4YXDC

Crystal structure of porcine heart mitochondrial complex ii bound with flutolanil
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 48
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4yxdC01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 4yxdC02
3AE7C 2WU2C 3AEGC 5C2TD 4YT0D 2H88C 1ZP0C 3P4RC 4YXDC 1OW8A 3CIRD 1NEKD 2FBWD 2WDQC 4YSYD 2WS3C 3AE8C 3AE7D 3VR8C 3AEGD 1YQ3D 2H88D 3P4QC 4YXDD 2WU5C 1KF6D 3SFDC 2BS4C 4YTND 2WDQD 3AEAC 3VRBD 2BS2C 2WS3D 3AE9C 1PV3A 3AE4D 3AE8D 1YQ3C 3VR8D 1QLBC 3P4QD 3AE5C 3AEEC 1KF6C 2WQYC 2WU5D 4YTNC 3VRBC 3SFDD 3AE1C 3AEAD 3AE4C 1L0VD 3AE9D 2WDVC 3AE2D 3AEBD 3AE6D 2G3AA 3ABVD 3SFEC 3AE5D 3AEED 2WQYD 3AEFC 3VRAC 3AE1D 1K04A 1L0VC 2H89C 3AE2C 3B71A 3AEBC 5C3JC 2WDVD 3AE6C 3ABVC 3P4PD 3VR9C 2ACZC 3SFED 4YSZD 3AE3C 1E7PC 3AEFD 3VRAD 4KX6D 1YQ4C 2WDRC 1OW6A 2H89D 3AECD 3AEDC 5C3JD 4YTPC 3P4PC 4YSZC 1ZOYD 3VR9D 2ACZD 2B76C 4KX6C 3AE3D 1KTMA 1K05A 2BS3C 3P4SD 2WP9C 1NEND 3AECC 1YQ4D 2WDRD 1KFYC 3AEDD 4YTMD 4YTPD 1ZOYC 4YSXD 5C2TC 1OW7A 4YT0C 3S9OA 3P4SC 2WU2D 2B76D 1NENC 1ZP0D 1NEKC 3CIRC 3P4RD 2FBWC 2WP9D 4YTMC 1KFYD 4YSYC 4YSXC
chains in the Genus database with same CATH superfamily
1JCDA 2E75D 1NTKE 2E75B 2V7QH 1FAVA 1X9VA 3W68A 2IBZD 1HBWA 1URQD 2KI7B 1URQB 1G2CA 3KXDA 2HYNA 4KJMA 2HR3A 4AYCA 3H1HE 2WU5C 1HGVA 2KP8A 1NTMJ 3L75G 1VF5D 1DEBA 1VF5B 5GTHH 2OTJP 3L70E 3AEEC 2BASA 2IBZG 1FZAA 2WSCH 4M3LA 1DEEG 2C0XA 3UIAA 1XTGB 3MUDC 2E76D 2W6BA 2FFDB 2E76B 1L0NK 2WDVD 2IZ0A 3MUDA 2A45G 1L0NE 4YSZD 2KSEA 1L2PA 2I1JA 3T97A 1M1JC 2K37A 3B8EB 4PJ0H 4I7ZB 4HYTB 1L4AD 3CCVP 3AECD 1HJ0A 1L4AB 3KHUA 4D6TJ 1M1JA 2H7HA 3L71D 1S5LE 2KS1B 4ZMDA 1IO4A 1KB9I 5K5GB 2YKOA 2E5YA 1RQVA 2E42A 1FS0E 1PGOA 1GL2B 1LTJC 1LTIC 3TDKA 2LR2A 1FOSF 3L71G 2E74D 1LTJA 2E74B 1NTZD 1USDA 1FZCC 2FBWD 1RH5B 3F5HA 4AQRD 2OYHB 1FZCA 3KQGA 1KQLA 2V7QJ 5CHXA 2P2UA 4OWFA 3SFDC 2W27A 3CCEP 2XDJA 3MZWB 4Y99B 1S9KE 1NTZG 1EZVD 3N4XA 1JY3O 4H13C 1IZNB 5KLVK 1VL2A 3C8VA 2BCCE 3GG2A 3LW5H 5CJ4A 1JTHA 3O6QB 4IOIH 2FXPA 5KLVE 1SQXK 2E43A 1YJNP 3GF7A 1EDLA 1KFMA 1SQXE 3VOPA 2WSCJ 4BWNA 3K5BA 2J58A 3PTZA 3G9RA 3G3ZA 1EZVG 5AW6B 4H0LB 4WY4D 4WY4B 3FWLA 3P8CD 5H2FH 1Z56A 2FKWB 3E1IA 2ACZD 3JCUH 2WDRD 2GM4A 2WT7B 3L75E 4YTPD 2FYNB 4GODA 2OGUA 4XFJA 3IN6A 1NHLA 2P10A 3S9OA 2QJKC 2WP9D 3CCRP 4YTMC 2IBZE 2HPCB 1CI6B 2PGDA 5AVSB 3N7NA 4YSYD 1HTLC 5CCGC 3O8ZA 1OMIA 1HJBA 3H1KD 1M1KQ 2BS4C 5CCGA 1MKMA 1YJ9P 1N7LA 1SQQJ 3AE9C 4RO0A 2IDBA 2JO1A 2OYIC 4FJVA 3VP9A 1RE3C 3GHGB 2HG5D 3CCLP 3SWFA 3RL0B 2OYIA 1RE3A 3H1JD 2PP6A 3H1KG 1PGPA 1N2DC 3AEFC 2G8YA 1ZR4A 3AE1D 2ZXEB 5APSA 3L72D 3H6PA 2PFXA 3L71E 4UB8E 5AVUB 2WPRA 5TISE 3TK1A 1OVUA 3H1JG 2K9YA 3A0BH 4BXLA 4PV1D 3V4WA 2BS3C 4OGQD 1HH0A 3VMXA 4OGQB 2DW3A 4W7ZA 3L72G 3L4FA 1NTZK 1HGZA 5GTIE 4PD4H 1ZN5A 1NTZE 4UB6H 3H1LJ 2H43A 2KXPB 2WU2C 4YT0D 2GUVA 4YXDC 5APTA 2XNXA 2JJLA 1FZEA 2WS3C 1LTSC 1IFDA 2Z4EA 3M06A 1D7MA 4ASVA 3TNUA 1JMMA 1CW5A 2ZFCA 1YI2P 1EZVE 3V5BA 3L37A 1PV3A 5L8RJ 2ITAA 4K3AA 2WSEH 3P4QD 3AE5C 2HFED 3I5CA 3C9IA 5BVZA 4EYYQ 1RF1C 1L0VD 5APXA 2N9YB 1JEKA 2M5AA 3CMEP 1FDMA 1JY2P 2IYPA 4U3FJ 1PP9J 1X0TA 1JNMA 3P8CE 1SQPG 4XA4A 3Q3DA 5KJ7A 3IR9A 4KX6D 5KAIH 4NPDA 3OAKA 2NPSB 1QEXA 1BE3J 1H88A 3M0AA 3P4SD 2ZT9C 3PH0A 1YQ4D 1KILC 1QLED 1ZR2A 4DHZA 1J1DB 4PD4I 1KILA 2OYOA 1JMBA 3D6YA 3U1CA 5APYA 1NENC 1URQC 1KFYD 3V2RA 2ZJSE 3EQ2A 3WUVA 1URQA 3H1KE 2Q3IA 4ZKUA 2PAJA 1AVYA 4EDFA 2P7JA 1S4XA 2AXTE 4HH2A 4U7JA 1DD4A 1M57D 1VQ9P 1QL1A 3HD7D 3H1JE 2HODA 2KIKA 1KF6C 3TSIA 3HD7B 1GK4A 2GUSA 1LWUA 3HE5B 3L36A 2E76C 2R5BA 3AEAD 1NU1J 2KSJA 1FZBA 3SWYA 2WDVC 1NH4A 3AEBD 2ZYDA 3L72E 1FOSE 1NYHA 3VMAA 4I7ZC 1Y9BA 4IFDK 2YMYA 5KKZB 