3T97 A;  3TGU E;  1PP9 E;  1M57 D;  2AEM A;  3O6Q A;  3TNU A;  3KQG A;  1IFM A;  1UII A;  1SQB J;  3G3Z A;  2WS3 D;  3RK2 D;  3L35 A;  3L4F A;  5AVU B;  3H1K J;  1T6A A;  4ZNC A;  2ZVN B;  5BU8 B;  4U3F E;  4KJM A;  4YSY C;  2OYH B;  2C9N Y;  1AQT A;  1RF1 B;  2A06 E;  4YTM D;  2ACZ D;  1IFP A;  1R5S A;  4IOI H;  3GF7 A;  5KKZ C;  1JY2 O;  3A7O A;  1LWU A;  2WSS H;  3I56 P;  4K3A A;  1KFM A;  1WT6 A;  1RE3 C;  1NEN C;  2W90 A;  2YKQ A;  4KT0 J;  1VQ9 P;  4PV1 D;  1T3J A;  5APS A;  3JC2 2;  5CCH C;  1N7S D;  5C2T D;  2FFD C;  1YQ4 D;  2M5A A;  4JBZ A;  1Q7Y Q;  1S2E A;  4N78 E;  1DEB A;  3HD7 C;  3CXH I;  1SQX K;  1GU4 A;  3VMY A;  3IR9 A;  3OW2 O;  2FXP A;  1N7S A;  2R5D A;  1L0L D;  4ASW A;  4R4M A;  1M90 Q;  4CPG A;  2NRG A;  2IBZ G;  2OQQ A;  3P4Q D;  4RO0 A;  1QL1 A;  1N73 A;  4JF7 A;  3L74 G;  4A7P A;  1P84 I;  4WWI A;  1QX8 A;  2FFD A;  2W83 C;  1Q90 D;  3P4Q C;  2WDQ D;  1S9K E;  3AE8 D;  3CC2 P;  1N7L A;  1PGJ A;  5APU A;  1GMJ A;  4DDG A;  1E5W A;  2KOG A;  2YNY A;  1OZH A;  3FXD A;  1KIL E;  4IFM A;  5AW9 B;  2RMZ A;  4JYC A;  2WQY D;  1RE4 C;  3MUD C;  3RL0 D;  4DHJ A;  3MHV A;  5E79 H;  1ZP0 C;  1NO4 A;  1YHQ P;  2GUS A;  2YKP A;  1K04 A;  1NEK C;  2Q6Q A;  4XFJ A;  1FZF A;  2WZ7 A;  2BCC G;  2NPS A;  3A3Y B;  1VQN P;  3CCS P;  3H1J D;  3AE2 C;  2M3E A;  1RF1 A;  4DOJ A;  3Q5P A;  1EZV I;  2JEE A;  4U7J A;  3V5B A;  3AEG D;  2ITA A;  3AE5 C;  2YMY A;  1YTZ I;  4UB8 E;  1SQQ G;  1NTM J;  3FX0 A;  2WVR A;  3TSI A;  2M0B A;  3CIR D;  1SQP K;  2KXP B;  4JPZ B;  2V7Q H;  1NAY A;  1BCC G;  4U3F G;  1KB9 I;  3H32 A;  3KPE A;  4Z1M H;  3KHU A;  3H6P A;  1SQV K;  1MKM A;  1NTM D;  2FYN C;  2YMK A;  4C7N A;  2WSF H;  3CC7 P;  1YQ3 C;  4D6T J;  1AVO A;  1BGY J;  3LID A;  3V2R A;  2BS2 C;  1MV8 A;  1ZR4 A;  3VOP A;  1BGY D;  1QVG O;  4I6M C;  1BSH A;  3SSU A;  4O9B A;  3P4S D;  4ASV A;  3NMD A;  1S9K D;  3RK2 C;  3IAO A;  1NU1 K;  1CI6 A;  3S1K A;  3FGA D;  1OVV A;  1L0N D;  2C0W A;  5AVY B;  1GL2 A;  1NVO A;  1NTM E;  4YT0 C;  3L36 A;  2R5B A;  2HR3 A;  1S72 