4YXDC

Crystal structure of porcine heart mitochondrial complex ii bound with flutolanil
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 48
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4yxdC01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 4yxdC02
1ZP0C 4YTPD 3ABVD 4YSYC 3P4RD 3CIRC 3AECC 1ZOYD 3P4QD 1OW8A 1NEKC 3AE9C 3P4SD 1K04A 1PV3A 3VRAC 3AE2D 1KFYC 1KF6D 2BS3C 4YSXD 1OW6A 4YXDD 2BS2C 3SFED 2ACZC 1YQ3D 3AEAD 3AE3C 2H88D 2WQYC 2FBWD 4YSZC 2WDVD 3AE4D 2WU5D 1ZP0D 3VRBC 4YSYD 3AE1C 4YT0C 3AEEC 2B76C 5C2TC 3CIRD 3AECD 2WS3C 2WDQC 1NEKD 3AE9D 3P4PC 3AEDC 5C3JC 3VRAD 3AE6C 1KFYD 2H89C 1NENC 2WU2C 2ACZD 3AE8C 3AE3D 2WP9C 1E7PC 4YSZD 3S9OA 3VRBD 3AE5C 3AE1D 4YT0D 4KX6C 2B76D 2WDRC 3AEED 5C2TD 4YTNC 2G3AA 2WS3D 2WDQD 3P4PD 3AEFC 3AEDD 3AEBC 5C3JD 3AE6D 1YQ4C 3VR9C 3VR8C 4YTMC 2H89D 2WU2D 3SFDC 3AE8D 3B71A 1L0VC 2WP9D 3AE7C 1QLBC 2WQYD 3AEGC 4YTPC 1KTMA 3ABVC 3AE5D 4KX6D 2WDRD 3P4RC 4YTND 1ZOYC 3P4QC 3P4SC 3AEFD 3AEBD 1OW7A 3AE2C 1KF6C 1YQ4D 4YSXC 4YTMD 3VR9D 3VR8D 4YXDC 3SFEC 1NEND 1K05A 1YQ3C 3AEAC 3SFDD 1L0VD 2H88C 2FBWC 2BS4C 3AE7D 2WDVC 3AEGD 3AE4C 2WU5C
chains in the Genus database with same CATH superfamily
2KUBA 4BWNA 3SWKA 3CIRC 2B87B 1NYHA 1FOSF 2POHA 1LT9A 1URQB 1KYOE 1M7LA 5APSA 2QM8A 2ZXEB 1BGYJ 1NTZG 3L71D 2E74B 4L74A 2Y9YA 3SFED 3Q1MA 2QG4A 4I6LA 1GL2B 2WDVD 1KD1Q 1T8ZA 1LTSC 2B89A 1NWQA 2QJPB 2E75D 2KI7B 4U3FE 1M57D 3FWNA 3KDPB 3CCQP 2OYHC 1IK7A 3SWYA 3PP5A 2OYHA 3E7KA 3L70G 2K9JB 2ACZD 1VQ4P 3AE8C 3CXHH 2XNXA 3I55P 1JY3O 3A5TA 2BEQD 2Q3IA 3CWBJ 3L75G 3L74G 2XU6A 2QIWA 4I7ZB 1GW4A 3H1HJ 3L70E 1J1DB 3TGUD 1NU1J 2WPSA 3AE7C 5B5EH 1VDFA 2MJZA 3V2RA 3T97B 4I6MC 1QX8A 3L75E 3HTKB 4LLHA 1LP1B 3L74E 2FYUK 2W83C 3RL0C 1YQ4D 4BXLA 2ZAEB 1URQC 1X79B 5AW4B 1BDDA 2B87A 2E74C 1KB9H 1NHLA 2FBWC 1OIPA 1IC2A 4AUWA 2QE7H 1URQA 4HH2A 1VQMP 1BGYD 2FYNB 3D6ZA 4EOTA 3P4RD 1A02J 3MIWA 1YYCA 1GL2C 3AECC 2LXCB 1ZOYD 3LIDA 2QJPC 3P4QD 2Q1KA 5AW5B 2P2UA 1FZCC 1GL2A 3A3YB 3VP9A 4IFMA 2C9NY 3SSUA 3G71P 1FZCA 4PJ0H 2N1TD 