1A02J 1JUNA 4XE5B 3H32A 1VDFA 1YIJP 5CBNA 3CD6P 2BCCD 1VQKP 2Y0CA 2CPSA 1PL5A 3RK3B 1OFCX 3PRJA 1PZQA 3M9QA 1SFCD 2FBWC 4RESB 3L35A 2FYZA 2QJPB 3OW2O 3L74J 4RKUJ 2BCCG 3VMZA 1J2JB 4BRYB 4LC1A 1YTZT 1KB9H 1H0TB 2N1TB 2H88D 4LLHA 3KPEA 4GOFA 5AW7B 1LTAC 4Z1MH 1YQ3C 3JSVC 4OH8B 3V2NA 1W2EA 4YTNC 2K88A 3HUSB 1N73C 2IFMA 1NTKJ 3VTPC 3AE4C 2C0WA 3AE6D 4LGDE 1N73A 1AQTA 4WY4C 5AVVB 2KZJA 3H1HJ 1EXIA 4JYBA 1LP1B 3TGUD 5B66E 1M8OB 4EI2A 2ACZC 2QVAA 3GW6A 3SFED 1FU1A 3LIEA 2WDRC 3L70J 1BCCD 5C3JD 4YTPC 2B87B 2O01N 2WP9C 3B5ND 3W67A 2R3SA 3B5NB 3CLQA 2IYOA 3TGUG 1ZOYC 1FJKA 2YXRB 1LT9B 2KNCA 1BCCG 1L0NJ 1KV4A 4YSYC 2K1AA 1OVRA 3HE4B 3V2QA 1QGKB 3P4RC 1KYOD 2YKQA 1ZV8A 2M3BA 5CCHC 3QH9A 5CCHA 1VQ8P 1GL2D 1TU3F 1AV1A 4DZOA 2YXQB 1PGQA 2O01J 5AVTB 2FXOA 3AE1C 2I8DA 3BRVB 2Y9ZA 1U7MA 4DHIB 1CZQA 1VPCA 2A45H 3LIDA 4GIFA 3H1LD 1A02F 1J1EB 1S3JA 1S1CX 4NPFX 2KUBA 4WVZA 5KTBA 2D2CD 3P32A 3TF5A 2D2CB 1X79B 3WU2E 5APQA 2WSSH 4PV1C 2KK7A 1OIPA 1NOHA 2XNDH 5C39A 2IPPA 1W5CE 5AW9B 1OZHA 3FXEA 3CCUP 5KLVJ 3MHVA 2FY8A 1SQXJ 4H0LD 4YT0C 1WMKA 3H1IJ 2FYUD 4H44C 4Y28J 1T6AA 2J59M 1G2CB 2N9BA 3VMYA 2AEMA 3CWBD 1HF9A 2WTYA 3AE7D 2IBZI 3AEGD 2FYUG 4PJ0E 1NWQA 3P4QC 2MJZA 5AVZB 3L75J 3MGNA 2AEJA 2QJYB 1LTTC 1ZRTD 3Q1MA 2M8RA 1PIXA 2SPZA 2E5TA 3CWBG 3VRBC 3G6EP 1HWTC 2K9JA 1OWAA 2A45I 1LTGC 1KZUB 2P1JA 1VQ4P 4A7PA 3T97B 3TGUE 1FZFA 1K04A 2A06D 1SLQA 3FX0A 3MTUE 3U1AA 4PD4D 1M1JB 3WMM0 2WMMA 4IL6X 1BCCE 3ITKA 1Q2NA 2BEZF 5B5EH 5APUA 2Y0EA 3RL0D 1YQ4C 1BGYD 2W6AA 2H89D 1IFIA 1MUUA 3P4PC 4N78D 3IFMA 4DT0A 1SS1A 2A06G 4O9BA 3VYIA 1KFYC 4GOEA 1LTJB 4IL6H 2XV5A 1QX8A 3D6ZA 1KD1Q 1AVOA 1USEA 3HTKA 1BGYG 1YITP 3SWKA 3Q2YA 1KYOE 1FZCB 3A2AA 3BASA 3L71J 2L5GB 3CX5H 4YSXC 1SQVD 1YYCA 1KQGB 1LNQA 4C7NA 1FDIA 4KHXA 3HD7C 3RK2C 2WITA 3AEAC 1IFPA 1P84D 1JTHB 1NTZJ 1SQVG 2WVRA 3L73D 3AE8D 1E79H 4GT1A 3CPWO 4L75A 4IFMA 1NO4A 3H1LE 2IFNA 1EZVI 4ZKPA 1T2KD 3CXHH 3TYYA 1N7SC 4N3YB 3AE2C 3L73G 1SQBD 3BVHA 2M3EA 3ABVC 3NXSA 1N7SA 3VN0A 3BCCD 1NGMB 1YTZI 1VQNP 4HKZH 1N8RQ 1RF1A 2RH0A 2FYUK 3BRTB 3CCSP 3AE3D 1SFCC 5CMZA 3CC4P 4R4LA 2FYUE 1SQBG 4YTMD 1SFCA 2QIWA 1Q82Q 4U3FE 1T3JA 3Q5RA 1JCCA 3BCCG 1PFIA 1R5SA 2NPSD 3CX5I 1NTMD 3CWBE 1DX7A 5AVRB 4W80A 2ZAEB 1LT1A 5C2TD 2H88C 1ZP0C 3GLMA 3A7OA 4HB1A 1JB0J 2JEEA 3WUUA 2AXCA 3KZIE 1ZRTE 2E75C 1LJ2A 2WSFH 1Q90D 3HUSC 1NTMG 2OYIB 2WDQD 3A0BE 1YJWP 1T3UA 2W83C 3VR8D 1Q86Q 1JY2O 1VF5C 1LTBC 2A06E 3CXHI 4DCKA 1GU4A 4PD4E 1GTWA 3H1KJ 2G3AA 1WT6A 4UB6E 4D6TD 3SFEC 1SVFA 1RE4C 2V4HA 3KDPB 4NPEA 4DDIA 3B71A 2KB7P 3S1KA 5C3JC 1BGYE 1HUCA 1RE4A 3PP5A 3Q5PA 4N78E 1NKZB 1EDKA 4WB4A 2FFDC 1DIPA 3VRAD 2ZFYA 1AA0A 2XU6A 3H25A 2POHA 3H1JJ 5DJUB 2FFDA 2R44A 2QEXP 4D6TG 3KYQA 3NMDA 4YSZC 1GK6A 1LT9C 1K05A 1KB9D 1L4AC 3AECC 3L72J 1LT9A 1SQVK 5KLIB 1L4AA 2WU2D 3S4RA 1SQVE 2Q6QA 5KAFE 2KOGA 2KS1A 3EWKA 3MD0A 1S5LX 1VQ6P 1R8EA 3WUTA 4DJGA 1L0LJ 3TNUB 5AW1B 3V4QA 1GL2C 3CC2P 2WPQA 1KORA 1RQUA 3U59A 3JC22 1GL2A 3RK3D 1MV8A 2E74C 1P84E 3L73E 2LXCB 5KAIE 1ZXGA 1PPJD 2HLOA 2JR8A 1S5LH 1KQFB 2OYHC 5E79E 5DJTB 2RKLA 2M5AB 2OYHA 1J1EC 3G4SP 2WSFJ 1R5LA 2M0BA 2Q9IA 4Y99C 1KFNA 3H1ID 1SQBK 1N86A 2N1TD 1SQBE 5KJ7D 3P7KA 1PPJG 2QG4A 2O01H 1FC2C 3BCCE 3D71A 4I2LC 1OX3A 3CCMP 1IFMA 4DDGA 1SQPJ 2R3CA 2NRGA 3O6QA 3M9BA 2PRRA 2C9LY 3A0HE 2ZT9D 1KILD 2ZT9B 1KILB 4H0LC 3G71P 3E1RA 1NEND 1NTMK 3WU2H 4WY4A 4JF7A 1Q81Q 3AEDD 1NTME 3USSA 2QE7H 3RL0g 2FYNC 4ZNCA 1KN7A 1SQQD 1VQMP 1GW4A 3AE7C 2WT7A 3AEGC 5BU5A 1NEKD 2QJYC 1IK9A 3IF4A 2WZ7A 4RJTA 4KT0J 4QMAA 2HODB 2HPCA 1LWUB 4TLFA 1H89A 1CI6A 3SSUA 1QL2A 4JYCA 1KF6D 4TT3H 3IAOA 2O3JA 1SQQG 2BS2C 3MP7B 3FXDA 4D6TE 1VQLP 3H32B 2Z5HA 2O1KA 3GHGC 2B9BA 2OTLP 2WQYD 