P;  1YBK A;  1Q82 Q;  5B5E H;  1NWQ A;  1PP9 J;  2P7J A;  2MJZ A;  4DDI A;  1KFY C;  3I55 P;  2OYH A;  4RKU J;  2OTL P;  2HLO A;  2QRX A;  1NH4 A;  1USE A;  1L0N E;  2QM8 A;  1JTH A;  1CSB A;  1FZC C;  1OVR A;  1N7S B;  3FXE A;  1T3U A;  1J1D B;  1SFC B;  4HJG H;  4ZMD A;  4H44 D;  4I7Z B;  3MP7 B;  2YXR B;  3EFG A;  3IF4 A;  4HB1 A;  3IFM A;  5APY A;  1ZRT D;  1PIX A;  4PD4 E;  4YTN D;  3AE5 D;  1JMB A;  3D6Y A;  1AVY A;  3HUS C;  3V4W A;  1EZV G;  1KQS O;  3A5T A;  3CCM P;  1HGZ A;  2FKW B;  2HPC B;  2KS1 A;  3VR9 C;  2H8P D;  2WSC H;  1FZG A;  1RQU A;  1LJ2 A;  1EDJ A;  1FZC A;  3H1L J;  1W2B O;  3GLM A;  3L70 J;  4PD4 D;  1KB9 H;  1OFC X;  3CWB E;  2XKM A;  3W67 A;  3AEE D;  2WDQ C;  4OGQ C;  1USD A;  3G6E P;  3H1I J;  2KK7 A;  2Y9Z A;  3A0B E;  2K37 A;  2J59 M;  3WMM 0;  1H8A A;  1ZR2 A;  2I1J A;  3D6Z A;  1E79 H;  1IZN B;  3M9H A;  2ZXX A;  3SFE C;  2W8Z A;  5GTH H;  3O6Q B;  5KLI C;  1U57 A;  3TNU B;  3BCC D;  1VQK P;  1RF0 A;  1U7M A;  1MFT A;  2WTY A;  4AQR D;  2LXC B;  4WY4 B;  4LLH A;  4PV1 B;  4YT0 D;  2P2U A;  2FYU J;  3GG2 A;  4U3F J;  1P84 E;  1MUU A;  3H1I G;  2WQY C;  1X0T A;  3U59 A;  4Y99 B;  3BCC J;  1JB0 J;  2XV5 A;  1KC8 Q;  2Z5H A;  3TGU D;  1GTW A;  1FOS F;  1NEK D;  2AXT H;  2OTK E;  1PPJ D;  2N1T D;  1BDD A;  3CCE P;  2VRS A;  2NPS B;  2BCC J;  2A45 G;  4IL6 H;  2KZJ A;  4WBA A;  3CME P;  3B5N A;  1P84 H;  1N7S C;  5C2T C;  1N8R Q;  4OH8 B;  1OW8 A;  3BVH A;  1K05 A;  3Q2Y A;  1KB9 E;  5AW1 B;  2ZVO B;  1L0V D;  1LTG C;  2IZ0 A;  5AVX B;  2RH0 A;  1NKZ B;  3VP9 A;  2Q5U A;  2KUB A;  1M7L A;  4C46 A;  1IK7 A;  1IC2 A;  1NOH A;  1S4X A;  1FDM A;  4M3L A;  5CCG C;  1LTI C;  2KYV A;  1KZU B;  1FC2 C;  1SQP E;  3AEF C;  4OWF A;  4D6T D;  5BVZ A;  5AVW B;  3P4P C;  4W7Z A;  3B4S A;  2LKM A;  1EZV D;  3H1L G;  2P67 A;  5AVQ B;  3AEF D;  2A45 I;  2QJK B;  1EQ7 A;  3BCC E;  1VQ5 P;  5AVT B;  1VQ4 P;  2CK3 H;  4C7N B;  1YJN P;  4W80 A;  2FYN B;  2J58 A;  1HVV A;  1M1K Q;  1KN7 A;  3E7K A;  3TDK A;  1KQG B;  1SQP D;  2XDJ A;  3AE3 D;  1VF5 C;  