4YXDC

Crystal structure of porcine heart mitochondrial complex ii bound with flutolanil
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
total genus 48
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4yxdC01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 4yxdC02
3AEFD 2FBWC 3P4SD 3SFEC 1ZP0D 5C3JD 4YSXC 3SFED 3VRBD 2WDQC 3VRAD 3VR8C 4YXDC 5C2TC 4YTNC 3P4QC 3AE5C 3AE8C 4YTMD 2BS4C 4YSYC 3P4RD 2WDQD 2H88C 2WDVD 5C2TD 3AE7C 1YQ3D 4KX6C 1E7PC 2WU2C 3AE4C 4YXDD 3AE1C 1KF6D 1OW6A 1KTMA 2WQYD 3VRBC 4KX6D 2H88D 2WDVC 2ACZC 1KFYD 1PV3A 3SFDD 3AEAD 3S9OA 4YSZC 3AEAC 1QLBC 3ABVD 2WQYC 2ACZD 2WS3C 3VRAC 1NENC 2BS2C 1ZP0C 3AE7D 4YT0C 3AE6C 4YSYD 3AE1D 2WU5D 1NEKD 1NEKC 2B76C 3AE2C 2H89D 1K05A 2WU5C 1YQ4D 3AEDD 3AE5D 2H89C 4YTPC 2B76D 3AE3C 3AEEC 3CIRD 5C3JC 3VR9C 2FBWD 1NEND 3AE9C 1KF6C 3P4PC 2WU2D 3ABVC 4YT0D 3VR9D 2G3AA 3AECC 1YQ3C 3AEED 4YSZD 4YTPD 3P4PD 3AEBC 1ZOYD 3AE9D 2WDRC 3AEFC 1K04A 3AE2D 3CIRC 1OW8A 1YQ4C 3AEDC 1L0VD 2WDRD 3VR8D 3AEBD 2WP9D 4YSXD 2WP9C 3B71A 1L0VC 3AE4D 3AE6D 4YTND 3AE3D 3P4RC 3SFDC 1KFYC 2WS3D 3AEGD 1OW7A 3AEGC 3AE8D 4YTMC 1ZOYC 2BS3C 3P4QD 3AECD 3P4SC
chains in the Genus database with same CATH superfamily
2W6AA 3V4QA 4PJ0H 4ASWA 1L0LK 1NVOA 3PTZA 4C7NA 1CI6A 1PPJE 4GODA 4HB1A 3RL0B 1S4XA 3GF7A 3VONA 4YSYC 1KILB 1LT9B 2QJKB 3GLMA 3HUSC 5CCHA 3PJSK 1KYOE 1NH4A 1NWQA 1PP9G 1JY2O 4H0LB 4W7ZA 4TLFA 4PD4E 3CMAP 5KLVJ 1LTTC 1RF0C 1FZAA 3JCUH 4EDFA 1AQ5A 3Q5SA 4IL6H 3O8ZA 4Z1MH 3TDKA 2M0BA 4PD4D 5KLIB 1FDIA 3ABVC 4YTPD 1GW3A 1KYOD 3AE9D 1BCCG 2B88A 5TJHA 1J1DB 1EDKA 4PV1D 2FYNC 1URQC 2PP6A 3CC7P 1DD3A 3H1ID 1S2EA 4PJ0E 1Q82Q 3ZDMA 2KI7B 4YTMC 2A45I 1RY3A 2KZJA 3AECD 1KC8Q 1X79B 1PZQA 1IK7A 4IL6E 5KLIC 1AVYA 3RK3D 3H1HE 2OYOA 5C2TD 1EDLA 2CK3H 2Q6QA 3HE5A 1KTMA 1KB9D 3PP5A 1U7MA 3TNUB 1T2KC 3CCLP 1N73B 1IFMA 2H88D 1J1EB 3MUDA 3N7NA 2K88A 1VQMP 1HBWA 1FDMA 4PD4H 5AW8B 1L0NG 5GTIH 1BGYG 2AEJA 1PP9D 2H8PD 3GHGA 2I8DA 2PGDA 3LW5H 1KILD 1KQGB 1GK4A 3I5CA 4PV1B 1HF9A 5E79E 3HUSA 3P7KA 2ITAA 2H89D 1FZCB 2FFDB 3VMXA 4BRYA 3E1IA 2E74B 1DX7A 1J1DC 5CCGD 1Y9BA 2YXQB 1P84H 1RF0A 3IR9A 1OW8A 5KTBA 3M0DA 2D2CC 2Q3IA 3A0HH 5CCHD 2WPRA 3FXEA 1YI2P 1X8YA 4NPEA 1L4AA 1PGQA 2IBZI 3VP9A 2E5TA 1SQPJ 3H1KE 1NKNA 4UB6H 2Y9ZA 1YJNP 5C39A 3G71P 1NTZE 3BCCJ 4H0LD 2YKOA 1L0LE 4I7ZC 3AE5C 2LR2A 2WWWA 4XE5B 1FU1A 3LW5J 1NTKK 5AW9B 2NPSA 2WSSH 1JY3N 1N7SA 2BASA 1D7MA 5KJ7A 4ZNCA 2E74D 1L0ND 3L73J 4A7PA 3PHLA 4RJTA 1USEA 3ABVD 3WUTA 1U57A 1L4AB 2JEEA 3M9BA 3V2QA 2ZYAA 1W2EA 2Y0EA 2KS1A 1ZR4A 2B76C 3EFGA 1NTKD 1YQ4D 1QLED 4YTPC 2E43A 2O1JA 3ITKA 4YPCA 1PPJD 2QM7A 4YSZD 3V6IA 3GHGC 3AE2D 1LWUB 2IZ1A 2GA1A 1FZCA 1SQBK 4DHIB 2WSFJ 3RGUA 1YQ4C 2WDRD 1L0VD 3H1HD 1FDOA 3HRNA 4M3LA 3H1JG 1N7SB 1TFFA 2MJZA 1KN7A 3CWBG 2FYNB 3G9RA 3LIEA 3H6PA 1FZEA 5B5EH 3QWOC 1SQBE 5APSA 3TF5A 1YJWP 3AE8D 1EDIA 2P67A 3P4SC 1VQ5P 1Q90D 2QJPB 2QSIA 5KKZB 1NTMG 1YJ9P 3CCJP 1NU1E 2QG4A 3E1RA 3M0DC 1SQPG 2ZVOB 2JP3A 2YNYA 2I1KA 3CXHE 3U1AA 3P4RD 2H88C 2W27A 1P84E 3AE7C 3II6A 4IL6X 4EI2A 2SPZA 2WTYA 1YQ3D 3RK2D 2JWAA 1OW6A 3H1HJ 2L5GB 5B66H 2HODB 5CJ4A 3A7OA 2W6JH 1KFYD 1JCDA 3KHUA 2KSEA 1JO5A 4OGQD 1GU4A 2WT7B 3AE7D 2W90A 3OA7A 3KQGA 1IJDB 3M9HA 1HGVA 3FXDA 2IFMA 1NEKD 2FFDA 1JMMA 1K05A 1N7SC 4R4MA 1DIPA 2JR8A 1S5LE 5AW4B 2AXTH 3MHVA 1SQQK 1JY2N 1KF6C 3TGUE 1HGZA 2AXCA 1RF1A 1M1JA 3U59A 1FOSF 3L35A 4WY4B 4D6TG 2WPSA 4I6LA 1AV1A 4IFMA 4RESB 5KAFE 4L73A 4JYCA 3P32A 3AE6D 1KZUB 4DZOA 3SSUA 3AE3D 2WS3D 3HD7A 1SQXD 1GL2B 1VQOP 3TYYA 2FBWC 3H1LG 3SFEC 1HWTC 2IZ0A 1LT9A 3A5TA 2YMYA 2WDVD 2R5BA 4LLHA 3AE4C 1KF6D 3KYQA 3CXHD 1OIPA 1Z56A 2E75D 1KILE 1SS1A 3AEAD 3C9IA 2I1JA 3CMEP 2WQYC 4L74A 3M91A 3VRAC 