2UWJE 4I6MC 3RL0C 2H89C 1JY3P 3GHGA 5AVYB 1GW3A 5AVWB 4EOTA 4L76A 3RBZA 1KB9E 3VR9D 3CC7P 1GMJA 1W2BO 1KTMA 5BU8B 3P8MC 3EFGA 3C1LA 1OW7A 4B86A 1UIIA 4OGQC 2B76D 2YIUB 3II6A 3R4YA 4IFFA 5CBOA 3H1LG 1QVGO 3RK3E 1JY2N 3RBXA 1Y8AA 2BCCJ 5GTHE 3CIRD 4I6LA 1X22A 1PPJE 2YO2A 3M91A 4UB8H 5TISH 1AQ5A 3AE8C 1G1JA 1U7JA 1KYOH 3V6IA 1YQ3D 3FGAD 2B89A 1GZLA 1MFTA 4YTND 4K35A 4U3FD 1PP9D 3RGUA 1N73B 3AE4D 3H1IE 2Z5IA 1T2KC 1IFNA 4I1LA 2WU5D 3CL3D 5GTIH 2RMZA 3PLNA 4YPCA 2QA4P 2W6JH 4N6JA 2OARA 3AEED 1BE3D 2CPBA 4U3FG 1L0VC 1PP9G 3EFFK 1DH3A 2JKVA 1KILE 1YBKA 3CI9A 1NVOA 5AW8B 4R4MA 3AE3C 3CX5D 2ZVNB 1GD2E 5AVXB 5M1BA 1OXZA 3OJAB 1BE3G 2YMKA 1ZOYD 5AW0B 4KX6C 2KNCB 1NKNA 1AJYA 2NPSC 4WBAA 1SQQK 2XKMA 3TGUJ 3CCJP 4CPGA 2NPSA 1SQQE 5C2TC 1XTCC 3P4SC 3P4RD 1KMIZ 1BCCJ 1J1DC 5CCHD 1FZGA 1LGHB 1AFOA 2BEQD 4JQ0D 1K8AQ 4C7RA 4GKGA 3B4SA 3CXHD 2WDQC 5AVQB 1KYOI 4JPZB 1NU1D 3VR8C 3FWNA 2KYVA 4HJGH 2ZYGA 1IK7A 3VP8A 4MN4C 3LW5J 5CJ0A 3KZIH 1NAFA 2JWAA 3SFDD 1ZLLA 2ZYAA 1EXJA 1NU1G 1HVVA 1BSNA 2Q7CA 1KC8Q 2W8ZA 1EDIA 1L0LD 3VRAC 3HD7A 1OVVA 4PV1B 3HE5A 1IFJA 4H13D 5H2FE 3OA7A 2R5DA 3AEBC 4H13B 3JCUE 1ZMEC 4OVNF 2QSIA 3F89A 1FDOA 1EDJA 3ZDMA 2P67A 2W90A 5KKZC 2AXTH 1JO5A 1FE6A 2XZRA 5KLIC 1DD3A 2OQQA 2R32A 3I56P 2VRSA 1L0LG 1Q7YQ 1EQ7A 2Q3EA 1T8ZA 3L74D 2KZIA 5AW4B 4H44D 1VQ7P 4H44B 1M56D 3V2PA 1GDTA 1FBMA 2YO3A 3I55P 3RK3C 1EC5A 3CMAP 2YNYA 2RN0A 1ZW0A 3L74G 1SQPD 4L74A 2QM7A 2QJKB 2K3RA 2JDIH 2MKVA 1KQSO 2ZXXA 2QJPC 5B5EE 5KAFH 1NTKD 1PP9E 2FYUJ 3A5TA 3MIWA 2FXMA 2O1JA 4C46A 2ZVOB 1BDCA 2K9JB 3VRBD 4BRYA 1S72P 3H1HD 2N1TC 4YXWH 1IJDB 5CCGD 5KJ7C 1QVFO 1H0TA 1NJIQ 2GA1A 3CWBJ 2N1TA 1JM0A 1P84H 4LDTA 3PHLA 1BE3E 3GF3A 4IL6E 3A3YB 4JBZA 5AW5B 1NTKG 1GU5A 3AE9D 2H8PD 3L70D 5E79H 2YKPA 2Q5UA 3CX5E 3R2PA 2WWWA 3H1HG 3HUSA 4AUWA 3AE6C 1JOCA 1PGJA 3P4PD 1E5WA 5APWA 3GMAA 4EIJA 1E7PC 3AEFD 4GDOA 2Q1KA 2NZ2A 1YHQP 1NAYA 3AEDC 3L70G 1WRGA 1L0ND 1LP1A 3VONA 3HTKB 1S2EA 2LKMA 1Y47A 1JY3N 2IX7C 2WPSA 2LXBA 5EFWB 4YSXD 3A0HH 1VQ5P 3QWOC 2OTKE 1VQOP 1BGYJ 3B5NC 1NEKC 4WWIA 1H8AA 2B87A 4C7NB 2C9NY 3CXHE 1L0NG 2Y9YA 1NU1K 2KLVA 3B5NA 1LWUC 3PJSK 1NU1E 1OW8A 5B66H 3HRNA 3D70A 1BSHA 2IZ1A 3RK2D 3RK2B 1G1IA 1X8YA 5TJHA 1K9MQ 1BDDA 3CCQP 4YXDD 2WSEJ 3HE4A 3E7KA 1IC2A 2WS3D 2WPVB 1SQVJ 2CK3H 4DHJA 4ASWA 1P84I 1QLBC 3NTNA 1L0LK 2WQYC 1CSBA 1UIXA 2I1KA 1L0LE 1S9KD 1N7SD 3BATA 5AW2B 3AE2D 1N7SB 1FJPA 1RF0C 2QRXA 1SP4A 1M7LA 1RY3A 3ABVD 3AE5D 4L73A 2B88A 2Y0DA 1RF0A 3NFQA 3L73J 1RF1B 5KLVD 4DOJA 2QM8A 5AW3B 3VR9C 1M90Q 1SQXD 1MZ9A 1RHZB 2D2CC 1OW6A 1SFCB 3L74E 2AEFA 2P58A 1TFFA 2JP3A 3M0DC 2YIUC 5APVA 2B76C 3Q5SA 1U57A 3M0DA 1SQBJ 4W7YA 5KLVG 1K73Q 2JWDA 2L91A 1SQXG 3BCCJ 1SQPK 2J5UA 1ZP0D 3CIRC 3H1IG 2KLUA 1SQPE 1MFZA 3L75D 3M9HA 1NTKK 1VQPP
chains in the Genus database with same CATH topology
3AE7C 2E74D 2WU2C 3AEGC 5C2TD 2E74B 2H88C 1ZP0C 2E75D 3GLMA 4RKUJ 4YT0D 3P4RC 4YXDC 1OW8A 1KQGB 2E75B 3CIRD 1NEKD 3D70A 1KORA 1RQUA 2FBWD 1JB0J 2QJYC 2WDQC 2MKVA 1HF9A 4YSYD 2QJPC 2WS3C 2E74C 4KT0J 1FDIA 3AE8C 1ZRTE 2E75C 3AE7D 3VR8C 3AEGD 1OMIA 1YQ3D 2H88D 3P4QC 3FGAD 4YXDD 2WU5C 2WSEJ 2V7QJ 1Q90D 1KF6D 4TT3H 1IK7A 3SFDC 2BS4C 1MKMA 4U7JA 1TU3F 1VF5D 1KQFB 3AEAC 2WDQD 3VRBD 3IAOA 1DD4A 4YTND 2BS2C 1VF5B 2WS3D 2WPVB 3AE9C 3Q1MA 1PV3A 3AE4D 4Z1MH 3AE8D 1PIXA 1YQ3C 2IDBA 3LW5J 5L8RJ 3VR8D 1QLBC 3P4QD 3AE5C 3AEEC 1KF6C 2WQYC 2JO1A 2WU5D 2WSFJ 2O01J 1UIXA 1VF5C 4YTNC 3VRBC 3SFDD 3AE1C 3GF3A 4H13C 2E76C 3AEAD 1VL2A 3AE4C 1EXJA 1L0VD 3C8VA 3AE9D 2WDVC 3AE2D 3AEBD 3AE6D 2G3AA 2FXPA 3T97B 3ABVD 3SFEC 3AE5D 3AEED 3GF7A 1NYHA 2WQYD 3AEFC 4I7ZC 2G8YA 1S1CX 3VRAC 1Y9BA 4PV1B 3AE1D 1K04A 4H13D 1EXIA 2E76D 1L0VC 2WSCJ 2H89C 3D71A 