2WQYD

Remodelling of carboxin binding to the q-site of avian respiratory complex ii
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
101
structure length
101
Chain Sequence
b'SKAASLHWTSERAVSALLLGLLPAAYLYPGPAVDYSLAAALTLHGHWGLGQVITDYVHGDTPIKVANTGLYVLSAITFTGLCYFNYYDVGICKAVAMLWSI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUCCINATE DEHYDROGENASE FLAVOPROTEIN SUBUNIT
publication title Remodelling of Carboxin Binding to the Q-Site of Avian Respiratory Complex II
rcsb
molecule tags Oxidoreductase
total genus 42
structure length 101
sequence length 101
chains with identical sequence Q
ec nomenclature
pdb deposition date 2009-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 2wqyD00
3VRAD 2H88C 2H88D 3AE5C 5C3JD 1L0VD 3P4QC 3CIRD 2WU2D 2ACZC 1YQ4D 3AE3C 3AE6C 4YTMD 4KX6C 4YT0C 1NEKD 3AEDC 4YTND 3AE4C 3AE4D 3AECC 5C2TC 3AEGC 1E7PC 3AEGD 3AEEC 1NENC 2B76C 3P4SC 2WDQC 4YSZD 3P4PD 3P4RC 3AE9C 4YTPC 2WP9C 3AE5D 2BS2C 1YQ3C 3P4QD 1YQ3D 4YXDC 2ACZD 3AE1C 1ZP0C 3AE3D 3AE6D 1ZOYC 4KX6D 4YT0D 3AEDD 3SFDC 3VRBC 3AECD 5C2TD 3SFEC 2WU5C 3AEED 1NEND 2B76D 3P4SD 2FBWC 2WDQD 3P4RD 3VR9C 2WS3C 2H89C 2WS3D 2WQYC 3AE9D 4YTPD 4YSXC 2WP9D 4YSYC 1QLBC 3AE2C 3AE7C 3AEBC 2WDRC 3AE7D 2WDRD 3AEAC 1KF6C 4YXDD 1KF6D 3AE1D 1ZP0D 1ZOYD 2BS3C 2BS4C 2WDVC 2WDVD 3SFDD 3VRBD 3VR8C 3AEFC 3SFED 2WU5D 3ABVC 3ABVD 3VRAC 1KFYC 1KFYD 2FBWD 5C3JC 3VR9D 1L0VC 3CIRC 2H89D 2WQYD 2WU2C 4YSXD 4YSYD 1YQ4C 3AE2D 3AEBD 4YTMC 3AEAD 1NEKC 4YTNC 3AE8C 3AE8D 4YSZC 3P4PC 3VR8D 3AEFD
chains in the Genus database with same CATH superfamily
3VRAD 2H88C 2H88D 3AE5C 5C3JD 2ZFYA 1L0VD 3P4QC 3CIRD 2WU2D 1TFFA 4DHZA 2ACZC 1YQ4D 3AE3C 3AE6C 4YTMD 4I6LA 4KX6C 4YT0C 1NEKD 3AEDC 4YTND 3AE4C 3AE4D 3AECC 5C2TC 3AEGC 1E7PC 3AEGD 3AEEC 4FJVA 1NENC 2B76C 3P4SC 2WDQC 4YSZD 3P4PD 3P4RC 4LDTA 3AE9C 4YTPC 2WP9C 3AE5D 2BS2C 1YQ3C 3P4QD 1YQ3D 4YXDC 2ACZD 3AE1C 1ZP0C 3AE3D 3AE6D 1ZOYC 4KX6D 4YT0D 3AEDD 3SFDC 3VRBC 4DHIB 3AECD 5C2TD 3SFEC 2WU5C 3AEED 1NEND 2B76D 3P4SD 2FBWC 2WDQD 3VONA 3P4RD 3VR9C 2WS3C 2H89C 2WS3D 2WQYC 4DHJA 3AE9D 4YTPD 4YSXC 2WP9D 4YSYC 1QLBC 3AE2C 3AE7C 3AEBC 2WDRC 3AE7D 2WDRD 3AEAC 1KF6C 4YXDD 1KF6D 4DDGA 3AE1D 1ZP0D 1ZOYD 2BS3C 2BS4C 2WDVC 2WDVD 3SFDD 3VRBD 3VR8C 3AEFC 3SFED 2WU5D 3ABVC 3ABVD 3VRAC 1KFYC 1KFYD 2FBWD 5C3JC 3VR9D 1L0VC 3CIRC 2H89D 2WQYD 2WU2C 4YSXD 4YSYD 1YQ4C 3AE2D 3AEBD 4YTMC 3AEAD 1NEKC 4YTNC 3AE8C 3AE8D 4DDIA 4YSZC 3P4PC 3VR8D 3AEFD