1FAV A;  1FJK A;  3WU2 H;  2YIU C;  3TGU J;  1JY2 P;  1G1J A;  1NEN D;  1W5C E;  1ZP0 D;  1DIP A;  2HFE D;  2O1J A;  2Z5I A;  3V6I A;  1N73 B;  3ABV D;  2POH A;  2QVA A;  3P7K A;  3CWB G;  1CI6 B;  1VQL P;  2WT7 B;  1YJW P;  1SQV J;  1W2E A;  1MZ9 A;  2H89 D;  4GOF A;  1QLE D;  4UB6 E;  5KLI B;  3OJA B;  1M1J B;  3H1H E;  2QE7 H;  1L0N J;  5BU5 A;  1FDI A;  1LT9 A;  5KJ7 C;  1K73 Q;  1SQX D;  2A45 H;  2D2C D;  3M9Q A;  2FYU D;  1ZN5 A;  2Q9I A;  3VR8 D;  1NU1 J;  1Y8A A;  1ZLL A;  3KZI H;  5APQ A;  3PLN A;  4Y99 C;  1JY3 P;  1L4A B;  1RQV A;  5TJH A;  3AE9 D;  5B66 H;  1DX7 A;  3L73 D;  1KQL A;  1PPJ G;  3VN0 A;  1NTK D;  2PFX A;  3H1H D;  2O01 N;  3AE1 C;  3L71 G;  4ZKP A;  1KOR A;  1HGV A;  2QEX P;  5APX A;  1D7M A;  2Y0E A;  1SQQ D;  4YTP D;  3AE1 D;  1QEX A;  2PAJ A;  1SQV E;  4YSY D;  2ZYA A;  3PJS K;  2FFD B;  2ZFC A;  2W6J H;  3M91 A;  1RHZ B;  3L37 A;  4KX6 D;  1QL2 A;  4HYT B;  3CX5 D;  4GIF A;  3TK1 A;  5H2F H;  3L75 D;  2BAS A;  3B71 A;  5KAI H;  1BCC J;  2Z4E A;  1LT9 B;  1TU3 F;  1CZQ A;  2WWW A;  2H88 C;  1PGO A;  1RF0 C;  2L91 A;  4KX6 C;  5CJ0 A;  5AVS B;  3L72 J;  1QLB C;  4AYC A;  2WMM A;  3L75 J;  3T97 B;  1FU1 A;  3L72 G;  1LTB C;  2YO2 A;  4GKG A;  1Q2N A;  2E42 A;  1NAF A;  4L76 A;  3RBZ A;  1N86 A;  2ACZ C;  1BGY E;  2E74 B;  1GU5 A;  1HJ0 A;  1R5L A;  1G2C B;  1FS0 E;  3CX5 H;  3U1C A;  2DW3 A;  2RN0 A;  2OYI C;  2UWJ E;  4GDO A;  3CD6 P;  2WP9 D;  3VMX A;  1BE3 E;  3HTK B;  2LR2 A;  2B9B A;  2QM7 A;  1PL5 A;  3L74 D;  2WSE H;  1A02 F;  3G9R A;  2FXO A;  1LP1 A;  2WP9 C;  3RK2 B;  2JR8 A;  3B5N C;  1GW4 A;  5M1B A;  1GD2 E;  4C7R A;  2L5G B;  4WB4 A;  3P4R D;  1AV1 A;  1RE4 A;  1NU1 G;  1BE3 D;  1K8A Q;  1L0V C;  2YXQ B;  2K88 A;  2WPV B;  1M8O B;  2ZAE B;  2QA4 P;  3P4S C;  2GUV A;  5CHX A;  3P4P D;  3CXH E;  4H0L B;  3PTZ A;  2ZFY A;  3LIE A;  5K5G B;  1LP1 B;  3H1K E;  5KLV J;  2E75 D;  3L71 E;  1BSN A;  1SQV G;  1GDT A;  1URQ A;  3OA7 A;  5KLV D;  3USS A;  2BCC D;  1Q86 Q;  2HYN A;  1OW6 A;  3H1J G;  1ZW0 A;  3RK3 C;  3CCQ P;  4YSX