3AE2C 3B71A 3AEBC 4H13B 2E76B 2D2CD 1ZMEC 5C3JC 2WDVD 3AE6C 2D2CB 2QSIA 1KILE 3G9RA 4IL6X 3ABVC 3Q5PA 3P4PD 3Q3DA 3VR9C 2BEZF 2ACZC 3O6QA 1FDOA 4PV1C 3GMAA 4R4MA 3SFED 4YSZD 3AE3C 4H0LB 1E7PC 1NGMB 1DIPA 3AEFD 3VRAD 4KX6D 1YQ4C 2WDRC 4GDOA 4I7ZB 2D2CC 5KKZC 1OW6A 2ZT9D 3H25A 2NZ2A 2H89D 3AECD 1HJ0A 2ZT9B 3AEDC 5KLIC 5C3JD 1DD3A 4YTPC 2OQQA 3P4PC 2K9YA 5M1BA 2JP3A 4H0LC 2YMKA 4YSZC 1ZOYD 3VR9D 2ACZD 2YIUC 4PV1D 2B76C 1GMJA 4KX6C 3Q5SA 1KTMA 1K05A 1U57A 2BS3C 3AE3D 3P4SD 2ZT9C 4OGQD 2WP9C 1NEND 1AJYA 3AECC 4H44D 4R4LA 4OGQB 1YQ4D 2WDRD 4H44B 1KFYC 3AEDD 4YTMD 4YTPD 1PL5A 2QIWA 1ZOYC 4YSXD 1RQVA 4H0LD 5C2TC 4XFJA 1OW7A 3IN6A 3Q5RA 4YT0C 3D6ZA 2P10A 1WMKA 3S9OA 3D6YA 2WU2D 3P4SC 4OGQC 2B76D 2J5UA 1NENC 1NEKC 2QJKC 4H44C 4Y28J 1ZP0D 3CIRC 3P4RD 1KMIZ 2FBWC 2WP9D 3RL0g 3R4YA 3EWKA 3Q2YA 2FYNC 4YTMC 1S5LX 1KFYD 4YSYC 1R8EA 2BEQD 4YSXC 3RK3E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AE7 C;  2WU2 C;  3AEG C;  5C2T D;  4YT0 D;  2H88 C;  1ZP0 C;  3P4R C;  4YXD C;  1OW8 A;  3CIR D;  1NEK D;  2FBW D;  2WDQ C;  4YSY D;  2WS3 C;  3AE8 C;  3AE7 D;  3VR8 C;  3AEG D;  1YQ3 D;  2H88 D;  3P4Q C;  4YXD D;  2WU5 C;  1KF6 D;  3SFD C;  2BS4 C;  4YTN D;  2WDQ D;  3AEA C;  3VRB D;  2BS2 C;  2WS3 D;  3AE9 C;  1PV3 A;  3AE4 D;  3AE8 D;  1YQ3 C;  3VR8 D;  1QLB C;  3P4Q D;  3AE5 C;  3AEE C;  1KF6 C;  2WQY C;  2WU5 D;  4YTN C;  3VRB C;  3SFD D;  3AE1 C;  3AEA D;  3AE4 C;  1L0V D;  3AE9 D;  2WDV C;  3AE2 D;  3AEB D;  3AE6 D;  2G3A A;  3ABV D;  3SFE C;  3AE5 D;  3AEE D;  2WQY D;  3AEF C;  3VRA C;  3AE1 D;  1K04 A;  1L0V C;  2H89 C;  3AE2 C;  3B71 A;  3AEB C;  5C3J C;  2WDV D;  3AE6 C;  3ABV C;  3P4P D;  3VR9 C;  2ACZ C;  3SFE D;  4YSZ D;  3AE3 C;  1E7P C;  3AEF D;  3VRA D;  4KX6 D;  1YQ4 C;  2WDR C;  1OW6 A;  2H89 D;  3AEC D;  3AED C;  5C3J D;  4YTP C;  3P4P C;  4YSZ C;  1ZOY D;  3VR9 D;  2ACZ D;  2B76 C;  4KX6 C;  3AE3 D;  1KTM A;  1K05 A;  2BS3 C;  3P4S D;  2WP9 C;  1NEN D;  3AEC C;  1YQ4 D;  2WDR D;  1KFY C;  3AED D;  4YTM D;  4YTP D;  1ZOY C;  4YSX D;  5C2T C;  1OW7 A;  4YT0 C;  3S9O A;  3P4S C;  2WU2 D;  2B76 D;  1NEN C;  1ZP0 D;  1NEK C;  3CIR C;  3P4R D;  2FBW C;  2WP9 D;  4YTM C;  1KFY D;  4YSY C;  4YSX C; 
#chains in the Genus database with same CATH topology
 1JCD A;  2E75 D;  1NTK E;  2E75 B;  2V7Q H;  1FAV A;  1X9V A;  3W68 A;  2IBZ D;  1HBW A;  1URQ D;  2KI7 B;  1URQ B;  1G2C A;  3KXD A;  2HYN A;  4KJM A;  2HR3 A;  4AYC A;  3H1H E;  2WU5 C;  1HGV A;  2KP8 A;  1NTM J;  3L75 G;  1VF5 D;  1DEB A;  1VF5 B;  5GTH H;  2OTJ P;  3L70 E;  3AEE C;  2BAS A;  2IBZ G;  1FZA A;  2WSC H;  4M3L A;  1DEE G;  2C0X A;  3UIA A;  1XTG B;  3MUD C;  2E76 D;  2W6B A;  2FFD B;  2E76 B;  1L0N K;  2WDV D;  2IZ0 A;  3MUD A;  2A45 G;  1L0N E;  4YSZ D;  2KSE A;  1L2P A;  2I1J A;  3T97 A;  1M1J C;  2K37 A;  3B8E B;  4PJ0 H;  4I7Z B;  4HYT B;  1L4A D;  3CCV P;  3AEC D;  1HJ0 A;  1L4A B;  3KHU A;  4D6T J;  1M1J A;  2H7H A;  3L71 D;  1S5L E;  2KS1 B;  4ZMD A;  1IO4 A;  1KB9 I;  5K5G B;  2YKO A;  2E5Y A;  1RQV A;  2E42 A;  1FS0 E;  1PGO A;  1GL2 B;  1LTJ C;  1LTI C;  3TDK A;  2LR2 A;  1FOS F;  3L71 G;  2E74 D;  1LTJ A;  2E74 B;  1NTZ D;  1USD A;  1FZC C;  2FBW D;  1RH5 B;  3F5H A;  4AQR D;  2OYH B;  1FZC A;  3KQG A;  1KQL A;  2V7Q J;  5CHX A;  2P2U A;  4OWF A;  3SFD C;  2W27 A;  3CCE P;  2XDJ A;  3MZW B;  4Y99 B;  1S9K E;  1NTZ G;  1EZV D;  3N4X A;  1JY3 O;  4H13 C;  1IZN B;  5KLV K;  1VL2 A;  3C8V A;  2BCC E;  3GG2 A;  3LW5 H;  5CJ4 A;  1JTH A;  3O6Q B;  4IOI H;  2FXP A;  5KLV E;  1SQX K;  2E43 A;  1YJN P;  3GF7 A;  1EDL A;  1KFM A;  1SQX E;  3VOP A;  2WSC J;  4BWN A;  3K5B A;  2J58 A;  3PTZ A;  3G9R