1NAYA 1DX7A 1N2DC 4HJGH 1EZVD 4WY4B 1PGPA 3BVHA 3D71A 2C0WA 4ASWA 2H89C 3MP7B 1JO5A 3IN6A 3Q3DA 1FDIA 2JDIH 1LWUC 2YO2A 5AVVB 2YXRB 3E1IA 2P58A 1VQ6P 3H1HD 1OFCX 3CXHE 3L72G 1LWUA 3JSVC 2CPBA 4YPCA 3RK3B 4YTMC 3ZDMA 1JTHA 4HKZH 1S9KD 3BCCG 1R5LA 1VQOP 3M9BA 3MTUE 1LP1A 4KX6D 5BU8B 1H0TB 1YTZT 5B5EE 3P4SC 2OTLP 2IBZE 5DJUB 1NTMK 3H32A 3BCCE 3V5BA 4O9BA 2CK3H 2H88C 4C7RA 3H1LJ 1EXIA 1SQBG 3VONA 3ABVD 3KHUA 1EDJA 3CX5H 1SS1A 1PGJA 5GTHH 2IYPA 5CJ4A 1K04A 1OXZA 2R3SA 2DW3A 1FU1A 3TYYA 1SQBE 1T2KC 1Y9BA 2JJLA 1PP9G 5CBOA 2ZJSE 1M56D 1MFTA 2QJKC 5CCGD 1JCCA 4PJ0E 1SQVK 1USDA 4NPFX 1VL2A 1S72P 3H1KG 1PP9E 1L0NK 1SQQD 3AE1D 1LGHB 1SLQA 1RE4C 2W6BA 4GT1A 5KAIH 3EFGA 1SP4A 3AEDD 4D6TD 3VR9C 1RE4A 1P84H 2PAJA 3A0HE 2H7HA 3H1KE 2WP9D 2YMKA 3OW2O 1BE3G 2NRGA 2IFMA 1SQXG 2IZ0A 1KZUB 1YIJP 2GA1A 1FAVA 1KORA 3V2NA 2M5AB 1L0LJ 4RJTA 1W2BO 1DEEG 3TF5A 2QM7A 2ZT9B 3H1LD 5TISH 1YJWP 1KC8Q 4TLFA 3NTNA 3H1JE 2KP8A 2YKOA 3NMDA 1PIXA 1BE3E 1SQXE 4RESB 4H0LD 1NH4A 2AXTE 2Q9IA 3RBXA 1KILC 1S2EA 2N9YB 3HD7C 3V6IA 3W68A 1GW3A 2W6AA 4C7NB 1PFIA 5AW7B 1OW6A 3HD7A 3RK3E 1E5WA 4ZKUA 3AEEC 3A7OA 4DHIB 1DD3A 2XV5A 2FXOA 1SFCB 3P4PC 1QVGO 3AE6C 1KYOD 2HPCB 3PJSK 4N78D 3WUVA 2Y9ZA 2R5DA 3CCSP 1SQPK 2Z4EA 3EFFK 2SPZA 5CCHC 2D2CD 4U3FD 5B66H 2FYUD 2WSFJ 5CCHA 3VMYA 3GW6A 3P8MC 4YXWH 2M5AA 1YI2P 3Q5SA 3H6PA 2YMYA 5CMZA 1IJDB 3F89A 2WDRD 3NFQA 2FFDB 4GIFA 5KAFH 1KF6C 1PZQA 3V2PA 2KS1B 3C9IA 4DZOA 5AVXB 1Q81Q 3GF3A 2WSEH 4PD4H 3VTPC 2Y0EA 1ZP0C 1N7SD 1LT1A 3QH9A 4YSYC 2NZ2A 1L4AB 1VF5D 4MN4C 1TU3F 4OGQD 4EYYQ 1PV3A 2KLVA 2HLOA 4WBAA 5KLVJ 3LW5H 2WPVB 2M3BA 2R44A 3IAOA 1SQVJ 1Y8AA 3R2PA 3PHLA 4YT0C 2B76C 2HPCA 1H89A 5AVRB 5APTA 1PPJD 3M0AA 1GK6A 1USEA 1NVOA 1ZRTE 1KFYD 2ZFCA 2JWDA 1X8YA 5H2FE 2L91A 2KYVA 2QSIA 4YSZD 5BVZA 2Y0CA 2N9BA 3VRBD 3FXDA 3U1AA 5C2TD 4PV1D 4BRYB 1GU4A 3L73J 1RQUA 2FFDC 3VR8C 1NTMD 2YIUB 2YNYA 2FFDA 2WQYD 2ZFYA 3G6EP 2OYHB 2QEXP 3L4FA 3VOPA 3AE5D 2KS1A 3H1IG 2A06G 3CXHD 1GTWA 3AEBD 4JQ0D 4YSXC 4L73A 1ZR2A 2ZXXA 3I5CA 1VQNP 3KYQA 1SQQK 5AW2B 