4OVNF 2J5UA 2KUBA 1T2KD 3IAOA 3RBXA 4YSYD 3SWFA 2ZT9C 3CCQP 4LGDE 3CC4P 1FJKA 3OJAB 1J2JB 2KS1B 2QJPC 2YO2A 3CIRD 2FYUE 1H0TA 3FX0A 3SWKA 1NEND 1BDCA 2VRSA 1KYOH 4H13B 3VMYA 3VR9D 3NFQA 2IDBA 4H44C 4OGQB 3L75D 1MZ9A 2ZT9D 4K3AA 1JY3O 3VR8D 2E42A 2OARA 5DJTB 1ZRTD 4U3FG 5KAIE 2BEZF 1S9KE 4D6TJ 1VQ7P 2FXPA 1WT6A 3B71A 2HFED 4U3FD 3L70G 1W2BO 3JSVC 1IFPA 1FE6A 4BXLA 4C7RA 3TK1A 2KP8A 3RK2B 3CX5I 1RE3A 1EZVG 1SQQD 3L72J 2W6BA 1ZLLA 2Z4EA 4H13C 3RL0g 1FJPA 1HTLC 2WDQD 2WITA 1L4AC 2BEQD 4KX6C 3AE1C 3Q5RA 3IN6A 5KLVG 3VRBC 2WSCJ 3S9OA 2OYIA 1VPCA 2WSCH 1N7LA 4AQRD 2M5AA 1T3JA 5DJUB 1S3JA 5APXA 1IFIA 1L0NE 1AVOA 4FJVA 3WU2E 1BGYE 3WMM0 1L0LD 4GT1A 1NKZB 2XV5A 1RE4A 1NOHA 2QJKC 1YITP 1IO4A 1FAVA 3Q2YA 1GMJA 5C3JC 1JM0A 3H1LD 3AECC 1JB0J 3AEED 1SQXG 2BCCJ 4K35A 1YYCA 3L74G 1GL2C 3KZIH 1PGPA 2IBZD 2Y0DA 2OYHB 1HUCA 2K9JA 4NPFX 3H1KD 3LIDA 2WSEJ 2HLOA 5AVWB 1N86A 2O3JA 3KDPB 2IBZG 3G6EP 1OVUA 4I2LC 2YO3A 3L70E 4D6TD 2IPPA 3CCEP 1CW5A 1WMKA 1JMBA 1PIXA 1Y47A 3FWNA 5AW0B 1JOCA 3FGAD 4YXDC 1YTZT 1S5LH 1OX3A 1TU3F 2E76C 1HJ0A 4B86A 3EFFK 4W80A 1L0LG 1JTHA 4L75A 1NHLA 3L75E 3SWYA 1S72P 1QL1A 5APYA 2WDVC 3BRTB 3RK3C 5CHXA 5GTIE 4LDTA 5H2FE 1PFIA 1X22A 3E7KA 5KLVD 1ZP0C 3H1IJ 2ZT9B 4UB6E 2Q1KA 1OZHA 3OAKA 4EIJA 1NEKC 2WU5C 1VQ9P 1N7SD 2KZIA 3C8VA 2E75B 4N3YB 2P2UA 3VR9C 2XU6A 1VF5B 4I1LA 4NPDA 2WU2D 3HE4A 3USSA 3BRVB 4DHZA 2AEFA 1SP4A 1CZQA 1VQLP 1G2CA 2K37A 4Y28J 2Q9IA 1LTGC 5KAIH 5GTHE 3H1JD 5APTA 2QE7H 1L0VC 3CCVP 3H1HG 3H1JE 3SFDC 3VMZA 2D2CD 1CI6B 2AEMA 5CJ0A 1SQXK 1SQXJ 3T97B 2IBZE 2ZVNB 5CBNA 4ASVA 1ZP0D 1GL2A 3H32A 2BCCD 3WUVA 2WDQC 2Z5HA 2QVAA 1KV4A 1NTKG 1SQVJ 1LTIC 1SQVG 4XFJA 5AVSB 1LTSC 4DDGA 2C0WA 3TGUD 1NU1D 2ZJSE 2FYZA 1JEKA 4YSZC 3AEAC 3L72D 4WY4A 1NO4A 2FKWB 3RL0C 3CXHI 1KQLA 1BGYJ 2KXPB 2R5DA 4Y99C 3IF4A 4JQ0D 5AW6B 1G2CB 5AVRB 2HYNA 2H43A 3B5NB 1P84D 2O01N 4MN4C 3TSIA 2A06E 2WT7A 1M7LA 3IFMA 4YT0D 1YQ3C 3N4XA 3BCCD 1BE3E 3L71E 2CPBA 2FYUD 1QVFO 4I6MC 1EDJA 1VQPP 1SQQJ 2KYVA 4AYCA 2LXBA 3KZIE 3P8MC 1GU5A 4N78D 4DOJA 3JCUE 2JWDA 2QIWA 4QMAA 1BCCE 2RKLA 1L0NK 3EWKA 3V5BA 3VRBD 1SFCD 2GUVA 5APVA 1HJBA 2RH0A 3V2RA 4DDIA 3H1LE 4EYYQ 1N2DC 3L75J 1FZGA 3A3YB 3PH0A 2KIKA 1QGKB 2KNCB 2M3BA 4GIFA 1HH0A 1M1JC 1VQ4P 2B9BA 3CWBJ 2ZYGA 2R3CA 2KSJA 2GM4A 1LP1B 3L70J 2JO1A 1JNMA 1GZLA 1IFJA 1M90Q 3G4SP 2IX7C 5KKZC 3CWBE 3AE3C 1SVFA 3MGNA 1SQPD 3HD7C 2B87B 2YKQA 3AEFC 2KK7A 2V7QJ 1NTME 2E5YA 2C9NY 2WP9D 1BE3G 3CWBD 1BE3D 1LWUC 2N9BA 1LTJA 5CMZA 4U3FE 5TISH 1KFYC 3P4RC 2L91A 2OYIB 3D70A 1N73A 1URQB 1E79H 1MFZA 2HG5D 3VRAD 3VR8C 1G1IA 2JDIH 5C2TC 3O6QA 1RQUA 2D2CB 3VYIA 2LXCB 3JC22 3B5ND 3CXHH 3EQ2A 2ACZC 1NTZG 1GD2E 2W83C 3T97A 3Q5PA 2M3EA 3WUUA 3HTKB 1X9VA 1U7JA 2N1TA 3AE6C 1IFNA 3AE1D 2QM8A 2QRXA 5CCHC 3AE2C 4L76A 5AVXB 3HUSB 1K9MQ 2G3AA 5APUA 1BDDA 1URQD 3CD6P 3V4WA 1DEEG 1VL2A 3CCUP 4HJGH 2QA4P 4R4LA 5AVUB 3I56P 3HE5B 1SFCB 5KAFH 5AW3B 4KT0J 1OFCX 2OQQA 3W68A 4YTND 2N1TD 4HKZH 1S1CX 1OXZA 1KYOI 1ZOYC 2Y0CA 1NAFA 1OVRA 3PRJA 3S1KA 3BASA 5C3JD 1IK9A 4IFFA 2AXTE 1DEBA 3M9QA 1PGOA 1UIXA 3CCSP 1IFDA 1LTJC 1K73Q 1KFNA 4YXWH 1GTWA 5KJ7D 1PGJA 4OGQC 3G3ZA 1J1EC 1N73C 1BGYD 3U1CA 1BSNA 1NU1G 1NTZD 3HD7B 1OWAA 3VMAA 2BS2C 1BCCJ 5EFWB 4YT0C 2YMKA 3Q1MA 3BVHA 1MKMA 4WBAA 2PAJA 3CPWO 3B8EB 1LJ2A 1SQQE 2P7JA 1PP9E 2P58A 2Q5UA 3L73E 3C1LA 1KQFB 2BCCG 3MUDC 1K8AQ 3L71D 1M1JB 1ZV8A 2WDRC 1AFOA 1T6AA 2N1TC 1ZW0A 1OVVA 2WSFH 2WPQA 3H1LJ 1LT9C 2YIUC 3B5NC 1KILC 1KQSO 1JTHB 1AJYA 3M06A 3H1IG 3AE4D 3HTKA 1Q7YQ 3BCCE 2ZAEB 3MIWA 1DH3A 4XA4A 2YKPA 4GKGA 1OW7A 4HH2A 3A0BE 5AVVB 1BCCD 2OTJP 2FXMA 2O1KA 3CX5H 5AVQB 3SFED 1NGMB 3NTNA 3OW2O 1RQVA 1YBKA 1BE3J 1NTKE 1SFCA 1H8AA 1GW4A 2WQYD 4HYTB 4H0LC 