D;  5AW2 B;  2H88 D;  2R3C A;  5GTI H;  2GM4 A;  1QGK B;  1VQ6 P;  5EFW B;  3SFE D;  1KYO I;  1KTM A;  1U7J A;  1AQ5 A;  1HBW A;  1HJB A;  1VF5 D;  3HE4 B;  1SQQ K;  3A0H E;  1PP9 D;  1OX3 A;  2W6A A;  3JCU H;  3WUV A;  3CPW O;  4QMA A;  3L71 D;  3RL0 B;  1L4A A;  4PJ0 E;  3C8V A;  3WUT A;  5KAF E;  3CXH H;  3ABV C;  2E76 D;  1JMM A;  2W6B A;  3GHG A;  2GA1 A;  3CL3 D;  3M9B A;  1LTS C;  3ZDM A;  4U3F D;  2K9Y A;  1FZE A;  1SQB D;  1LTJ C;  2V7Q J;  3AE4 C;  3QH9 A;  2XU6 A;  5CCH D;  3BAT A;  1EDL A;  1YQ4 C;  2CPS A;  3L75 G;  1YYC A;  1TFF A;  5AW0 B;  4Y28 J;  1Y9B A;  5GTI E;  3L74 E;  4YXW H;  1KIL B;  4EIJ A;  2QJP B;  4H13 C;  3MD0 A;  4UB6 H;  2E75 B;  2WSF J;  3M0D C;  1GL2 C;  2WT7 A;  2D2C C;  2ZYG A;  1LTA C;  4N3Y B;  2ZJS E;  2MKV A;  3VR8 C;  1FZA A;  3EQ2 A;  4H0L D;  2O3J A;  1SS1 A;  1ZOY C;  2FXM A;  5KJ7 A;  2YKO A;  3NFQ A;  3SFD D;  2M8R A;  3C9I A;  1OIP A;  2K9J A;  4IL6 X;  3H32 B;  5APV A;  1L0L J;  2KNC B;  1JY3 N;  3KYQ A;  3H1K D;  1YQ3 D;  5L8R J;  3M0A A;  3AE6 D;  2BCC E;  4BXL A;  2J5U A;  1EDI A;  1YI2 P;  3D70 A;  2Y9Y A;  4L75 A;  3AE3 C;  3PP5 A;  3G4S P;  2KI7 B;  1LT1 A;  1IFJ A;  1J2J B;  3HUS B;  3NXS A;  5KLV K;  2IFN A;  1BE3 G;  4KHX A;  1IO4 A;  3CI9 A;  1J1E C;  3N7N A;  2Q3E A;  1FZC B;  1EDK A;  4DZO A;  1ZV8 A;  1PGP A;  1RH5 B;  1SFC C;  1OMI A;  1SQB E;  3PHL A;  5AVR B;  1KYO D;  3MUD A;  1BCC E;  2XNX A;  1JTH B;  2N9Y B;  2K1A A;  1EZV E;  1PV3 A;  1AJY A;  1L0L G;  1NTZ E;  3AEC D;  4EOT A;  1EXJ A;  1FOS E;  3AE7 D;  1IFN A;  3P8M C;  1L4A C;  2C0X A;  1WRG A;  4N6J A;  2FBW C;  2E5Y A;  1GK6 A;  1SQX J;  2WU5 C;  5AW8 B;  1LTJ A;  1PGQ A;  4L74 A;  2AXT E;  2JDI H;  1KV4 A;  4H0L C;  5KTB A;  2I8D A;  2W27 A;  3TYY A;  1JEK A;  2E76 B;  2JO1 A;  1KD1 Q;  5KKZ B;  3VMZ A;  4H44 B;  1KIL A;  1LTT C;  5CBO A;  3CWB D;  3CCL P;  5AW3 B;  3A0H H;  3CIR C;  1FE6 A;  1JNM A;  5CMZ A;  5AW4 B;  1H88 A;  1H0T A;  2FYZ A;  3VYI A;  3CCJ P;  1SQX E;  2IBZ I;  3G71 P;  2QJY B;  4R4L A;  2QJY C;  1KFY D;  3L73 G;  