3H1IE 3TGUJ 2A06E 1M1JB 3AE9C 4Y99C 2IBZD 1T3UA 1W5CE 1M90Q 3AE3C 5BU5A 3MGNA 3PLNA 2G8YA 1EDIA 1L0ND 4FJVA 5APWA 5KJ7C 4H44D 2P1JA 3RL0B 3B5NC 1KB9D 4JBZA 1SQPJ 4Y28J 5CHXA 5KJ7A 3CC2P 3B5NA 3L37A 2KB7P 1E7PC 2P10A 2YIUC 1NGMB 3L73D 1MFZA 2IZ1A 4BRYA 2KNCB 1VQPP 1G2CB 3GLMA 4Z1MH 1FZCB 1NTKG 2WS3D 1IFIA 5C3JD 3O6QA 3BASA 3HUSC 1XTCC 2J58A 1NTZE 1L0LG 4DCKA 2E5TA 3CC7P 2WU2D 2AEMA 3B71A 3HUSA 1KQLA 2E76D 4YTPC 1BCCJ 4WWIA 2I8DA 4W80A 2CPSA 1NTKE 1Q86Q 2XNDH 3AEFD 3CCMP 4ZMDA 3KZIE 1Q7YQ 2LKMA 5EFWB 1L0LE 1M1JC 3RK2C 1LWUB 1L0VD 2BS4C 3AEGD 3G4SP 1JTHB 1M1JA 1QL1A 1ZN5A 1YJNP 1HGZA 1OWAA 2HODB 4WY4D 3AE2D 1VQKP 2W27A 5CJ0A 3H1JD 1NTZK 3WUUA 2WT7A 4YXDD 1S3JA 1X22A 4W7ZA 2E75B 1JMMA 2WQYC 2WU5D 2R5BA 3H32B 1AVOA 1SQPD 1OVVA 2V7QJ 1JY3P 3A0BE 4ASVA 1KQGB 3QWOC 1QVFO 2YKPA 3VMAA 1HH0A 3HE5A 1N7LA 2M0BA 4L76A 1NKNA 5AW0B 3CX5D 1LTTC 2KNCA 3RK3D 1G2CA 2BCCD 2YO3A 4GDOA 1RF0C 5GTIE 3TDKA 2A45I 1RF0A 3P8CD 1AA0A 1ZXGA 5K5GB 1Q2NA 3FX0A 1RE3C 1BCCD 1IFDA 2A45G 1RE3A 2M3EA 1IZNB 2QJKB 2WMMA 2O01N 3A0HH 1FS0E 2MKVA 1EDKA 1OZHA 4DDIA 1SQQJ 3I56P 4KT0J 3SFEC 1NEND 2J59M 1JY2O 4A7PA 4D6TJ 2WDVC 3M91A 2HODA 5AVWB 2E75C 5KLVG 2FYZA 1P84D 3L72E 1SQVG 3VYIA 5KTBA 1VQ7P 3EQ2A 2XZRA 3IFMA 1IFPA 3R4YA 2AXTH 2ACZC 5AVSB 3AEAD 2IYOA 3S4RA 1EQ7A 2NPSD 3FXEA 2Z5IA 5CBNA 2HYNA 5KLVE 1X9VA 1WT6A 3L71G 1FZFA 3MD0A 3CCVP 1M1KQ 3CL3D 1RQVA 2WSEJ 1KILB 1PGQA 3HD7B 4DJGA 2O3JA 3MUDC 4W7YA 5AW3B 2WDQD 2PGDA 4XE5B 1S5LX 3L71E 3B4SA 1YQ4C 2ZT9D 3MUDA 5C39A 3WU2H 2WSCH 1Q90D 3P4RC 3WMM0 1ZOYC 4DT0A 1OMIA 3P4QC 5M1BA 3U59A 2KZJA 2O1JA 2KK7A 2ZYAA 4GOFA 1YBKA 1EC5A 4U3FJ 1M8OB 1VQ5P 2OYIC 1SQBK 2FYUJ 2N1TC 3SWFA 2P67A 2OYIA 2N1TA 3Q5PA 2I1KA 2FY8A 1SFCD 5TJHA 2I1JA 1KFMA 1LTAC 1YQ3D 1K73Q 3CMAP 4XFJA 1BGYG 4JYBA 2ZYDA 1HF9A 3CCUP 3H1ID 1NEKD 2A06D 4PD4D 2OGUA 3VRAD 1EZVI 1KILA 1NENC 2OYOA 4EI2A 1GZLA 1HUCA 1BGYE 1JOCA 2Q3EA 3V4QA 1EZVG 2IPPA 4KX6C 1NJIQ 5H2FH 5APVA 5APYA 4H13D 4DDGA 3CC4P 3CWBG 1IFMA 4R4MA 1SQXK 2K88A 1UIIA 3TNUB 3ABVC 1EZVE 3H1HG 3WU2E 4YTND 3KPEA 