2OYHA 1SQVE 4RKUJ 1FS0E 1M1KQ 2KB7P 1KMIZ 4H44D 1DD4A 2QJYB 4WWIA 4DCKA 3H25A 1NENC 5AVTB 3I55P 1R5SA 4Y99B 1SQBJ 3CX5D 2OGUA 2NPSC 2XZRA 3QH9A 1A02F 3PLNA 4IFDK 1M8OB 2E76B 3VN0A 2N1TB 3HD7D 5APQA 3B4SA 1BSHA 1RE3C 2XNDH 1H0TB 3CCRP 1LTAC 2P10A 4C46A 2ZXEB 2OTKE 1JY3P 2WP9C 1LP1A 2J58A 1OMIA 3KXDA 1CSBA 1ZMEC 2FYUG 2CPSA 5BVZA 4GOFA 2PFXA 1MV8A 3AEGD 1WRGA 1YTZI 4WY4D 3H1IE 3BCCG 1XTGB 3CCMP 3H1JJ 1QVGO 2M8RA 1W5CE 1IZNB 5L8RJ 2GUSA 1PL5A 1URQA 2Q3EA 2P1JA 1T8ZA 2NPSB 2IYOA 1S9KD 1YHQP 3AE8C 1LTJB 2Z5IA 2A45G 3K5BA 2WU2C 4DJGA 3D71A 1R5LA 3CI9A 3KPEA 2JKVA 2HPCA 1EZVE 4PV1C 2XNXA 3L72G 3P8CE 1L0LJ 2A06D 3NMDA 3TGUG 2G8YA 2XDJA 3CL3D 1KB9I 2E75C 2ZYDA 2B87A 2HR3A 4GOEA 5B66E 1NJIQ 1USDA 2WVRA 2WU5D 1SQVD 2IYPA 1H89A 1HVVA 1SFCC 4WVZA 5KLVE 3AE5D 2B76D 2OYHC 2WSEH 3AE9C 1N8RQ 1JCCA 4OH8B 3L71J 3MD0A 1EC5A 3GW6A 4OWFA 2E74C 1FZFA 2MKVA 2O01H 2W8ZA 3RK3E 2YIUB 2KNCA 3RK2C 4N6JA 2FFDC 1FOSE 1FBMA 1NU1K 1P84I 3GHGB 1JY2P 4GDOA 1Q2NA 2UWJE 4JF7A 1SQPK 1RF1C 1ZR2A 4CPGA 1L0NJ 3L73D 2ZXXA 3AEFD 3TNUA 1AQTA 2HODA 3P4SD 3S4RA 1SLQA 4H44B 4RO0A 3L36A 1L4AD 3RBZA 2Q7CA 5BU8B 1EXJA 1VQKP 2BS4C 1VQ6P 1NTKJ 1EXIA 1MUUA 1NYHA 2K9YA 1E7PC 1SQBG 3L4FA 3CC2P 4KJMA 1LNQA 1AA0A 4PD4I 5H2FH 3SFDD 1PV3A 2A06G 5CCGA 5K5GB 1VDFA 2XKMA 4DHJA 2ACZD 3L72E 2QEXP 1RF1B 4W7YA 1NAYA 3F5HA 1QEXA 3A0BH 1LWUA 5GTHH 1KB9H 3AEEC 2FBWD 2JJLA 2R32A 5KJ7C 2FYUK 1EQ7A 3P4PD 3M0AA 3F89A 3CIRC 3VP8A 1H88A 1LTBC 4WB4A 2WZ7A 2Y9YA 3AEBD 3BATA 3CLQA 5KLVK 2FYUJ 2FXOA 2ZFYA 3H1KG 1Q86Q 1RHZB 1PP9J 3RL0D 4JBZA 3CX5E 3O6QB 1VQNP 3MTUE 1ZN5A 3L74D 3NXSA 1T3UA 1M57D 1M56D 2KOGA 2YXRB 4U3FJ 5BU5A 1FZCC 4WY4C 5AW2B 2LKMA 1KILA 4YTNC 3Q3DA 4YTMD 1NTMJ 4C7NB 3GG2A 4ZMDA 4UB8H 2FY8A 2KLVA 2N9YB 1VQ8P 2C0XA 2WS3C 3HE4B 4DT0A 3GF3A 1L2PA 1SQBD 3L74E 3L74J 1Q81Q 1KD1Q 2K9JB 2H7HA 3MP7B 3AEDD 4LC1A 1E5WA 1G1JA 2K3RA 3V2NA 4BWNA 1QX8A 1NTMD 1Y8AA 5CCGC 1R8EA 1QL2A 2OYIC 1SQQG 1EZVD 3L73G 1NTZK 2BCCE 1K04A 2DW3A 2WMMA 1GL2D 5B5EE 4UB8E 5AW1B 2V7QH 2O01J 3L37A 3AEDC 2HPCB 3TGUJ 2IFNA 3L70D 3A2AA 4YSXD 1S5LX 1YIJP 1RE4C 2B89A 4IOIH 1NTZJ 1VF5D 3AEGC 2BS3C 3L75G 4ZKUA 1SQPE 3H1KJ 3UIAA 2RN0A 2A45H 2ZFCA 4TT3H 2C9LY 1PPJG 3L71G 2OTLP 4YSXC 3D6ZA 1IC2A 4U7JA 2WPVB 3P4QC 1A02J 2RMZA 2KLUA 5AVZB 2PRRA 1X0TA 3D6YA 1EZVI 3W67A 4YXDD 2NZ2A 4KX6D 2K1AA 5CBOA 3V2PA 3VTPC 5APWA 3R2PA 1KB9E 4ZKPA 2E76D 2J59M 1MFTA 3GMAA 4H13D 1QLBC 1LT1A 1NTMK 5E79H 1ZXGA 2R44A 3RK3B 2NRGA 4JPZB 1XTCC 3WU2H 1GDTA 3FWLA 1RH5B 5AVYB 3VOPA 4BRYB 3B5NA 1KORA 5TISE 1JUNA 4AUWA 4EOTA 2H89C 4D6TE 1FC2C 4I7ZB 3R4YA 3P4PC 2QJYC 3P8CD 5AW7B 2M5AB 3AEBC 1ZOYD 1SQVK 1KFMA 1VF5C 4O9BA 4KHXA 5AW5B 2R3SA 1LGHB 1FZBA 2NPSD 1GK6A 4N78E 3MZWB 3A0HE 1NU1J 4JYBA 1UIIA 2POHA 2V4HA 3P4QD 1ZRTE 1SQXE 5M1BA 3H32B
chains in the Genus database with same CATH topology
3EWKA 3AEFD 1Q90D 4TT3H 2FBWC 2QSIA 1WMKA 3SFEC 3P4SD 1ZP0D 5C3JD 5L8RJ 1PIXA 4YSXC 1PL5A 3SFED 4H0LD 4H44B 3VRBD 2WDQC 3FGAD 3VRAD 1IK7A 3VR8C 3D6ZA 4YXDC 1NGMB 4H13C 1RQVA 2JP3A 4U7JA 1TU3F 3RL0g 2WPVB 5C2TC 5KLIC 4I7ZC 3P4QC 4YTNC 3Q3DA 1UIXA 2E76C 1HJ0A 3AE5C 3AE8C 3GF7A 1EXJA 4YTMD 3O6QA 2BS4C 4YSYC 1RQUA 2WDQD 3P4RD 2H88C 3LW5J 2WDVD 3GLMA 1EXIA 2D2CB 3D6YA 5C2TD 3AE7C 4IL6X 1YQ3D 1NYHA 2BEQD 2K9YA 1E7PC 4KX6C 2WU2C 3AE4C 4YXDD 3AE1C 4XFJA 1OW6A 1KF6D 1KTMA 3D71A 2WQYD 3Q5RA 2NZ2A 3IN6A 4H0LC 4KX6D 3VRBC 4RKUJ 4OGQC 4PV1C 2H88D 2WDVC 1KMIZ 2E75D 2ACZC 1KILE 4H0LB 4H44D 1DD4A 2E74D 1PV3A 2E76D 1KFYD 3AEAD 2WSCJ 3S9OA 3SFDD 4YSZC 2G8YA 3AEAC 3GMAA 4H13D 3Q5PA 1QLBC 3ABVD 2WQYC 1U57A 2E75C 2ACZD 2WS3C 3VRAC 1NENC 3H25A 2BS2C 4OGQD 1ZP0C 3AE7D 2J5UA 3GF3A 4YT0C 3AE6C 1KQGB 3AECD 2YMKA 3IAOA 4PV1B 3Q1MA 2JO1A 