5C3J C;  4PJ0 H;  2N1T A;  1ZRT E;  1NU1 E;  2Y0C A;  3L73 E;  2SPZ A;  1NTK G;  3H1H G;  1LTJ B;  1IK9 A;  4I1L A;  2KB7 P;  1BCC D;  3FWN A;  2ZYD A;  2HG5 D;  1YJ9 P;  1NKN A;  1AFO A;  2E43 A;  2ZXE B;  1EC5 A;  1G1I A;  1NTZ D;  4LC1 A;  2YIU B;  5CCG A;  3HD7 A;  1WMK A;  1RF1 C;  3AED D;  3QWO C;  3H25 A;  1KYO H;  4WVZ A;  1L0N G;  2H43 A;  4RES B;  3WUU A;  4YTM C;  1E7P C;  1JO5 A;  1VQO P;  1BGY G;  3O8Z A;  1IFD A;  3CCU P;  4D6T G;  1GZL A;  4H13 D;  4HKZ H;  1G2C A;  1J1D C;  3H1L D;  2IX7 C;  1VQ8 P;  1MFZ A;  2QSI A;  4H13 B;  1JY3 O;  3K5B A;  3H1I E;  3WU2 E;  3HUS A;  2JP3 A;  4GT1 A;  1NTK K;  4EDF A;  3U1A A;  3P32 A;  1S5L X;  1SQP G;  3H1J E;  1N2D C;  3C1L A;  1SQQ J;  5AW6 B;  3L70 D;  4PD4 I;  4D6T E;  2QG4 A;  1J1E B;  3RL0 g;  3VR9 D;  1FZB A;  1LWU C;  2A06 G;  3EFF K;  1M1J C;  2NPS D;  1JM0 A;  3SWY A;  3E1R A;  1JCD A;  2H7H A;  2M3B A;  2OTJ P;  1FJP A;  2N1T B;  4WY4 D;  1S5L H;  3HE5 A;  4NPF X;  1R8E A;  2NPS C;  3Q5R A;  3W68 A;  4UB8 H;  4YTP C;  3UIA A;  2OYO A;  2PGD A;  1Y47 A;  3MGN A;  2Q1K A;  4YXD C;  3VP8 A;  4FJV A;  1NTZ K;  3GMA A;  3CXH D;  2ZT9 C;  1NTM K;  3AE7 C;  3VRA D;  2O01 H;  3CC4 P;  2KLV A;  1X9V A;  2WU2 D;  1OW7 A;  2M5A B;  4YXD D;  3SWK A;  5KLV E;  2FBW D;  3L71 J;  1X22 A;  3Q1M A;  4DT0 A;  4W7Y A;  2WDR C;  1ZXG A;  2ZT9 B;  1RY3 A;  3L72 E;  3M06 A;  3V4Q A;  4I6L A;  3LW5 H;  1S5L E;  3AEC C;  2Y0D A;  3HTK A;  3NTN A;  2PP6 A;  3B5N D;  5B5E E;  3L74 J;  1L0N K;  1A02 J;  3S9O A;  1OXZ A;  1VQ7 P;  1DEE G;  3H1I D;  2QJK C;  2R3S A;  2JKV A;  1HH0 A;  1HWT C;  3F89 A;  2KSE A;  2P58 A;  3BCC G;  3N4X A;  4ZKU A;  3CX5 I;  2IZ1 A;  4OGQ B;  3MIW A;  3A0B H;  3AEB D;  3OAK A;  3LW5 J;  3B8E B;  3L70 E;  2KS1 B;  2B87 A;  2IDB A;  3CWB J;  2IPP A;  2KZI A;  3A2A A;  1VPC A;  5H2F E;  1LT9 C;  2E74 D;  1Z56 A;  2XZR A;  2OGU A;  5GTH E;  4NPD A;  1H0T B;  3CLQ A;  3TGU G;  1JOC A;  3ITK A;  1GK4 A;  1GL2 B;  2IYP A;  3V2Q A;  1T8Z A;  3P8C E;  5CCG D;  2LXB A;  3E1I A;  4XE5 B;  1PFI A;  1M1J