1NU1G 4DHJA 1L4AD 1NTZD 2Q7CA 2R32A 2ZVNB 3CWBE 3SFDD 3C8VA 2HFED 1U57A 3H1HE 1S1CX 1KILE 4ZNCA 3PRJA 4NPEA 1NTMJ 1X0TA 5CCGC 1NU1E 1HGVA 1QGKB 1BDCA 2QJYC 1S9KE 2RKLA 5CCGA 4OH8B 3L70D 3VMZA 1JY3N 3C1LA 3AE4D 1S5LH 2J5UA 2LR2A 3AE1C 2BASA 2GUVA 3CIRD 2W6JH 3CCRP 2WPQA 3AEDC 3L75D 3D6YA 3L74D 4XA4A 3IF4A 4R4LA 2W90A 2WP9C 2QVAA 3H25A 4M3LA 1DD4A 1KFNA 3GF7A 3BCCJ 4Y99B 4I2LC 3U1CA 4IFDK 1L0NJ 3GG2A 2JEEA 3TNUA 4GODA 3AE8D 1N86A 5AW1B 3GHGB 4H0LC 1T6AA 3KXDA 3B5NB 4RKUJ 3N4XA 1D7MA 4JYCA 4D6TG 1GDTA 2E43A 1DH3A 1MKMA 3P32A 2R3CA 5AVYB 1AV1A 2WTYA 3O6QB 3AE7D 4UB8H 4OGQB 3UIAA 3OJAB 2GUSA 3KZIH 3KQGA 3II6A 3O8ZA 1ZR4A 1FZAA 1Y47A 3HUSB 2QRXA 3H1LG 2YXQB 4HYTB 4OWFA 3EWKA 2M8RA 3RL0D 2BS3C 1PP9J 1URQD 3BRTB 2E74D 2FBWD 4LDTA 1YJ9P 2P7JA 3CD6P 1DIPA 1FZGA 1GL2D 3AECD 2D2CC 3H1LE 3L72D 3HRNA 3H1KJ 3RK2B 2H8PD 1S5LE 1JM0A 3ITKA 1H8AA 2KLUA 1AJYA 3HE4A 1KYOI 3BCCD 3M9HA 3A0BH 3GMAA 4PV1B 3S9OA 2WT7B 3H1JJ 1CW5A 2ITAA 2WDRC 3RL0g 3GHGC 3MZWB 3OAKA 1SQXJ 1FC2C 2H89D 1BSNA 3M06A 3GHGA 5AW6B 1R5SA 1HWTC 5L8RJ 4AYCA 5GTIH 1EXJA 1ZLLA 5AVTB 3HE5B 1N7SC 1SQBD 1LTIC 4LC1A 4U3FG 1VF5C 4OGQC 1N7SA 2FYUG 2BCCJ 3V4WA 2B88A 3N7NA 4N78E 2WSFH 4YTMD 2AEJA 2JP3A 3Q5RA 1OVRA 3USSA 2KZIA 3CCLP 4WB4A 1FE6A 4K3AA 1PP9D 1Z56A 2YKQA 2PFXA 2FYUE 4UB8E 3P4SD 2A45H 1CI6A 1KFYC 1E79H 3F5HA 2H88D 1XTGB 2WSCJ 4YSZC 3H1KD 4H44B 3M9QA 3VRBC 2UWJE 1PL5A 5C2TC 3G3ZA 4PV1C 1AQ5A 3BRVB 3M0DC 1TFFA 4IL6X 2IDBA 3A2AA 2O1KA 3M0DA 4U7JA 1T2KD 1BE3D 2AXCA 5APUA 1SQXD 3AE5C 4EDFA 1JMBA 1PPJG 1RHZB 4K35A 1S4XA 1NTKK 1JB0J 3AEBC 5APXA 1MUUA 1FJPA 4EIJA 1L0LK 2E76B 3BATA 2E42A 2PP6A 2KIKA 2OTKE 2WWWA 1GK4A 1FZBA 1PPJE 2KXPB 5E79H 1LTJB 2BEZF 3VR9D 1NTMG 2PRRA 3CXHI 1LTGC 1ZV8A 1LJ2A 1R8EA 1OVUA 1YTZI 3RBZA 2JWAA 4H44C 2K9JA 2WVRA 1IK9A 1NTME 2RN0A 2KSEA 2LXBA 1A02F 4I7ZC 1AQTA 2JO1A 4NPDA 3CWBD 2IBZI 4N6JA 3L36A 1J1DC 3FGAD 1KILD 3HD7D 2O01H 2WS3C 1NU1D 5C3JC 2IBZG 1FZEA 2XKMA 3T97A 2W8ZA 2OYIB 2WU2C 1KB9I 2N1TB 4CPGA 1G1IA 3HTKA 2E76C 2JR8A 1L0NG 1EDLA 3AEED 1FDMA 1MV8A 