A;  3G3Z A;  1EZV G;  5AW6 B;  4H0L B;  4WY4 D;  4WY4 B;  3FWL A;  3P8C D;  5H2F H;  1Z56 A;  2FKW B;  3E1I A;  2ACZ D;  3JCU H;  2WDR D;  2GM4 A;  2WT7 B;  3L75 E;  4YTP D;  2FYN B;  4GOD A;  2OGU A;  4XFJ A;  3IN6 A;  1NHL A;  2P10 A;  3S9O A;  2QJK C;  2WP9 D;  3CCR P;  4YTM C;  2IBZ E;  2HPC B;  1CI6 B;  2PGD A;  5AVS B;  3N7N A;  4YSY D;  1HTL C;  5CCG C;  3O8Z A;  1OMI A;  1HJB A;  3H1K D;  1M1K Q;  2BS4 C;  5CCG A;  1MKM A;  1YJ9 P;  1N7L A;  1SQQ J;  3AE9 C;  4RO0 A;  2IDB A;  2JO1 A;  2OYI C;  4FJV A;  3VP9 A;  1RE3 C;  3GHG B;  2HG5 D;  3CCL P;  3SWF A;  3RL0 B;  2OYI A;  1RE3 A;  3H1J D;  2PP6 A;  3H1K G;  1PGP A;  1N2D C;  3AEF C;  2G8Y A;  1ZR4 A;  3AE1 D;  2ZXE B;  5APS A;  3L72 D;  3H6P A;  2PFX A;  3L71 E;  4UB8 E;  5AVU B;  2WPR A;  5TIS E;  3TK1 A;  1OVU A;  3H1J G;  2K9Y A;  3A0B H;  4BXL A;  4PV1 D;  3V4W A;  2BS3 C;  4OGQ D;  1HH0 A;  3VMX A;  4OGQ B;  2DW3 A;  4W7Z A;  3L72 G;  3L4F A;  1NTZ K;  1HGZ A;  5GTI E;  4PD4 H;  1ZN5 A;  1NTZ E;  4UB6 H;  3H1L J;  2H43 A;  2KXP B;  2WU2 C;  4YT0 D;  2GUV A;  4YXD C;  5APT A;  2XNX A;  2JJL A;  1FZE A;  2WS3 C;  1LTS C;  1IFD A;  2Z4E A;  3M06 A;  1D7M A;  4ASV A;  3TNU A;  1JMM A;  1CW5 A;  2ZFC A;  1YI2 P;  1EZV E;  3V5B A;  3L37 A;  1PV3 A;  5L8R J;  2ITA A;  4K3A A;  2WSE H;  3P4Q D;  3AE5 C;  2HFE D;  3I5C A;  3C9I A;  5BVZ A;  4EYY Q;  1RF1 C;  1L0V D;  5APX A;  2N9Y B;  1JEK A;  2M5A A;  3CME P;  1FDM A;  1JY2 P;  2IYP A;  4U3F J;  1PP9 J;  1X0T A;  1JNM A;  3P8C E;  1SQP G;  4XA4 A;  3Q3D A;  5KJ7 A;  3IR9 A;  4KX6 D;  5KAI H;  4NPD A;  3OAK A;  2NPS B;  1QEX A;  1BE3 J;  1H88 A;  3M0A A;  3P4S D;  2ZT9 C;  3PH0 A;  1YQ4 D;  1KIL C;  1QLE D;  1ZR2 A;  4DHZ A;  1J1D B;  4PD4 I;  1KIL A;  2OYO A;  1JMB A;  3D6Y A;  3U1C A;  5APY A;  1NEN C;  1URQ C;  1KFY D;  3V2R A;  2ZJS E;  3EQ2 A;  3WUV A;  1URQ A;  3H1K E;  2Q3I A;  4ZKU A;  2PAJ A;  1AVY A;  4EDF A;  2P7J A;  1S4X A;  2AXT E;  4HH2 A;  4U7J A;  1DD4 A;  1M57 D;  1VQ9 P;  1QL1 A;  3HD7 D;  3H1J E;  2HOD A;  2KIK A;  1KF6 C;  3TSI A;  3HD7 B;  1GK4 A;  2GUS A;  1LWU A;  3HE5 B;  3L36 A;  2E76 C;  2R5B A;  3AEA D;  1NU1 J;  2KSJ A;  1FZB A;  3SWY A;  2WDV C;  1NH4 A;  3AEB D;  2ZYD A;  3L72 E;  1FOS E;  1NYH A;  3VMA A;  4I7Z C;  1Y9B A;  4IFD K;  2YMY A;  5KKZ B;  1A02 J;  1JUN A;  4XE5 B;  3H32 A;  1VDF A;  1YIJ P;  5CBN A;  3CD6 P;  2BCC D;  1VQK P;  2Y0C A;  2CPS A;  1PL5 A;  3RK3 B;  1OFC X;  3PRJ A;  1PZQ A;  3M9Q A;  1SFC D;  2FBW C;  4RES B;  3L35 A;  2FYZ A;  2QJP B;  3OW2 O;  3L74 J;  4RKU J;  2BCC G;  3VMZ A;  1J2J B;  4BRY B;  4LC1 A;  1YTZ T;  1KB9 H;  1H0T B;  2N1T B;  2H88 D;  4LLH A;  3KPE A;  4GOF A;  5AW7 B;  1LTA C;  4Z1M H;  1YQ3 C;  3JSV C;  4OH8 B;  3V2N A;  1W2E A;  4YTN C;  2K88 A;  3HUS B;  1N73 C;  2IFM A;  1NTK J;  3VTP C;  3AE4 C;  2C0W A;  3AE6 D;  4LGD E;  1N73 A;  1AQT A;  4WY4 C;  5AVV B;  2KZJ A;  3H1H J;  1EXI A;  4JYB A;  1LP1 B;  3TGU D;  5B66 E;  1M8O B;  4EI2 A;  2ACZ C;  2QVA A;  3GW6 A;  3SFE D;  1FU1 A;  3LIE A;  2WDR C;  3L70 J;  1BCC D;  5C3J D;  4YTP C;  2B87 B;  2O01 N;  2WP9 C;  3B5N D;  3W67 A;  2R3S A;  3B5N B;  3CLQ A;  2IYO A;  3TGU G;  1ZOY C;  1FJK A;  2YXR B;  1LT9 B;  2KNC A;  1BCC G;  1L0N J;  1KV4 A;  4YSY C;  2K1A A;  1OVR A;  3HE4 B;  3V2Q A;  1QGK B;  3P4R C;  1KYO D;  2YKQ A;  1ZV8 A;  2M3B A;  5CCH C;  3QH9 A;  5CCH A;  1VQ8 P;  1GL2 D;  1TU3 F;  1AV1 A;  4DZO A;  2YXQ B;  1PGQ A;  2O01 J;  5AVT B;  2FXO A;  3AE1 C;  2I8D A;  3BRV B;  2Y9Z A;  1U7M A;  4DHI B;  1CZQ A;  1VPC A;  2A45 H;  3LID A;  4GIF A;  3H1L D;  1A02 F;  1J1E B;  1S3J A;  1S1C X;  4NPF X;  2KUB A;  4WVZ A;  5KTB A;  2D2C D;  3P32 A;  3TF5 A;  2D2C B;  1X79 B;  3WU2 E;  5APQ A;  2WSS H;  4PV1 C;  2KK7 A;  1OIP A;  1NOH A;  2XND H;  5C39 A;  2IPP A;  1W5C E;  5AW9 B;  1OZH A;  3FXE A;  3CCU P;  5KLV J;  3MHV A;  2FY8 A;  1SQX J;  4H0L D;  4YT0 C;  1WMK A;  3H1I J;  2FYU D;  4H44 C;  4Y28 J;  1T6A A;  2J59 M;  1G2C B;  2N9B A;  3VMY A;  2AEM A;  3CWB D;  1HF9 A;  2WTY A;  3AE7 D;  2IBZ I;  3AEG D;  2FYU G;  4PJ0 E;  1NWQ A;  3P4Q C;  2MJZ A;  5AVZ B;  3L75 J;  3MGN A;  2AEJ A;  2QJY B;  1LTT C;  1ZRT D;  3Q1M A;  2M8R A;  1PIX A;  2SPZ A;  2E5T A;  3CWB G;  3VRB C;  3G6E P;  1HWT C;  2K9J A;  1OWA A;  2A45 I;  1LTG C;  1KZU B;  2P1J A;  1VQ4 P;  4A7P A;  3T97 B;  3TGU E;  1FZF A;  1K04 A;  2A06 D;  1SLQ A;  3FX0 A;  3MTU E;  3U1A A;  4PD4 D;  1M1J B;  3WMM 0;  2WMM A;  4IL6 X;  1BCC E;  3ITK A;  1Q2N A;  2BEZ F;  5B5E H;  5APU A;  2Y0E A;  3RL0 D;  1YQ4 C;  1BGY D;  2W6A A;  2H89 D;  1IFI A;  1MUU A;  3P4P C;  4N78 D;  3IFM A;  4DT0 A;  1SS1 A;  2A06 G;  4O9B A;  3VYI A;  1KFY C;  4GOE A;  1LTJ B;  4IL6 H;  2XV5 A;  1QX8 A;  3D6Z A;  1KD1 Q;  1AVO A;  1USE A;  3HTK A;  1BGY G;  1YIT P;  3SWK A;  3Q2Y A;  1KYO E;  1FZC B;  3A2A A;  3BAS A;  3L71 J;  2L5G B;  3CX5 H;  4YSX C;  1SQV D;  1YYC A;  1KQG B;  1LNQ A;  4C7N A;  1FDI A;  4KHX A;  3HD7 C;  3RK2 C;  2WIT A;  3AEA C;  1IFP A;  1P84 D;  1JTH B;  1NTZ J;  1SQV G;  2WVR A;  3L73 D;  3AE8 D;  1E79 H;  4GT1 A;  3CPW O;  4L75 A;  4IFM A;  1NO4 A;  3H1L E;  2IFN A;  1EZV I;  4ZKP A;  1T2K D;  3CXH H;  3TYY A;  1N7S C;  4N3Y B;  3AE2 C;  3L73 G;  1SQB D;  3BVH A;  2M3E A;  3ABV C;  3NXS A;  1N7S A;  3VN0 A;  3BCC D;  1NGM B;  1YTZ I;  1VQN P;  4HKZ H;  1N8R Q;  1RF1 A;  2RH0 A;  2FYU K;  3BRT B;  3CCS P;  3AE3 D;  1SFC C;  5CMZ A;  3CC4 P;  4R4L A;  2FYU E;  1SQB G;  4YTM D;  1SFC A;  2QIW A;  1Q82 Q;  4U3F E;  1T3J A;  3Q5R A;  1JCC A;  3BCC G;  1PFI A;  1R5S A;  2NPS D;  3CX5 I;  1NTM D;  3CWB E;  1DX7 A;  5AVR B;  4W80 A;  2ZAE B;  1LT1 A;  5C2T D;  2H88 C;  1ZP0 C;  3GLM A;  3A7O A;  4HB1 A;  1JB0 J;  2JEE A;  3WUU A;  2AXC A;  3KZI E;  1ZRT E;  2E75 C;  1LJ2 A;  2WSF H;  1Q90 D;  3HUS C;  1NTM G;  2OYI B;  2WDQ D;  3A0B E;  1YJW P;  1T3U A;  2W83 C;  3VR8 D;  1Q86 Q;  1JY2 O;  1VF5 C;  1LTB C;  2A06 E;  3CXH I;  4DCK A;  1GU4 A;  4PD4 E;  1GTW A;  3H1K J;  2G3A A;  1WT6 A;  4UB6 E;  4D6T D;  3SFE C;  1SVF A;  1RE4 C;  2V4H A;  3KDP B;  4NPE A;  4DDI A;  3B71 A;  2KB7 P;  3S1K A;  5C3J C;  1BGY E;  1HUC A;  1RE4 A;  3PP5 A;  3Q5P A;  4N78 E;  1NKZ B;  1EDK A;  4WB4 A;  2FFD C;  1DIP A;  3VRA D;  2ZFY A;  1AA0 A;  2XU6 A;  3H25 A;  2POH A;  3H1J J;  5DJU B;  2FFD A;  2R44 A;  2QEX P;  4D6T G;  3KYQ A;  3NMD A;  4YSZ C;  1GK6 A;  1LT9 C;  1K05 A;  1KB9 D;  1L4A C;  3AEC C;  3L72 J;  1LT9 A;  1SQV K;  5KLI B;  1L4A A;  2WU2 D;  3S4R A;  1SQV E;  2Q6Q A;  5KAF E;  2KOG A;  2KS1 A;  3EWK A;  3MD0 A;  1S5L X;  1VQ6 P;  1R8E A;  3WUT A;  4DJG A;  1L0L J;  3TNU B;  5AW1 B;  3V4Q A;  1GL2 C;  3CC2 P;  2WPQ A;  1KOR A;  1RQU A;  3U59 A;  3JC2 2;  1GL2 A;  3RK3 D;  1MV8 A;  2E74 C;  1P84 E;  3L73 E;  2LXC B;  5KAI E;  1ZXG A;  1PPJ D;  2HLO A;  2JR8 A;  1S5L H;  1KQF B;  2OYH C;  5E79 E;  5DJT B;  2RKL A;  2M5A B;  2OYH A;  1J1E C;  3G4S P;  2WSF J;  1R5L A;  2M0B A;  2Q9I A;  4Y99 C;  1KFN A;  3H1I D;  1SQB K;  1N86 A;  2N1T D;  1SQB E;  5KJ7 D;  3P7K A;  1PPJ G;  2QG4 A;  2O01 H;  1FC2 C;  3BCC E;  3D71 A;  4I2L C;  1OX3 A;  3CCM P;  1IFM A;  4DDG A;  1SQP J;  2R3C A;  2NRG A;  3O6Q A;  3M9B A;  2PRR A;  2C9L Y;  3A0H E;  2ZT9 D;  1KIL D;  2ZT9 B;  1KIL B;  4H0L C;  3G71 P;  3E1R A;  1NEN D;  1NTM K;  3WU2 H;  4WY4 