A;  5C39 A;  1N73 C;  3L70 G;  3BRT B;  1VL2 A;  5AW5 B;  4HH2 A;  5TIS E;  3AED C;  1NU1 D;  1KF6 D;  3P8C D;  1GL2 D;  3L73 J;  1L2P A;  2CPB A;  1QVF O;  1KF6 C;  5APW A;  1NTK E;  5KJ7 D;  2BS3 C;  3JSV C;  2P10 A;  1SQB K;  4PV1 C;  4TLF A;  2FY8 A;  3F5H A;  3KZI E;  4WY4 A;  4MN4 C;  4IFD K;  2R32 A;  4JYB A;  1SQV D;  1KIL C;  2BEZ F;  2IFM A;  1UIX A;  5APT A;  3AEG C;  5CJ4 A;  4PD4 H;  3CCV P;  4AUW A;  2KLU A;  4DCK A;  5B66 E;  4YSZ D;  4IL6 E;  1KIL D;  1EXI A;  1X8Y A;  3R4Y A;  1PP9 G;  1X79 B;  4EYY Q;  2BS4 C;  2WPS A;  2OYH C;  3KXD A;  3GF3 A;  1OVU A;  2E74 C;  5DJT B;  3RK3 D;  4YSX C;  2IYO A;  2WSE J;  5KAI E;  2JWA A;  2FYU K;  4WY4 C;  1SQP J;  2JJL A;  3RGU A;  1NTK J;  4LGD E;  5AVZ B;  3TF5 A;  1IJD B;  2JWD A;  1SQX G;  2HPC A;  5E79 E;  2Q3I A;  2FYU G;  3PRJ A;  5AW7 B;  4L73 A;  3VRB D;  2G8Y A;  1M56 D;  1AA0 A;  3RK3 E;  1H89 A;  5TIS H;  2AEF A;  3CX5 E;  1VQM P;  3AE6 C;  3BRV B;  3L75 E;  2P1J A;  2WU2 C;  3SWF A;  5CBN A;  2H89 C;  4DHI B;  4B86 A;  2E76 C;  1GW3 A;  1LGH B;  1JCC A;  2WDR D;  1T2K D;  4XA4 A;  2KNC A;  1NGM B;  2PRR A;  3HD7 B;  3CMA P;  4BWN A;  4EI2 A;  3V2P A;  3Q3D A;  3RL0 C;  3R2P A;  2OAR A;  1NTM G;  1FBM A;  1T2K C;  1NYH A;  3P4R C;  1DH3 A;  3H1K G;  1PPJ E;  2KP8 A;  2OYI A;  3AEA C;  2B89 A;  3EWK A;  1KMI Z;  2R44 A;  4I2L C;  2AEJ A;  1SVF A;  4BRY B;  1DD4 A;  3H1H J;  1ZME C; 
#chains in the Genus database with same CATH homology
 2FYN C;  3B71 A;  2YMK A;  2WDQ D;  4YTP C;  3IN6 A;  1KQF B;  2WU5 C;  1TU3 F;  1NEN D;  1YQ3 C;  1ZP0 D;  1DIP A;  4H44 C;  3AE8 D;  2H88 C;  1WMK A;  2BS4 C;  2E75 D;  3VR9 C;  3GF3 A;  4YTM D;  4YXD C;  2ACZ D;  1GMJ A;  3ABV D;  2BS2 C;  3AEA D;  4KX6 C;  1RQU A;  2E74 C;  4YSX C;  1ZOY D;  3AED D;  3GMA A;  3GF7 A;  3H25 A;  3SFD C;  2WSE J;  4IL6 X;  1QLB C;  4YSZ C;  1KIL E;  2ZT9 C;  4H0L C;  5KKZ C;  1S1C X;  5C2T C;  3AE7 C;  3T97 B;  3VRA D;  3P4S D;  4YTN C;  3GLM A;  4YTM C;  1OW6 A;  2WU2 D;  1OW8 A;  4YSX D;  2E76 B;  2D2C B;  1E7P C;  1YQ3 D;  