2ZYGA 2FYNC 1SQVE 3P4PD 3AEFC 1N73B 3AE6D 1K9MQ 1LTJC 3Q2YA 3H1IJ 2Y0DA 2H43A 1L0VC 1JY2P 2HR3A 3L73G 1QLBC 3AEGC 1GU5A 1L0NE 1JCDA 1JEKA 4C46A 1LTJA 5CCHD 1FDOA 1KB9E 1W2EA 3RGUA 4WY4C 3AE2C 2AEFA 1ZRTD 2GM4A 3LIEA 4YXDC 1K8AQ 1K05A 3LW5J 4WY4A 5E79E 3L73E 2WU5C 2B9BA 4N3YB 4OVNF 1QL2A 5KLVK 1PGOA 1GMJA 1J2JB 3W67A 4IL6H 1VPCA 2ZVOB 1KF6D 4HB1A 4L75A 1H88A 2NPSB 5KKZB 3TGUG 3RK3C 5KLIB 1ZP0D 2HG5D 4WVZA 4YSYD 1LTBC 1NTZJ 4LGDE 1FOSE 4RO0A 3TSIA 1J1EB 3H1JG 3P7KA 1SVFA 4IOIH 1KN7A 1JNMA 3TGUE 1N73C 1NTKJ 1HVVA 1H0TA 1SQPG 3CX5I 3K5BA 4YT0D 2V7QH 1N73A 5AVQB 2B76D 1G1JA 2QJYB 1T3JA 3L70J 1U7JA 4ZKPA 1HJ0A 3IR9A 4JPZB 1WRGA 2OARA 2BCCG 1BSHA 1SQPE 3L75J 3WUTA 3L74J 1NOHA 2K3RA 2OTJP 1RF1B 1NKZB 3CPWO 1OW7A 3PTZA 1AVYA 1BCCG 3CX5E 3CLQA 5AVZB 3VR8D 3E1RA 3VMXA 2KSJA 5GTHE 3AEAC 2BCCE 2NPSC 2FXMA 5KKZC 5KLIC 3P8CE 1ZW0A 1KV4A 1YHQP 1JUNA 2NPSA 4TT3H 2WZ7A 1BCCE 2C9LY 1P84I 4YSXD 1J1EC 2BS2C 3CCJP 1RH5B 2V4HA 4H0LB 4IL6E 5AW8B 4AQRD 4I1LA 1NAFA 2WPRA 2JKVA 2OQQA 4GKGA 4B86A 1HTLC 1RY3A 2K37A 1MZ9A 1KMIZ 1DEBA 3S1KA 2WDQC 3AE9D 1NTKD 2QA4P 2WSSH 2IFNA 3B8EB 2C0XA 2ZT9C 5KAIE 1L0LD 3CI9A 3CMEP 4KHXA 3AE3D 2XDJA 1FBMA 1P84E 2FXPA 4JF7A 3VP8A 5KJ7D 2E5YA 2G3AA 4GOEA 3B5ND 4H13B 1QEXA 1RF1C 4DOJA 4UB6H 1QLED 3OA7A 5TISE 1KQFB 1ZMEC 1RF1A 3L72J 1HBWA 2D2CB 3HE4B 1CSBA 1NO4A 4IFFA 4C7NA 5DJTB 1NU1K 3JCUH 2KOGA 1SFCC 2IX7C 4QMAA 1YQ3C 3L35A 1N8RQ 1SFCA 1KYOH 1SQQG 4YTPD 1GD2E 2RMZA 1VQLP 1OW8A 1U7MA 1VQ9P 1NEKC 3VRAC 1IFJA 1CZQA 1SQBJ 3RK2D 1LT9B 5AVUB 1WMKA 1N7SB 2RH0A 1AFOA 1YITP 1SQQE 3L71J 1FJKA 1VF5B 4D6TE 5APQA 1L2PA 2Z5HA 3VN0A 4H13C 5B66E 3NXSA 1HJBA 4PD4I 2L5GB 1CI6B 3TK1A 4KJMA 2K9YA 4DHZA 4YTNC 1IO4A 2K1AA 1VQ8P 1UIXA 3D70A 1L4AC 1LNQA 3G9RA 1JY2N 2FKWB 3MHVA 5KAFE 3SFDC 1L4AA 3FWLA 3V2QA 1KTMA 4UB6E 2Q6QA 2WITA 5KLVD 3JC22 3CCEP 2O01J 4PD4E 1SQVD 3PH0A 1BE3J 1Q82Q 5AW9B 2Q5UA 1KQSO 2VRSA 3JCUE 1OX3A 1IFNA 3AE4C 1LT9C
chains in the Genus database with same CATH topology