1MKMA 2ZT9B 3AE1D 4YSYD 1HF9A 2WU5D 1NEKD 2ZT9C 1KORA 1NEKC 3Q5SA 3AE2C 2B76C 2H89D 1K05A 4R4MA 2WU5C 1YQ4D 3AEDD 5KKZC 1DIPA 2QJKC 4Z1MH 3AE5D 2H89C 4YTPC 2QJPC 3AE3C 3Q2YA 2B76D 3C8VA 1GMJA 2E75B 3AEEC 3CIRD 5C3JC 1KQFB 3VR9C 2E74B 2FBWD 2E76B 1NEND 3AE9C 4I7ZB 1KF6C 1VF5B 3R4YA 1FDIA 3P4PC 2QJYC 2WU2D 3ABVC 4H13B 4YT0D 1R8EA 3VR9D 2G3AA 1JB0J 1YQ3C 3AECC 3AEED 4YSZD 2IDBA 4YTPD 3P4PD 3AEBC 1ZOYD 4H44C 1Y9BA 4OGQB 2WDRC 3AE9D 3AEFC 1K04A 3AE2D 3CIRC 1VF5C 4PV1D 2P10A 1OW8A 2FYNC 2ZT9D 2V7QJ 2E74C 2WSFJ 4Y28J 2O01J 1VL2A 2MKVA 1YQ4C 3AEDC 1L0VD 1FDOA 1DD3A 2D2CC 2WDRD 4R4LA 3RK3E 3AEBD 3VR8D 2YIUC 2WP9D 4YSXD 2WP9C 2BEZF 1S5LX 4KT0J 1OMIA 2FXPA 3B71A 2WSEJ 1AJYA 1L0VC 3AE4D 3AE6D 2OQQA 1ZMEC 3G9RA 4YTND 3AE3D 1VF5D 4GDOA 3P4RC 3SFDC 1KFYC 2WS3D 2D2CD 3AEGD 1S1CX 1OW7A 3AEGC 3AE8D 4YTMC 3T97B 1ZOYC 2BS3C 2QIWA 3P4QD 1ZRTE 5M1BA 3D70A 3P4SC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AEF D;  2FBW C;  3P4S D;  3SFE C;  1ZP0 D;  5C3J D;  4YSX C;  3SFE D;  3VRB D;  2WDQ C;  3VRA D;  3VR8 C;  4YXD C;  5C2T C;  4YTN C;  3P4Q C;  3AE5 C;  3AE8 C;  4YTM D;  2BS4 C;  4YSY C;  3P4R D;  2WDQ D;  2H88 C;  2WDV D;  5C2T D;  3AE7 C;  1YQ3 D;  4KX6 C;  1E7P C;  2WU2 C;  3AE4 C;  4YXD D;  3AE1 C;  1KF6 D;  1OW6 A;  1KTM A;  2WQY D;  3VRB C;  4KX6 D;  2H88 D;  2WDV C;  2ACZ C;  1KFY D;  1PV3 A;  3SFD D;  3AEA D;  3S9O A;  4YSZ C;  3AEA C;  1QLB C;  3ABV D;  2WQY C;  2ACZ D;  2WS3 C;  3VRA C;  1NEN C;  2BS2 C;  1ZP0 C;  3AE7 D;  4YT0 C;  3AE6 C;  4YSY D;  3AE1 D;  2WU5 D;  1NEK D;  1NEK C;  2B76 C;  3AE2 C;  2H89 D;  1K05 A;  2WU5 C;  1YQ4 D;  3AED D;  3AE5 D;  2H89 C;  4YTP C;  2B76 D;  3AE3 C;  3AEE C;  3CIR D;  5C3J C;  3VR9 C;  2FBW D;  1NEN D;  3AE9 C;  1KF6 C;  3P4P C;  2WU2 D;  3ABV C;  4YT0 D;  3VR9 D;  2G3A A;  3AEC C;  1YQ3 C;  3AEE D;  4YSZ D;  4YTP D;  3P4P D;  3AEB C;  1ZOY D;  3AE9 D;  2WDR C;  3AEF C;  1K04 A;  3AE2 D;  3CIR C;  1OW8 A;  1YQ4 C;  3AED C;  1L0V D;  2WDR D;  3VR8 D;  3AEB D;  2WP9 D;  4YSX D;  2WP9 C;  3B71 A;  1L0V C;  3AE4 D;  3AE6 D;  4YTN D;  3AE3 D;  3P4R C;  3SFD C;  1KFY C;  2WS3 D;  3AEG D;  1OW7 A;  3AEG C;  3AE8 D;  4YTM C;  1ZOY C;  2BS3 C;  3P4Q D;  3AEC D;  3P4S C; 
#chains in the Genus database with same CATH topology
 2W6A A;  3V4Q A;  4PJ0 H;  4ASW A;  1L0L K;  1NVO A;  3PTZ A;  4C7N A;  1CI6 A;  1PPJ E;  4GOD A;  4HB1 A;  3RL0 B;  1S4X A;  3GF7 A;  3VON A;  4YSY C;  1KIL B;  1LT9 B;  2QJK B;  3GLM A;  3HUS C;  5CCH A;  3PJS K;  1KYO E;  1NH4 A;  1NWQ A;  1PP9 G;  1JY2 O;  4H0L B;  4W7Z A;  4TLF A;  4PD4 E;  3CMA P;  5KLV J;  1LTT C;  1RF0 C;  1FZA A;  3JCU H;  4EDF A;  1AQ5 A;  3Q5S A;  4IL6 H;  3O8Z A;  4Z1M H;  3TDK A;  2M0B A;  4PD4 D;  5KLI B;  1FDI A;  3ABV C;  4YTP D;  1GW3 A;  1KYO D;  3AE9 D;  1BCC G;  2B88 A;  5TJH A;  1J1D B;  1EDK A;  4PV1 D;  2FYN C;  1URQ C;  2PP6 A;  3CC7 P;  1DD3 A;  3H1I D;  1S2E A;  4PJ0 E;  1Q82 Q;  3ZDM A;  2KI7 B;  4YTM C;  2A45 I;  1RY3 A;  2KZJ A;  3AEC D;  1KC8 Q;  1X79 B;  1PZQ A;  1IK7 A;  4IL6 E;  5KLI C;  1AVY A;  3RK3 D;  3H1H E;  2OYO A;  5C2T D;  1EDL A;  2CK3 H;  2Q6Q A;  3HE5 A;  1KTM A;  1KB9 D;  3PP5 A;  1U7M A;  3TNU B;  1T2K C;  3CCL P;  1N73 B;  1IFM A;  2H88 D;  1J1E B;  3MUD A;  3N7N A;  2K88 A;  1VQM P;  1HBW A;  1FDM A;  4PD4 H;  5AW8 B;  1L0N G;  5GTI H;  1BGY G;  2AEJ A;  1PP9 D;  2H8P D;  3GHG A;  2I8D A;  2PGD A;  3LW5 H;  1KIL D;  1KQG B;  1GK4 A;  3I5C A;  4PV1 B;  1HF9 A;  5E79 E;  3HUS A;  3P7K A;  2ITA A;  2H89 D;  1FZC B;  2FFD B;  3VMX A;  4BRY A;  3E1I A;  2E74 B;  1DX7 A;  1J1D C;  5CCG D;  1Y9B A;  2YXQ B;  1P84 H;  1RF0 A;  3IR9 A;  1OW8 A;  5KTB A;  3M0D A;  2D2C C;  2Q3I A;  3A0H H;  5CCH D;  2WPR A;  3FXE A;  1YI2 P;  1X8Y A;  4NPE A;  1L4A A;  1PGQ A;  2IBZ I;  3VP9 A;  2E5T A;  1SQP J;  3H1K E;  1NKN A;  4UB6 H;  2Y9Z A;  1YJN P;  5C39 A;  3G71 P;  1NTZ E;  3BCC J;  4H0L D;  2YKO A;  1L0L E;  4I7Z C;  3AE5 C;  2LR2 A;  2WWW A;  4XE5 B;  1FU1 A;  3LW5 J;  1NTK K;  5AW9 B;  2NPS A;  2WSS H;  1JY3 N;  1N7S A;  2BAS A;  1D7M A;  5KJ7 A;  4ZNC A;  2E74 D;  1L0N D;  3L73 J;  4A7P A;  3PHL A;  4RJT A;  1USE A;  3ABV D;  3WUT A;  1U57 A;  1L4A B;  2JEE A;  3M9B A;  3V2Q A;  2ZYA A;  1W2E A;  2Y0E A;  2KS1 A;  1ZR4 A;  2B76 C;  3EFG A;  1NTK D;  1YQ4 D;  1QLE D;  4YTP C;  2E43 A;  2O1J A;  3ITK A;  4YPC A;  1PPJ D;  2QM7 A;  4YSZ D;  3V6I A;  3GHG C;  3AE2 D;  1LWU B;  2IZ1 A;  2GA1 A;  1FZC A;  1SQB K;  4DHI B;  2WSF J;  3RGU A;  1YQ4 C;  2WDR D;  1L0V D;  3H1H D;  1FDO A;  3HRN A;  4M3L A;  3H1J G;  1N7S B;  1TFF A;  2MJZ A;  1KN7 A;  3CWB G;  2FYN B;  3G9R A;  3LIE A;  3H6P A;  1FZE A;  5B5E H;  3QWO C;  1SQB E;  5APS A;  3TF5 A;  1YJW P;  3AE8 D;  1EDI A;  2P67 A;  3P4S C;  1VQ5 P;  1Q90 D;  2QJP B;  2QSI A;  5KKZ B;  1NTM G;  1YJ9 P;  3CCJ P;  1NU1 E;  2QG4 A;  3E1R A;  3M0D C;  1SQP G;  2ZVO B;  2JP3 A;  2YNY A;  2I1K A;  3CXH E;  3U1A A;  3P4R D;  2H88 C;  2W27 A;  1P84 E;  3AE7 C;  3II6 A;  4IL6 X;  4EI2 A;  2SPZ A;  2WTY A;  1YQ3 D;  3RK2 D;  2JWA A;  1OW6 A;  3H1H J;  2L5G B;  5B66 H;  2HOD B;  5CJ4 A;  3A7O A;  2W6J H;  1KFY D;  1JCD A;  3KHU A;  2KSE A;  1JO5 A;  4OGQ D;  1GU4 A;  2WT7 B;  3AE7 D;  2W90 A;  3OA7 A;  3KQG A;  1IJD B;  3M9H A;  1HGV A;  3FXD A;  2IFM A;  1NEK D;  2FFD A;  1JMM A;  1K05 A;  1N7S C;  4R4M A;  1DIP A;  2JR8 A;  1S5L E;  5AW4 B;  2AXT H;  3MHV A;  1SQQ K;  1JY2 N;  1KF6 C;  3TGU E;  1HGZ A;  2AXC A;  1RF1 A;  1M1J A;  3U59 A;  1FOS F;  3L35 A;  4WY4 B;  4D6T G;  2WPS A;  4I6L A;  1AV1 A;  4IFM A;  4RES B;  5KAF E;  4L73 A;  4JYC A;  3P32 A;  3AE6 D;  1KZU B;  4DZO A;  3SSU A;  3AE3 D;  2WS3 D;  3HD7 A;  1SQX D;  1GL2 B;  1VQO P;  3TYY A;  2FBW C;  3H1L G;  3SFE C;  1HWT C;  2IZ0 A;  1LT9 A;  3A5T A;  2YMY A;  2WDV D;  2R5B A;  4LLH A;  3AE4 C;  1KF6 D;  3KYQ A;  3CXH D;  1OIP A;  1Z56 A;  2E75 D;  1KIL E;  1SS1 A;  3AEA D;  3C9I A;  2I1J A;  3CME P;  2WQY C;  4L74 A;  3M91 A;  3VRA C;  4OVN F;  2J5U A;  2KUB A;  1T2K D;  3IAO A;  3RBX A;  4YSY D;  3SWF A;  2ZT9 C;  3CCQ P;  4LGD E;  3CC4 P;  1FJK A;  3OJA B;  1J2J B;  2KS1 B;  2QJP C;  2YO2 A;  3CIR D;  2FYU E;  1H0T A;  3FX0 A;  3SWK A;  1NEN D;  1BDC A;  2VRS A;  1KYO H;  4H13 B;  3VMY A;  3VR9 D;  3NFQ A;  2IDB A;  4H44 C;  4OGQ B;  3L75 D;  1MZ9 A;  2ZT9 D;  4K3A A;  1JY3 O;  3VR8 D;  2E42 A;  2OAR A;  5DJT B;  1ZRT D;  4U3F G;  5KAI E;  2BEZ F;  1S9K E;  4D6T J;  1VQ7 P;  2FXP A;  1WT6 A;  3B71 A;  2HFE D;  4U3F D;  3L70 G;  1W2B O;  3JSV C;  1IFP A;  1FE6 A;  4BXL A;  4C7R A;  3TK1 A;  2KP8 A;  3RK2 B;  3CX5 I;  1RE3 A;  1EZV G;  1SQQ D;  3L72 J;  2W6B A;  1ZLL A;  2Z4E A;  4H13 C;  3RL0 g;  1FJP A;  1HTL C;  2WDQ D;  2WIT A;  1L4A C;  2BEQ D;  4KX6 C;  3AE1 C;  3Q5R A;  3IN6 A;  5KLV G;  3VRB C;  2WSC J;  3S9O A;  2OYI A;  1VPC A;  2WSC H;  1N7L A;  4AQR D;  2M5A A;  1T3J A;  5DJU B;  1S3J A;  5APX A;  1IFI A;  1L0N E;  1AVO A;  4FJV A;  3WU2 E;  1BGY E;  3WMM 0;  1L0L D;  4GT1 A;  1NKZ B;  2XV5 A;  1RE4 A;  1NOH A;  2QJK C;  1YIT P;  1IO4 A;  1FAV A;  3Q2Y A;  1GMJ A;  5C3J C;  1JM0 A;  3H1L D;  3AEC C;  1JB0 J;  3AEE D;  1SQX G;  2BCC J;  4K35 A;  1YYC A;  3L74 G;  1GL2 C;  3KZI H;  1PGP A;  2IBZ D;  2Y0D A;  2OYH B;  1HUC A;  2K9J A;  4NPF X;  3H1K D;  3LID A;  2WSE J;  2HLO A;  5AVW B;  1N86 A;  2O3J A;  