2JO1 A;  3IAO A;  2H88 D;  1OW7 A;  2WQY D;  2WU5 D;  1K05 A;  3Q2Y A;  2H89 D;  3SFE D;  2ACZ C;  5L8R J;  1L0V D;  3AEE D;  4H44 B;  2WDQ C;  3AE2 D;  4OGQ C;  1KTM A;  4YXD D;  1FDO A;  3FGA D;  4H13 D;  1ZP0 C;  2E74 B;  3AE6 D;  1NEN C;  1HJ0 A;  1VF5 D;  2QJP C;  2FBW D;  3Q1M A;  2J5U A;  4I7Z C;  4KT0 J;  2WDR C;  1VL2 A;  2NZ2 A;  2ZT9 B;  3CIR C;  2QSI A;  3D70 A;  4YT0 C;  1K04 A;  2O01 J;  3AE3 C;  4H13 B;  1NEK C;  1IK7 A;  4PV1 D;  3VRB D;  2G8Y A;  3C8V A;  3D6Z A;  1FDI A;  3AE9 C;  3AEC C;  5C2T D;  3RK3 E;  2G3A A;  3ABV C;  4GDO A;  2E76 D;  2QIW A;  4XFJ A;  1YQ4 D;  2WDV C;  2WP9 D;  3AED C;  2B76 C;  2D2C D;  4OGQ D;  1KF6 D;  2JP3 A;  3AE8 C;  3VR8 D;  3P4Q C;  3AE6 C;  1DD3 A;  3SFE C;  3AEB C;  2K9Y A;  1PL5 A;  1VF5 B;  5KLI C;  1U57 A;  3AE2 C;  3AEE C;  2WU2 C;  1KFY C;  3S9O A;  2V7Q J;  5C3J D;  4RKU J;  3G9R A;  3AE4 C;  3AEF C;  1KF6 C;  1S5L X;  2H89 C;  1RQV A;  4TT3 H;  3Q5P A;  4U7J A;  2BS3 C;  2QJK C;  3AE9 D;  3AEG D;  3VRA C;  1YQ4 C;  3P4P C;  3AE5 C;  2E76 C;  2WDV D;  2WP9 C;  2B76 D;  2P10 A;  4PV1 B;  2FXP A;  4YT0 D;  2WSC J;  4PV1 C;  5M1B A;  3VRB C;  4Y28 J;  2WDR D;  3AEF D;  2WS3 C;  1Y9B A;  3RL0 g;  4R4L A;  3AE1 C;  1OMI A;  2QJY C;  2E75 C;  3CIR D;  3P4R D;  3VR9 D;  1KFY D;  1HF9 A;  4H13 C;  4R4M A;  1KOR A;  1NGM B;  4OGQ B;  3AE4 D;  5C3J C;  2OQQ A;  4H44 D;  1ZRT E;  2E75 B;  4I7Z B;  3AEB D;  2WQY C;  2WSF J;  3P4Q D;  2BEZ F;  3Q3D A;  3O6Q A;  4YTP D;  2D2C C;  3LW5 J;  3AE1 D;  1PV3 A;  1L0V C;  2MKV A;  1AJY A;  3VR8 C;  1UIX A;  4YSY D;  3AEC D;  1JB0 J;  2IDB A;  2WPV B;  2WS3 D;  1PIX A;  4H0L D;  1EXJ A;  1NYH A;  2BEQ D;  2ZT9 D;  4Z1M H;  3D71 A;  3P4R C;  3AEG C;  3P4S C;  4YTN D;  3AE7 D;  3AE5 D;  3AEA C;  1KQG B;  4KX6 D;  1ZOY C;  3EWK A;  1KMI Z;  2E74 D;  3D6Y A;  1Q90 D;  1NEK D;  1MKM A;  3Q5S A;  3AE3 D;  1R8E A;  3SFD D;  4YSY C;  4YSZ D;  1DD4 A;  1VF5 C;  2FBW C;  4H0L B;  3Q5R A;  3P4P D;  2YIU C;  1EXI A;  1ZME C;  3R4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...