A;  4JF7 A;  1Q81 Q;  3AED D;  1NTM E;  3USS A;  2QE7 H;  3RL0 g;  2FYN C;  4ZNC A;  1KN7 A;  1SQQ D;  1VQM P;  1GW4 A;  3AE7 C;  2WT7 A;  3AEG C;  5BU5 A;  1NEK D;  2QJY C;  1IK9 A;  3IF4 A;  2WZ7 A;  4RJT A;  4KT0 J;  4QMA A;  2HOD B;  2HPC A;  1LWU B;  4TLF A;  1H89 A;  1CI6 A;  3SSU A;  1QL2 A;  4JYC A;  1KF6 D;  4TT3 H;  3IAO A;  2O3J A;  1SQQ G;  2BS2 C;  3MP7 B;  3FXD A;  4D6T E;  1VQL P;  3H32 B;  2Z5H A;  2O1K A;  3GHG C;  2B9B A;  2OTL P;  2WQY D;  2UWJ E;  4I6M C;  3RL0 C;  2H89 C;  1JY3 P;  3GHG A;  5AVY B;  1GW3 A;  5AVW B;  4EOT A;  4L76 A;  3RBZ A;  1KB9 E;  3VR9 D;  3CC7 P;  1GMJ A;  1W2B O;  1KTM A;  5BU8 B;  3P8M C;  3EFG A;  3C1L A;  1OW7 A;  4B86 A;  1UII A;  4OGQ C;  2B76 D;  2YIU B;  3II6 A;  3R4Y A;  4IFF A;  5CBO A;  3H1L G;  1QVG O;  3RK3 E;  1JY2 N;  3RBX A;  1Y8A A;  2BCC J;  5GTH E;  3CIR D;  4I6L A;  1X22 A;  1PPJ E;  2YO2 A;  3M91 A;  4UB8 H;  5TIS H;  1AQ5 A;  3AE8 C;  1G1J A;  1U7J A;  1KYO H;  3V6I A;  1YQ3 D;  3FGA D;  2B89 A;  1GZL A;  1MFT A;  4YTN D;  4K35 A;  4U3F D;  1PP9 D;  3RGU A;  1N73 B;  3AE4 D;  3H1I E;  2Z5I A;  1T2K C;  1IFN A;  4I1L A;  2WU5 D;  3CL3 D;  5GTI H;  2RMZ A;  3PLN A;  4YPC A;  2QA4 P;  2W6J H;  4N6J A;  2OAR A;  3AEE D;  1BE3 D;  2CPB A;  4U3F G;  1L0V C;  1PP9 G;  3EFF K;  1DH3 A;  2JKV A;  1KIL E;  1YBK A;  3CI9 A;  1NVO A;  5AW8 B;  4R4M A;  3AE3 C;  3CX5 D;  2ZVN B;  1GD2 E;  5AVX B;  5M1B A;  1OXZ A;  3OJA B;  1BE3 G;  2YMK A;  1ZOY D;  5AW0 B;  4KX6 C;  2KNC B;  1NKN A;  1AJY A;  2NPS C;  4WBA A;  1SQQ K;  2XKM A;  3TGU J;  3CCJ P;  4CPG A;  2NPS A;  1SQQ E;  5C2T C;  1XTC C;  3P4S C;  3P4R D;  1KMI Z;  1BCC J;  1J1D C;  5CCH D;  1FZG A;  1LGH B;  1AFO A;  2BEQ D;  4JQ0 D;  1K8A Q;  4C7R A;  4GKG A;  3B4S A;  3CXH D;  2WDQ C;  5AVQ B;  1KYO I;  4JPZ B;  1NU1 D;  3VR8 C;  3FWN A;  2KYV A;  4HJG H;  2ZYG A;  1IK7 A;  3VP8 A;  4MN4 C;  3LW5 J;  5CJ0 A;  3KZI H;  1NAF A;  2JWA A;  3SFD D;  1ZLL A;  2ZYA A;  1EXJ A;  1NU1 G;  1HVV A;  1BSN A;  2Q7C A;  1KC8 Q;  2W8Z A;  1EDI A;  1L0L D;  3VRA C;  3HD7 A;  1OVV A;  4PV1 B;  3HE5 A;  1IFJ A;  4H13 D;  5H2F E;  3OA7 A;  2R5D A;  3AEB C;  4H13 B;  3JCU E;  1ZME C;  4OVN F;  2QSI A;  3F89 A;  1FDO A;  1EDJ A;  3ZDM A;  2P67 A;  2W90 A;  5KKZ C;  2AXT H;  1JO5 A;  1FE6 A;  2XZR A;  5KLI C;  1DD3 A;  2OQQ A;  2R32 A;  3I56 P;  2VRS A;  1L0L G;  1Q7Y Q;  1EQ7 A;  2Q3E A;  1T8Z A;  3L74 D;  2KZI A;  5AW4 B;  4H44 D;  1VQ7 P;  4H44 B;  1M56 D;  3V2P A;  1GDT A;  1FBM A;  2YO3 A;  3I55 P;  3RK3 C;  1EC5 A;  3CMA P;  2YNY A;  2RN0 A;  1ZW0 A;  3L74 G;  1SQP D;  4L74 A;  2QM7 A;  2QJK B;  2K3R A;  2JDI H;  2MKV A;  1KQS O;  2ZXX A;  2QJP C;  5B5E E;  5KAF H;  1NTK D;  1PP9 E;  2FYU J;  3A5T A;  3MIW A;  2FXM A;  2O1J A;  4C46 A;  2ZVO B;  1BDC A;  2K9J B;  3VRB D;  4BRY A;  1S72 P;  3H1H D;  2N1T C;  4YXW H;  1IJD B;  5CCG D;  5KJ7 C;  1QVF O;  1H0T A;  1NJI Q;  2GA1 A;  3CWB J;  2N1T A;  1JM0 A;  1P84 H;  4LDT A;  3PHL A;  1BE3 E;  3GF3 A;  4IL6 E;  3A3Y B;  4JBZ A;  5AW5 B;  1NTK G;  1GU5 A;  3AE9 D;  2H8P D;  3L70 D;  5E79 H;  2YKP A;  2Q5U A;  3CX5 E;  3R2P A;  2WWW A;  3H1H G;  3HUS A;  4AUW A;  3AE6 C;  1JOC A;  1PGJ A;  3P4P D;  1E5W A;  5APW A;  3GMA A;  4EIJ A;  1E7P C;  3AEF D;  4GDO A;  2Q1K A;  2NZ2 A;  1YHQ P;  1NAY A;  3AED C;  3L70 G;  1WRG A;  1L0N D;  1LP1 A;  3VON A;  3HTK B;  1S2E A;  2LKM A;  1Y47 A;  1JY3 N;  2IX7 C;  2WPS A;  2LXB A;  5EFW B;  4YSX D;  3A0H H;  1VQ5 P;  3QWO C;  2OTK E;  1VQO P;  1BGY J;  3B5N C;  1NEK C;  4WWI A;  1H8A A;  2B87 A;  4C7N B;  2C9N Y;  3CXH E;  1L0N G;  2Y9Y A;  1NU1 K;  2KLV A;  3B5N A;  1LWU C;  3PJS