1ZP0C 5KKZC 1U57A 4OGQB 4YTPD 1S1CX 1KILE 2NZ2A 5KLIC 3D6ZA 3ABVD 4YSYC 2E75C 3P4RD 3CIRC 1GMJA 3AECC 1VF5D 1NYHA 1TU3F 4H44C 4OGQD 1ZOYD 3P4QD 1OW8A 2QJPC 1NEKC 3AE9C 3P4SD 4TT3H 1K04A 1PV3A 2QJYC 3EWKA 3Q5PA 3VRAC 3AE2D 1KFYC 1KF6D 2BS3C 4YSXD 2E74B 1OW6A 4YXDD 2BS2C 3RK3E 3R4YA 4I7ZC 3SFED 1WMKA 4H0LB 3Q1MA 2JO1A 2ACZC 1YQ3D 3AEAD 2WPVB 3AE3C 3IAOA 2E75B 2E74D 2WQYC 2H88D 2WSCJ 2FBWD 4YSZC 2WDVD 3AE4D 2WU5D 2OQQA 4XFJA 4H44B 1ZP0D 1VF5B 1Y9BA 2G8YA 2J5UA 3FGAD 1DIPA 4YSYD 1PL5A 3AE1C 4YT0C 3VRBC 3AEEC 2E75D 2V7QJ 2B76C 5C2TC 3CIRD 1HF9A 1KMIZ 3AECD 1DD3A 2D2CC 2QJKC 4H44D 4PV1C 1IK7A 2WS3C 2WDQC 1NEKD 1KQGB 3AE9D 3P4PC 3AEDC 5C3JC 3D71A 1ZRTE 3VRAD 3AE6C 3D6YA 1KFYD 2H89C 1AJYA 4Y28J 2ZT9C 4IL6X 1NENC 4H13C 2IDBA 2WU2C 2ACZD 1RQVA 1VL2A 2WSEJ 4R4LA 3AE8C 3IN6A 3AE3D 2WP9C 2QSIA 3Q3DA 1FDIA 3H25A 2P10A 1E7PC 4YSZD 4U7JA 2YIUC 3GMAA 4GDOA 1NGMB 2E76C 4PV1B 3S9OA 1DD4A 3VRBD 3AE5C 3AE1D 4YT0D 4KX6C 2K9YA 3GF7A 2B76D 2WDRC 3AEED 2FXPA 5C2TD 3RL0g 2BEQD 4YTNC 2D2CD 3GLMA 2G3AA 4PV1D 4Z1MH 2FYNC 2WS3D 1UIXA 2WDQD 1JB0J 4H13B 3D70A 3AEFC 1S5LX 3AEDD 3AEBC 3P4PD 5C3JD 2QIWA 3G9RA 3O6QA 4I7ZB 3AE6D 1RQUA 2WSFJ 1YQ4C 3AEGD 3VR9C 1HJ0A 2H89D 3VR8C 4YTMC 2ZT9D 4H13D 2WU2D 2E76B 5L8RJ 3Q2YA 1EXJA 3SFDC 3AE8D 3B71A 1KQFB 3Q5SA 2YMKA 1ZMEC 1L0VC 2WP9D 4R4MA 3AE7C 1QLBC 2WQYD 3AEGC 4H0LC 2E76D 2D2CB 4YTPC 3T97B 1KTMA 1KORA 3ABVC 3AE5D 4KX6D 1Q90D 2WDRD 4RKUJ 3P4RC 4YTND 1VF5C 1FDOA 1ZOYC 4OGQC 2O01J 1OMIA 3P4QC 3P4SC 2ZT9B 2MKVA 5M1BA 3AEBD 1OW7A 3AEFD 3AE2C 1KF6C 2BEZF 1YQ4D 4YSXC 4YTMD 2JP3A 1MKMA 3Q5RA 3VR9D 3VR8D 4KT0J 4YXDC 1PIXA 3SFEC 1NEND 1K05A 1YQ3C 3AEAC 3GF3A 3LW5J 1R8EA 3SFDD 1L0VD 2H88C 3C8VA 2E74C 2FBWC 2BS4C 1EXIA 3AE7D 2WDVC 4H0LD 3AE4C 2WU5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZP0 C;  4YTP D;  3ABV D;  4YSY C;  3P4R D;  3CIR C;  3AEC C;  1ZOY D;  3P4Q D;  1OW8 A;  1NEK C;  3AE9 C;  3P4S D;  1K04 A;  1PV3 A;  3VRA C;  3AE2 D;  1KFY C;  1KF6 D;  2BS3 C;  4YSX D;  1OW6 A;  4YXD D;  2BS2 C;  3SFE D;  2ACZ C;  1YQ3 D;  3AEA D;  3AE3 C;  2H88 D;  2WQY C;  2FBW D;  