3KDP B;  2IBZ G;  3G6E P;  1OVU A;  4I2L C;  2YO3 A;  3L70 E;  4D6T D;  2IPP A;  3CCE P;  1CW5 A;  1WMK A;  1JMB A;  1PIX A;  1Y47 A;  3FWN A;  5AW0 B;  1JOC A;  3FGA D;  4YXD C;  1YTZ T;  1S5L H;  1OX3 A;  1TU3 F;  2E76 C;  1HJ0 A;  4B86 A;  3EFF K;  4W80 A;  1L0L G;  1JTH A;  4L75 A;  1NHL A;  3L75 E;  3SWY A;  1S72 P;  1QL1 A;  5APY A;  2WDV C;  3BRT B;  3RK3 C;  5CHX A;  5GTI E;  4LDT A;  5H2F E;  1PFI A;  1X22 A;  3E7K A;  5KLV D;  1ZP0 C;  3H1I J;  2ZT9 B;  4UB6 E;  2Q1K A;  1OZH A;  3OAK A;  4EIJ A;  1NEK C;  2WU5 C;  1VQ9 P;  1N7S D;  2KZI A;  3C8V A;  2E75 B;  4N3Y B;  2P2U A;  3VR9 C;  2XU6 A;  1VF5 B;  4I1L A;  4NPD A;  2WU2 D;  3HE4 A;  3USS A;  3BRV B;  4DHZ A;  2AEF A;  1SP4 A;  1CZQ A;  1VQL P;  1G2C A;  2K37 A;  4Y28 J;  2Q9I A;  1LTG C;  5KAI H;  5GTH E;  3H1J D;  5APT A;  2QE7 H;  1L0V C;  3CCV P;  3H1H G;  3H1J E;  3SFD C;  3VMZ A;  2D2C D;  1CI6 B;  2AEM A;  5CJ0 A;  1SQX K;  1SQX J;  3T97 B;  2IBZ E;  2ZVN B;  5CBN A;  4ASV A;  1ZP0 D;  1GL2 A;  3H32 A;  2BCC D;  3WUV A;  2WDQ C;  2Z5H A;  2QVA A;  1KV4 A;  1NTK G;  1SQV J;  1LTI C;  1SQV G;  4XFJ A;  5AVS B;  1LTS C;  4DDG A;  2C0W A;  3TGU D;  1NU1 D;  2ZJS E;  2FYZ A;  1JEK A;  4YSZ C;  3AEA C;  3L72 D;  4WY4 A;  1NO4 A;  2FKW B;  3RL0 C;  3CXH I;  1KQL A;  1BGY J;  2KXP B;  2R5D A;  4Y99 C;  3IF4 A;  4JQ0 D;  5AW6 B;  1G2C B;  5AVR B;  2HYN A;  2H43 A;  3B5N B;  1P84 D;  2O01 N;  4MN4 C;  3TSI A;  2A06 E;  2WT7 A;  1M7L A;  3IFM A;  4YT0 D;  1YQ3 C;  3N4X A;  3BCC D;  1BE3 E;  3L71 E;  2CPB A;  2FYU D;  1QVF O;  4I6M C;  1EDJ A;  1VQP P;  1SQQ J;  2KYV A;  4AYC A;  2LXB A;  3KZI E;  3P8M C;  1GU5 A;  4N78 D;  4DOJ A;  3JCU E;  2JWD A;  2QIW A;  4QMA A;  1BCC E;  2RKL A;  1L0N K;  3EWK A;  3V5B A;  3VRB D;  1SFC D;  2GUV A;  5APV A;  1HJB A;  2RH0 A;  3V2R A;  4DDI A;  3H1L E;  4EYY Q;  1N2D C;  3L75 J;  1FZG A;  3A3Y B;  3PH0 A;  2KIK A;  1QGK B;  2KNC B;  2M3B A;  4GIF A;  1HH0 A;  1M1J C;  1VQ4 P;  2B9B A;  3CWB J;  2ZYG A;  2R3C A;  2KSJ A;  2GM4 A;  1LP1 B;  3L70 J;  2JO1 A;  1JNM A;  1GZL A;  1IFJ A;  1M90 Q;  3G4S P;  2IX7 C;  5KKZ C;  3CWB E;  3AE3 C;  1SVF A;  3MGN A;  1SQP D;  3HD7 C;  2B87 B;  2YKQ A;  3AEF C;  2KK7 A;  2V7Q J;  1NTM E;  2E5Y A;  2C9N Y;  2WP9 D;  1BE3 G;  3CWB D;  1BE3 D;  1LWU C;  2N9B A;  1LTJ A;  5CMZ A;  4U3F E;  5TIS H;  1KFY C;  3P4R C;  2L91 A;  2OYI B;  3D70 A;  1N73 A;  1URQ B;  1E79 H;  1MFZ A;  2HG5 D;  3VRA D;  3VR8 C;  1G1I A;  2JDI H;  5C2T C;  3O6Q A;  1RQU A;  2D2C B;  3VYI A;  2LXC B;  3JC2 2;  3B5N D;  3CXH H;  3EQ2 A;  2ACZ C;  1NTZ G;  1GD2 E;  2W83 C;  3T97 A;  3Q5P A;  2M3E A;  3WUU A;  3HTK B;  1X9V A;  1U7J A;  2N1T A;  3AE6 C;  1IFN A;  3AE1 D;  2QM8 A;  2QRX A;  5CCH C;  3AE2 C;  4L76 A;  5AVX B;  3HUS B;  1K9M Q;  2G3A A;  5APU A;  1BDD A;  1URQ D;  3CD6 P;  3V4W A;  1DEE G;  1VL2 A;  3CCU P;  4HJG H;  2QA4 P;  4R4L A;  5AVU B;  3I56 P;  3HE5 B;  1SFC B;  5KAF H;  5AW3 B;  4KT0 J;  1OFC X;  2OQQ A;  3W68 A;  4YTN D;  2N1T D;  4HKZ H;  1S1C X;  1OXZ A;  1KYO I;  1ZOY C;  2Y0C A;  1NAF A;  1OVR A;  3PRJ A;  3S1K A;  3BAS A;  5C3J D;  1IK9 A;  4IFF A;  2AXT E;  1DEB A;  3M9Q A;  1PGO A;  1UIX A;  3CCS P;  1IFD A;  1LTJ C;  1K73 Q;  1KFN A;  4YXW H;  1GTW A;  5KJ7 D;  1PGJ A;  4OGQ C;  3G3Z A;  1J1E C;  1N73 C;  1BGY D;  3U1C A;  1BSN A;  1NU1 G;  1NTZ D;  3HD7 B;  1OWA A;  3VMA A;  2BS2 C;  1BCC J;  5EFW B;  4YT0 C;  2YMK A;  3Q1M A;  3BVH A;  1MKM A;  4WBA A;  2PAJ A;  3CPW O;  3B8E B;  1LJ2 A;  1SQQ E;  2P7J A;  1PP9 E;  2P58 A;  2Q5U A;  3L73 E;  3C1L A;  1KQF B;  2BCC G;  3MUD C;  1K8A Q;  3L71 D;  1M1J B;  1ZV8 A;  2WDR C;  1AFO