K;  1NU1 E;  1OW8 A;  5B66 H;  3HRN A;  3D70 A;  1BSH A;  2IZ1 A;  3RK2 D;  3RK2 B;  1G1I A;  1X8Y A;  5TJH A;  1K9M Q;  1BDD A;  3CCQ P;  4YXD D;  2WSE J;  3HE4 A;  3E7K A;  1IC2 A;  2WS3 D;  2WPV B;  1SQV J;  2CK3 H;  4DHJ A;  4ASW A;  1P84 I;  1QLB C;  3NTN A;  1L0L K;  2WQY C;  1CSB A;  1UIX A;  2I1K A;  1L0L E;  1S9K D;  1N7S D;  3BAT A;  5AW2 B;  3AE2 D;  1N7S B;  1FJP A;  1RF0 C;  2QRX A;  1SP4 A;  1M7L A;  1RY3 A;  3ABV D;  3AE5 D;  4L73 A;  2B88 A;  2Y0D A;  1RF0 A;  3NFQ A;  3L73 J;  1RF1 B;  5KLV D;  4DOJ A;  2QM8 A;  5AW3 B;  3VR9 C;  1M90 Q;  1SQX D;  1MZ9 A;  1RHZ B;  2D2C C;  1OW6 A;  1SFC B;  3L74 E;  2AEF A;  2P58 A;  1TFF A;  2JP3 A;  3M0D C;  2YIU C;  5APV A;  2B76 C;  3Q5S A;  1U57 A;  3M0D A;  1SQB J;  4W7Y A;  5KLV G;  1K73 Q;  2JWD A;  2L91 A;  1SQX G;  3BCC J;  1SQP K;  2J5U A;  1ZP0 D;  3CIR C;  3H1I G;  2KLU A;  1SQP E;  1MFZ A;  3L75 D;  3M9H A;  1NTK K;  1VQP P; 
#chains in the Genus database with same CATH homology
 3AE7 C;  2E74 D;  2WU2 C;  3AEG C;  5C2T D;  2E74 B;  2H88 C;  1ZP0 C;  2E75 D;  3GLM A;  4RKU J;  4YT0 D;  3P4R C;  4YXD C;  1OW8 A;  1KQG B;  2E75 B;  3CIR D;  1NEK D;  3D70 A;  1KOR A;  1RQU A;  2FBW D;  1JB0 J;  2QJY C;  2WDQ C;  2MKV A;  1HF9 A;  4YSY D;  2QJP C;  2WS3 C;  2E74 C;  4KT0 J;  1FDI A;  3AE8 C;  1ZRT E;  2E75 C;  3AE7 D;  3VR8 C;  3AEG D;  1OMI A;  1YQ3 D;  2H88 D;  3P4Q C;  3FGA D;  4YXD D;  2WU5 C;  2WSE J;  2V7Q J;  1Q90 D;  1KF6 D;  4TT3 H;  1IK7 A;  3SFD C;  2BS4 C;  1MKM A;  4U7J A;  1TU3 F;  1VF5 D;  1KQF B;  3AEA C;  2WDQ D;  3VRB D;  3IAO A;  1DD4 A;  4YTN D;  2BS2 C;  1VF5 B;  2WS3 D;  2WPV B;  3AE9 C;  3Q1M A;  1PV3 A;  3AE4 D;  4Z1M H;  3AE8 D;  1PIX A;  1YQ3 C;  2IDB A;  3LW5 J;  5L8R J;  3VR8 D;  1QLB C;  3P4Q D;  3AE5 C;  3AEE C;  1KF6 C;  2WQY C;  2JO1 A;  2WU5 D;  2WSF J;  2O01 J;  1UIX A;  1VF5 C;  4YTN C;  3VRB C;  3SFD D;  3AE1 C;  3GF3 A;  4H13 C;  2E76 C;  3AEA D;  1VL2 A;  3AE4 C;  1EXJ A;  1L0V D;  3C8V A;  3AE9 D;  2WDV C;  3AE2 D;  3AEB D;  3AE6 D;  2G3A A;  2FXP A;  3T97 B;  3ABV D;  3SFE C;  3AE5 D;  3AEE D;  3GF7 A;  1NYH A;  2WQY D;  3AEF C;  4I7Z C;  2G8Y A;  1S1C X;  3VRA C;  1Y9B A;  4PV1 B;  3AE1 D;  1K04 A;  4H13 D;  1EXI A;  2E76 D;  1L0V C;  2WSC J;  2H89 C;  3D71 A;  3AE2 C;  3B71 A;  3AEB C;  4H13 B;  2E76 B;  2D2C D;  1ZME C;  5C3J C;  2WDV D;  3AE6 C;  2D2C B;  2QSI A;  1KIL E;  3G9R A;  4IL6 X;  3ABV C;  3Q5P A;  3P4P D;  3Q3D A;  3VR9 C;  2BEZ F;  2ACZ C;  3O6Q A;  1FDO A;  4PV1 C;  3GMA A;  4R4M A;  3SFE D;  4YSZ D;  3AE3 C;  4H0L B;  1E7P C;  1NGM B;  1DIP A;  3AEF D;  3VRA D;  4KX6 D;  1YQ4 C;  2WDR C;  4GDO A;  4I7Z B;  2D2C C;  5KKZ C;  1OW6 A;  2ZT9 D;  3H25 A;  2NZ2 A;  2H89 D;  3AEC D;  1HJ0 A;  2ZT9 B;  3AED C;  5KLI C;  5C3J D;  1DD3 A;  4YTP C;  2OQQ A;  3P4P C;  2K9Y A;  5M1B A;  2JP3 A;  4H0L C;  2YMK A;  4YSZ C;  1ZOY D;  3VR9 D;  2ACZ D;  2YIU C;  4PV1 D;  2B76 C;  1GMJ A;  4KX6 C;  3Q5S A;  1KTM A;  1K05 A;  1U57 A;  2BS3 C;  3AE3 D;  3P4S D;  2ZT9 C;  4OGQ D;  2WP9 C;  1NEN D;  1AJY A;  3AEC C;  4H44 D;  4R4L A;  4OGQ B;  1YQ4 D;  2WDR D;  4H44 B;  1KFY C;  3AED D;  4YTM D;  4YTP D;  1PL5 A;  2QIW A;  1ZOY C;  4YSX D;  1RQV A;  4H0L D;  5C2T C;  4XFJ A;  1OW7 A;  3IN6 A;  3Q5R A;  4YT0 C;  3D6Z A;  2P10 A;  1WMK A;  3S9O A;  3D6Y A;  2WU2 D;  3P4S C;  4OGQ C;  2B76 D;  2J5U A;  1NEN C;  1NEK C;  2QJK C;  4H44 C;  4Y28 J;  1ZP0 D;  3CIR C;  3P4R D;  1KMI Z;  2FBW C;  2WP9 D;  3RL0 g;  3R4Y A;  3EWK A;  3Q2Y A;  2FYN C;  4YTM C;  1S5L X;  1KFY D;  4YSY C;  1R8E A;  2BEQ D;  4YSX C;  3RK3 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...