4YSZ C;  2WDV D;  3AE4 D;  2WU5 D;  1ZP0 D;  3VRB C;  4YSY D;  3AE1 C;  4YT0 C;  3AEE C;  2B76 C;  5C2T C;  3CIR D;  3AEC D;  2WS3 C;  2WDQ C;  1NEK D;  3AE9 D;  3P4P C;  3AED C;  5C3J C;  3VRA D;  3AE6 C;  1KFY D;  2H89 C;  1NEN C;  2WU2 C;  2ACZ D;  3AE8 C;  3AE3 D;  2WP9 C;  1E7P C;  4YSZ D;  3S9O A;  3VRB D;  3AE5 C;  3AE1 D;  4YT0 D;  4KX6 C;  2B76 D;  2WDR C;  3AEE D;  5C2T D;  4YTN C;  2G3A A;  2WS3 D;  2WDQ D;  3P4P D;  3AEF C;  3AED D;  3AEB C;  5C3J D;  3AE6 D;  1YQ4 C;  3VR9 C;  3VR8 C;  4YTM C;  2H89 D;  2WU2 D;  3SFD C;  3AE8 D;  3B71 A;  1L0V C;  2WP9 D;  3AE7 C;  1QLB C;  2WQY D;  3AEG C;  4YTP C;  1KTM A;  3ABV C;  3AE5 D;  4KX6 D;  2WDR D;  3P4R C;  4YTN D;  1ZOY C;  3P4Q C;  3P4S C;  3AEF D;  3AEB D;  1OW7 A;  3AE2 C;  1KF6 C;  1YQ4 D;  4YSX C;  4YTM D;  3VR9 D;  3VR8 D;  4YXD C;  3SFE C;  1NEN D;  1K05 A;  1YQ3 C;  3AEA C;  3SFD D;  1L0V D;  2H88 C;  2FBW C;  2BS4 C;  3AE7 D;  2WDV C;  3AEG D;  3AE4 C;  2WU5 C; 
#chains in the Genus database with same CATH topology
 2KUB A;  4BWN A;  3SWK A;  3CIR C;  2B87 B;  1NYH A;  1FOS F;  2POH A;  1LT9 A;  1URQ B;  1KYO E;  1M7L A;  5APS A;  2QM8 A;  2ZXE B;  1BGY J;  1NTZ G;  3L71 D;  2E74 B;  4L74 A;  2Y9Y A;  3SFE D;  3Q1M A;  2QG4 A;  4I6L A;  1GL2 B;  2WDV D;  1KD1 Q;  1T8Z A;  1LTS C;  2B89 A;  1NWQ A;  2QJP B;  2E75 D;  2KI7 B;  4U3F E;  1M57 D;  3FWN A;  3KDP B;  3CCQ P;  2OYH C;  1IK7 A;  3SWY A;  3PP5 A;  2OYH A;  3E7K A;  3L70 G;  2K9J B;  2ACZ D;  1VQ4 P;  3AE8 C;  3CXH H;  2XNX A;  3I55 P;  1JY3 O;  3A5T A;  2BEQ D;  2Q3I A;  3CWB J;  3L75 G;  3L74 G;  2XU6 A;  2QIW A;  4I7Z B;  1GW4 A;  3H1H J;  3L70 E;  1J1D B;  3TGU D;  1NU1 J;  2WPS A;  3AE7 C;  5B5E H;  1VDF A;  2MJZ A;  3V2R A;  3T97 B;  4I6M C;  1QX8 A;  3L75 E;  3HTK B;  4LLH A;  1LP1 B;  3L74 E;  2FYU K;  2W83 C;  3RL0 C;  1YQ4 D;  4BXL A;  2ZAE B;  1URQ C;  1X79 B;  5AW4 B;  1BDD A;  2B87 A;  2E74 C;  1KB9 H;  1NHL A;  2FBW C;  1OIP A;  1IC2 A;  4AUW A;  2QE7 H;  1URQ A;  4HH2 A;  1VQM P;  1BGY