A;  1T6A A;  2N1T C;  1ZW0 A;  1OVV A;  2WSF H;  2WPQ A;  3H1L J;  1LT9 C;  2YIU C;  3B5N C;  1KIL C;  1KQS O;  1JTH B;  1AJY A;  3M06 A;  3H1I G;  3AE4 D;  3HTK A;  1Q7Y Q;  3BCC E;  2ZAE B;  3MIW A;  1DH3 A;  4XA4 A;  2YKP A;  4GKG A;  1OW7 A;  4HH2 A;  3A0B E;  5AVV B;  1BCC D;  2OTJ P;  2FXM A;  2O1K A;  3CX5 H;  5AVQ B;  3SFE D;  1NGM B;  3NTN A;  3OW2 O;  1RQV A;  1YBK A;  1BE3 J;  1NTK E;  1SFC A;  1H8A A;  1GW4 A;  2WQY D;  4HYT B;  4H0L C;  2OYH A;  1SQV E;  4RKU J;  1FS0 E;  1M1K Q;  2KB7 P;  1KMI Z;  4H44 D;  1DD4 A;  2QJY B;  4WWI A;  4DCK A;  3H25 A;  1NEN C;  5AVT B;  3I55 P;  1R5S A;  4Y99 B;  1SQB J;  3CX5 D;  2OGU A;  2NPS C;  2XZR A;  3QH9 A;  1A02 F;  3PLN A;  4IFD K;  1M8O B;  2E76 B;  3VN0 A;  2N1T B;  3HD7 D;  5APQ A;  3B4S A;  1BSH A;  1RE3 C;  2XND H;  1H0T B;  3CCR P;  1LTA C;  2P10 A;  4C46 A;  2ZXE B;  2OTK E;  1JY3 P;  2WP9 C;  1LP1 A;  2J58 A;  1OMI A;  3KXD A;  1CSB A;  1ZME C;  2FYU G;  2CPS A;  5BVZ A;  4GOF A;  2PFX A;  1MV8 A;  3AEG D;  1WRG A;  1YTZ I;  4WY4 D;  3H1I E;  3BCC G;  1XTG B;  3CCM P;  3H1J J;  1QVG O;  2M8R A;  1W5C E;  1IZN B;  5L8R J;  2GUS A;  1PL5 A;  1URQ A;  2Q3E A;  2P1J A;  1T8Z A;  2NPS B;  2IYO A;  1S9K D;  1YHQ P;  3AE8 C;  1LTJ B;  2Z5I A;  2A45 G;  3K5B A;  2WU2 C;  4DJG A;  3D71 A;  1R5L A;  3CI9 A;  3KPE A;  2JKV A;  2HPC A;  1EZV E;  4PV1 C;  2XNX A;  3L72 G;  3P8C E;  1L0L J;  2A06 D;  3NMD A;  3TGU G;  2G8Y A;  2XDJ A;  3CL3 D;  1KB9 I;  2E75 C;  2ZYD A;  2B87 A;  2HR3 A;  4GOE A;  5B66 E;  1NJI Q;  1USD A;  2WVR A;  2WU5 D;  1SQV D;  2IYP A;  1H89 A;  1HVV A;  1SFC C;  4WVZ A;  5KLV E;  3AE5 D;  2B76 D;  2OYH C;  2WSE H;  3AE9 C;  1N8R Q;  1JCC A;  4OH8 B;  3L71 J;  3MD0 A;  1EC5 A;  3GW6 A;  4OWF A;  2E74 C;  1FZF A;  2MKV A;  2O01 H;  2W8Z A;  3RK3 E;  2YIU B;  2KNC A;  3RK2 C;  4N6J A;  2FFD C;  1FOS E;  1FBM A;  1NU1 K;  1P84 I;  3GHG B;  1JY2 P;  4GDO A;  1Q2N A;  2UWJ E;  4JF7 A;  1SQP K;  1RF1 C;  1ZR2 A;  4CPG A;  1L0N J;  3L73 D;  2ZXX A;  3AEF D;  3TNU A;  1AQT A;  2HOD A;  3P4S D;  3S4R A;  1SLQ A;  4H44 B;  4RO0 A;  3L36 A;  1L4A D;  3RBZ A;  2Q7C A;  5BU8 B;  1EXJ A;  1VQK P;  2BS4 C;  1VQ6 P;  1NTK J;  1EXI A;  1MUU A;  1NYH A;  2K9Y A;  1E7P C;  1SQB G;  3L4F A;  3CC2 P;  4KJM A;  1LNQ A;  1AA0 A;  4PD4 I;  5H2F H;  3SFD D;  1PV3 A;  2A06 G;  5CCG A;  5K5G B;  1VDF A;  2XKM A;  4DHJ A;  2ACZ D;  3L72 E;  2QEX P;  1RF1 B;  4W7Y A;  1NAY A;  3F5H A;  1QEX A;  3A0B H;  1LWU A;  5GTH H;  1KB9 H;  3AEE C;  2FBW D;  2JJL A;  2R32 A;  5KJ7 C;  2FYU K;  1EQ7 A;  3P4P D;  3M0A A;  3F89 A;  3CIR C;  3VP8 A;  1H88 A;  1LTB C;  4WB4 A;  2WZ7 A;  2Y9Y A;  3AEB D;  3BAT A;  3CLQ A;  5KLV K;  2FYU J;  2FXO A;  2ZFY A;  3H1K G;  1Q86 Q;  1RHZ B;  1PP9 J;  3RL0 D;  4JBZ A;  3CX5 E;  3O6Q B;  1VQN P;  3MTU E;  1ZN5 A;  3L74 D;  3NXS A;  1T3U A;  1M57 D;  1M56 D;  2KOG A;  2YXR B;  4U3F J;  5BU5 A;  1FZC C;  4WY4 C;  5AW2 B;  2LKM A;  1KIL A;  4YTN C;  3Q3D A;  4YTM D;  1NTM J;  4C7N B;  3GG2 A;  4ZMD A;  4UB8 H;  2FY8 A;  2KLV A;  2N9Y B;  1VQ8 P;  2C0X A;  2WS3 C;  3HE4 B;  4DT0 A;  3GF3 A;  1L2P A;  1SQB D;  3L74 E;  3L74 J;  1Q81 Q;  1KD1 Q;  2K9J B;  2H7H A;  3MP7 B;  3AED D;  4LC1 A;  1E5W A;  1G1J A;  2K3R A;  3V2N A;  4BWN A;  1QX8 A;  1NTM D;  1Y8A A;  5CCG C;  1R8E A;  1QL2 A;  2OYI C;  1SQQ G;  1EZV D;  3L73 G;  1NTZ K;  2BCC E;  1K04 A;  2DW3 A;  2WMM A;  1GL2 D;  5B5E E;  4UB8 E;  5AW1 B;  2V7Q H;  2O01 J;  3L37 A;  3AED C;  2HPC B;  3TGU J;  2IFN A;  3L70 D;  3A2A A;  4YSX D;  1S5L X;  1YIJ P;  1RE4 C;  2B89 A;  4IOI H;  1NTZ J;  1VF5 D;  3AEG C;  2BS3 C;  3L75 G;  4ZKU A;  1SQP