chains in the Genus database with same CATH topology
3VRAD 2H88C 2H88D 3AE5C 5C3JD 1L0VD 3P4QC 3CIRD 2WU2D 2ACZC 1YQ4D 3AE3C 3AE6C 4YTMD 4KX6C 4YT0C 1NEKD 3AEDC 4YTND 3AE4C 3AE4D 3AECC 5C2TC 3AEGC 1E7PC 3AEGD 3AEEC 1NENC 2B76C 3P4SC 2WDQC 4YSZD 3P4PD 3P4RC 3AE9C 4YTPC 2WP9C 3AE5D 2BS2C 1YQ3C 3P4QD 1YQ3D 4YXDC 2ACZD 3AE1C 1ZP0C 3AE3D 3AE6D 1ZOYC 4KX6D 4YT0D 3AEDD 3SFDC 3VRBC 3AECD 5C2TD 3SFEC 2WU5C 3AEED 1NEND 2B76D 3P4SD 2FBWC 2WDQD 3P4RD 3VR9C 2WS3C 2H89C 2WS3D 2WQYC 3AE9D 4YTPD 4YSXC 2WP9D 4YSYC 1QLBC 3AE2C 3AE7C 3AEBC 2WDRC 3AE7D 2WDRD 3AEAC 1KF6C 4YXDD 1KF6D 3AE1D 1ZP0D 1ZOYD 2BS3C 2BS4C 2WDVC 2WDVD 3SFDD 3VRBD 3VR8C 3AEFC 3SFED 2WU5D 3ABVC 3ABVD 3VRAC 1KFYC 1KFYD 2FBWD 5C3JC 3VR9D 1L0VC 3CIRC 2H89D 2WQYD 2WU2C 4YSXD 4YSYD 1YQ4C 3AE2D 3AEBD 4YTMC 3AEAD 1NEKC 4YTNC 3AE8C 3AE8D 4YSZC 3P4PC 3VR8D 3AEFD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VRA D;  2H88 C;  2H88 D;  3AE5 C;  5C3J D;  1L0V D;  3P4Q C;  3CIR D;  2WU2 D;  2ACZ C;  1YQ4 D;  3AE3 C;  3AE6 C;  4YTM D;  4KX6 C;  4YT0 C;  1NEK D;  3AED C;  4YTN D;  3AE4 C;  3AE4 D;  3AEC C;  5C2T C;  3AEG C;  1E7P C;  3AEG D;  3AEE C;  1NEN C;  2B76 C;  3P4S C;  2WDQ C;  4YSZ D;  3P4P D;  3P4R C;  3AE9 C;  4YTP C;  2WP9 C;  3AE5 D;  2BS2 C;  1YQ3 C;  3P4Q D;  1YQ3 D;  4YXD C;  2ACZ D;  3AE1 C;  1ZP0 C;  3AE3 D;  3AE6 D;  1ZOY C;  4KX6 D;  4YT0 D;  3AED D;  3SFD C;  3VRB C;  3AEC D;  5C2T D;  3SFE C;  2WU5 C;  3AEE D;  1NEN D;  2B76 D;  3P4S D;  2FBW C;  2WDQ D;  3P4R D;  3VR9 C;  2WS3 C;  2H89 C;  2WS3 D;  2WQY C;  3AE9 D;  4YTP D;  4YSX C;  2WP9 D;  4YSY C;  1QLB C;  3AE2 C;  3AE7 C;  3AEB C;  2WDR C;  3AE7 D;  2WDR D;  3AEA C;  1KF6 C;  4YXD D;  1KF6 D;  3AE1 D;  1ZP0 D;  1ZOY D;  2BS3 C;  2BS4 C;  2WDV C;  2WDV D;  3SFD D;  3VRB D;  3VR8 C;  3AEF C;  3SFE D;  2WU5 D;  3ABV C;  3ABV D;  3VRA C;  1KFY C;  1KFY D;  2FBW D;  5C3J C;  3VR9 D;  1L0V C;  3CIR C;  2H89 D;  2WQY D;  2WU2 C;  4YSX D;  4YSY D;  1YQ4 C;  3AE2 D;  3AEB D;  4YTM C;  3AEA D;  1NEK C;  4YTN C;  3AE8 C;  3AE8 D;  4YSZ C;  3P4P C;  3VR8 D;  3AEF D; 
#chains in the Genus database with same CATH topology
 3VRA D;  2H88 C;  2H88 D;  3AE5 C;  5C3J D;  2ZFY A;  1L0V D;  3P4Q C;  3CIR D;  2WU2 D;  1TFF A;  4DHZ A;  2ACZ C;  1YQ4 D;  3AE3 C;  3AE6 C;  4YTM D;  4I6L A;  4KX6 C;  4YT0 C;  1NEK D;  3AED C;  4YTN D;  3AE4 C;  3AE4 D;  3AEC C;  5C2T C;  3AEG C;  1E7P C;  3AEG D;  3AEE C;  4FJV A;  1NEN C;  2B76 C;  3P4S C;  2WDQ C;  4YSZ D;  3P4P D;  3P4R C;  4LDT A;  3AE9 C;  4YTP C;  2WP9 C;  3AE5 D;  2BS2 C;  1YQ3 C;  3P4Q D;  1YQ3 D;  4YXD C;  2ACZ D;  3AE1 C;  1ZP0 C;  3AE3 D;  3AE6 D;  1ZOY C;  4KX6 D;  4YT0 D;  3AED D;  3SFD C;  3VRB C;  4DHI B;  3AEC D;  5C2T D;  3SFE C;  2WU5 C;  3AEE D;  1NEN D;  2B76 D;  3P4S D;  2FBW C;  2WDQ D;  3VON A;  3P4R D;  3VR9 C;  2WS3 C;  2H89 C;  2WS3 D;  2WQY C;  4DHJ A;  3AE9 D;  4YTP D;  4YSX C;  2WP9 D;  4YSY C;  1QLB C;  3AE2 C;  3AE7 C;  3AEB C;  2WDR C;  3AE7 D;  2WDR D;  3AEA C;  1KF6 C;  4YXD D;  1KF6 D;  4DDG A;  3AE1 D;  1ZP0 D;  1ZOY D;  2BS3 C;  2BS4 C;  2WDV C;  2WDV D;  3SFD D;  3VRB D;  3VR8 C;  3AEF C;  3SFE D;  2WU5 D;  3ABV C;  3ABV D;  3VRA C;  1KFY C;  1KFY D;  2FBW D;  5C3J C;  3VR9 D;  1L0V C;  3CIR C;  2H89 D;  2WQY D;  2WU2 C;  4YSX D;  4YSY D;  1YQ4 C;  3AE2 D;  3AEB D;  4YTM C;  3AEA D;  1NEK C;  4YTN C;  3AE8 C;  3AE8 D;  4DDI A;  4YSZ C;  3P4P C;  3VR8 D;  3AEF D; 
#chains in the Genus database with same CATH homology
 3VRA D;  2H88 C;  2H88 D;  3AE5 C;  5C3J D;  1L0V D;  3P4Q C;  3CIR D;  2WU2 D;  2ACZ C;  1YQ4 D;  3AE3 C;  3AE6 C;  4YTM D;  4KX6 C;  4YT0 C;  1NEK D;  3AED C;  4YTN D;  3AE4 C;  3AE4 D;  3AEC C;  5C2T C;  3AEG C;  1E7P C;  3AEG D;  3AEE C;  1NEN C;  2B76 C;  3P4S C;  2WDQ C;  4YSZ D;  3P4P D;  3P4R C;  3AE9 C;  4YTP C;  2WP9 C;  3AE5 D;  2BS2 C;  1YQ3 C;  3P4Q D;  1YQ3 D;  4YXD C;  2ACZ D;  3AE1 C;  1ZP0 C;  3AE3 D;  3AE6 D;  1ZOY C;  4KX6 D;  4YT0 D;  3AED D;  3SFD C;  3VRB C;  3AEC D;  5C2T D;  3SFE C;  2WU5 C;  3AEE D;  1NEN D;  2B76 D;  3P4S D;  2FBW C;  2WDQ D;  3P4R D;  3VR9 C;  2WS3 C;  2H89 C;  2WS3 D;  2WQY C;  3AE9 D;  4YTP D;  4YSX C;  2WP9 D;  4YSY C;  1QLB C;  3AE2 C;  3AE7 C;  3AEB C;  2WDR C;  3AE7 D;  2WDR D;  3AEA C;  1KF6 C;  4YXD D;  1KF6 D;  3AE1 D;  1ZP0 D;  1ZOY D;  2BS3 C;  2BS4 C;  2WDV C;  2WDV D;  3SFD D;  3VRB D;  3VR8 C;  3AEF C;  3SFE D;  2WU5 D;  3ABV C;  3ABV D;  3VRA C;  1KFY C;  1KFY D;  2FBW D;  5C3J C;  3VR9 D;  1L0V C;  3CIR C;  2H89 D;  2WQY D;  2WU2 C;  4YSX D;  4YSY D;  1YQ4 C;  3AE2 D;  3AEB D;  4YTM C;  3AEA D;  1NEK C;  4YTN C;  3AE8 C;  3AE8 D;  4YSZ C;  3P4P C;  3VR8 D;  3AEF D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...