E;  3H1K J;  3UIA A;  2RN0 A;  2A45 H;  2ZFC A;  4TT3 H;  2C9L Y;  1PPJ G;  3L71 G;  2OTL P;  4YSX C;  3D6Z A;  1IC2 A;  4U7J A;  2WPV B;  3P4Q C;  1A02 J;  2RMZ A;  2KLU A;  5AVZ B;  2PRR A;  1X0T A;  3D6Y A;  1EZV I;  3W67 A;  4YXD D;  2NZ2 A;  4KX6 D;  2K1A A;  5CBO A;  3V2P A;  3VTP C;  5APW A;  3R2P A;  1KB9 E;  4ZKP A;  2E76 D;  2J59 M;  1MFT A;  3GMA A;  4H13 D;  1QLB C;  1LT1 A;  1NTM K;  5E79 H;  1ZXG A;  2R44 A;  3RK3 B;  2NRG A;  4JPZ B;  1XTC C;  3WU2 H;  1GDT A;  3FWL A;  1RH5 B;  5AVY B;  3VOP A;  4BRY B;  3B5N A;  1KOR A;  5TIS E;  1JUN A;  4AUW A;  4EOT A;  2H89 C;  4D6T E;  1FC2 C;  4I7Z B;  3R4Y A;  3P4P C;  2QJY C;  3P8C D;  5AW7 B;  2M5A B;  3AEB C;  1ZOY D;  1SQV K;  1KFM A;  1VF5 C;  4O9B A;  4KHX A;  5AW5 B;  2R3S A;  1LGH B;  1FZB A;  2NPS D;  1GK6 A;  4N78 E;  3MZW B;  3A0H E;  1NU1 J;  4JYB A;  1UII A;  2POH A;  2V4H A;  3P4Q D;  1ZRT E;  1SQX E;  5M1B A;  3H32 B; 
#chains in the Genus database with same CATH homology
 3EWK A;  3AEF D;  1Q90 D;  4TT3 H;  2FBW C;  2QSI A;  1WMK A;  3SFE C;  3P4S D;  1ZP0 D;  5C3J D;  5L8R J;  1PIX A;  4YSX C;  1PL5 A;  3SFE D;  4H0L D;  4H44 B;  3VRB D;  2WDQ C;  3FGA D;  3VRA D;  1IK7 A;  3VR8 C;  3D6Z A;  4YXD C;  1NGM B;  4H13 C;  1RQV A;  2JP3 A;  4U7J A;  1TU3 F;  3RL0 g;  2WPV B;  5C2T C;  5KLI C;  4I7Z C;  3P4Q C;  4YTN C;  3Q3D A;  1UIX A;  2E76 C;  1HJ0 A;  3AE5 C;  3AE8 C;  3GF7 A;  1EXJ A;  4YTM D;  3O6Q A;  2BS4 C;  4YSY C;  1RQU A;  2WDQ D;  3P4R D;  2H88 C;  3LW5 J;  2WDV D;  3GLM A;  1EXI A;  2D2C B;  3D6Y A;  5C2T D;  3AE7 C;  4IL6 X;  1YQ3 D;  1NYH A;  2BEQ D;  2K9Y A;  1E7P C;  4KX6 C;  2WU2 C;  3AE4 C;  4YXD D;  3AE1 C;  4XFJ A;  1OW6 A;  1KF6 D;  1KTM A;  3D71 A;  2WQY D;  3Q5R A;  2NZ2 A;  3IN6 A;  4H0L C;  4KX6 D;  3VRB C;  4RKU J;  4OGQ C;  4PV1 C;  2H88 D;  2WDV C;  1KMI Z;  2E75 D;  2ACZ C;  1KIL E;  4H0L B;  4H44 D;  1DD4 A;  2E74 D;  1PV3 A;  2E76 D;  1KFY D;  3AEA D;  2WSC J;  3S9O A;  3SFD D;  4YSZ C;  2G8Y A;  3AEA C;  3GMA A;  4H13 D;  3Q5P A;  1QLB C;  3ABV D;  2WQY C;  1U57 A;  2E75 C;  2ACZ D;  2WS3 C;  3VRA C;  1NEN C;  3H25 A;  2BS2 C;  4OGQ D;  1ZP0 C;  3AE7 D;  2J5U A;  3GF3 A;  4YT0 C;  3AE6 C;  1KQG B;  3AEC D;  2YMK A;  3IAO A;  4PV1 B;  3Q1M A;  2JO1 A;  1MKM A;  2ZT9 B;  3AE1 D;  4YSY D;  1HF9 A;  2WU5 D;  1NEK D;  2ZT9 C;  1KOR A;  1NEK C;  3Q5S A;  3AE2 C;  2B76 C;  2H89 D;  1K05 A;  4R4M A;  2WU5 C;  1YQ4 D;  3AED D;  5KKZ C;  1DIP A;  2QJK C;  4Z1M H;  3AE5 D;  2H89 C;  4YTP C;  2QJP C;  3AE3 C;  3Q2Y A;  2B76 D;  3C8V A;  1GMJ A;  2E75 B;  3AEE C;  3CIR D;  5C3J C;  1KQF B;  3VR9 C;  2E74 B;  2FBW D;  2E76 B;  1NEN D;  3AE9 C;  4I7Z B;  1KF6 C;  1VF5 B;  3R4Y A;  1FDI A;  3P4P C;  2QJY C;  2WU2 D;  3ABV C;  4H13 B;  4YT0 D;  1R8E A;  3VR9 D;  2G3A A;  1JB0 J;  1YQ3 C;  3AEC C;  3AEE D;  4YSZ D;  2IDB A;  4YTP D;  3P4P D;  3AEB C;  1ZOY D;  4H44 C;  1Y9B A;  4OGQ B;  2WDR C;  3AE9 D;  3AEF C;  1K04 A;  3AE2 D;  3CIR C;  1VF5 C;  4PV1 D;  2P10 A;  1OW8 A;  2FYN C;  2ZT9 D;  2V7Q J;  2E74 C;  2WSF J;  4Y28 J;  2O01 J;  1VL2 A;  2MKV A;  1YQ4 C;  3AED C;  1L0V D;  1FDO A;  1DD3 A;  2D2C C;  2WDR D;  4R4L A;  3RK3 E;  3AEB D;  3VR8 D;  2YIU C;  2WP9 D;  4YSX D;  2WP9 C;  2BEZ F;  1S5L X;  4KT0 J;  1OMI A;  2FXP A;  3B71 A;  2WSE J;  1AJY A;  1L0V C;  3AE4 D;  3AE6 D;  2OQQ A;  1ZME C;  3G9R A;  4YTN D;  3AE3 D;  1VF5 D;  4GDO A;  3P4R C;  3SFD C;  1KFY C;  2WS3 D;  2D2C D;  3AEG D;  1S1C X;  1OW7 A;  3AEG C;  3AE8 D;  4YTM C;  3T97 B;  1ZOY C;  2BS3 C;  2QIW A;  3P4Q D;  1ZRT E;  5M1B A;  3D70 A;  3P4S C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...