D;  2FYN B;  3D6Z A;  4EOT A;  3P4R D;  1A02 J;  3MIW A;  1YYC A;  1GL2 C;  3AEC C;  2LXC B;  1ZOY D;  3LID A;  2QJP C;  3P4Q D;  2Q1K A;  5AW5 B;  2P2U A;  1FZC C;  1GL2 A;  3A3Y B;  3VP9 A;  4IFM A;  2C9N Y;  3SSU A;  3G71 P;  1FZC A;  4PJ0 H;  2N1T D;  1NAY A;  1DX7 A;  1N2D C;  4HJG H;  1EZV D;  4WY4 B;  1PGP A;  3BVH A;  3D71 A;  2C0W A;  4ASW A;  2H89 C;  3MP7 B;  1JO5 A;  3IN6 A;  3Q3D A;  1FDI A;  2JDI H;  1LWU C;  2YO2 A;  5AVV B;  2YXR B;  3E1I A;  2P58 A;  1VQ6 P;  3H1H D;  1OFC X;  3CXH E;  3L72 G;  1LWU A;  3JSV C;  2CPB A;  4YPC A;  3RK3 B;  4YTM C;  3ZDM A;  1JTH A;  4HKZ H;  1S9K D;  3BCC G;  1R5L A;  1VQO P;  3M9B A;  3MTU E;  1LP1 A;  4KX6 D;  5BU8 B;  1H0T B;  1YTZ T;  5B5E E;  3P4S C;  2OTL P;  2IBZ E;  5DJU B;  1NTM K;  3H32 A;  3BCC E;  3V5B A;  4O9B A;  2CK3 H;  2H88 C;  4C7R A;  3H1L J;  1EXI A;  1SQB G;  3VON A;  3ABV D;  3KHU A;  1EDJ A;  3CX5 H;  1SS1 A;  1PGJ A;  5GTH H;  2IYP A;  5CJ4 A;  1K04 A;  1OXZ A;  2R3S A;  2DW3 A;  1FU1 A;  3TYY A;  1SQB E;  1T2K C;  1Y9B A;  2JJL A;  1PP9 G;  5CBO A;  2ZJS E;  1M56 D;  1MFT A;  2QJK C;  5CCG D;  1JCC A;  4PJ0 E;  1SQV K;  1USD A;  4NPF X;  1VL2 A;  1S72 P;  3H1K G;  1PP9 E;  1L0N K;  1SQQ D;  3AE1 D;  1LGH B;  1SLQ A;  1RE4 C;  2W6B A;  4GT1 A;  5KAI H;  3EFG A;  1SP4 A;  3AED D;  4D6T D;  3VR9 C;  1RE4 A;  1P84 H;  2PAJ A;  3A0H E;  2H7H A;  3H1K E;  2WP9 D;  2YMK A;  3OW2 O;  1BE3 G;  2NRG A;  2IFM A;  1SQX G;  2IZ0 A;  1KZU B;  1YIJ P;  2GA1 A;  1FAV A;  1KOR A;  3V2N A;  2M5A B;  1L0L J;  4RJT A;  1W2B O;  1DEE G;  3TF5 A;  2QM7 A;  2ZT9 B;  3H1L D;  5TIS H;  1YJW P;  1KC8 Q;  4TLF A;  3NTN A;  3H1J E;  2KP8 A;  2YKO A;  3NMD A;  1PIX A;  1BE3 E;  1SQX E;  4RES B;  4H0L D;  1NH4 A;  2AXT E;  2Q9I A;  3RBX A;  1KIL C;  1S2E A;  2N9Y B;  3HD7 C;  3V6I A;  3W68 A;  1GW3 A;  2W6A A;  4C7N B;  1PFI A;  5AW7 B;  1OW6 A;  3HD7 A;  3RK3 E;  1E5W A;  4ZKU A;  3AEE C;  3A7O A;  4DHI B;  1DD3 A;  2XV5 A;  2FXO A;  1SFC B;  3P4P C;  1QVG O;  3AE6 C;  1KYO D;  2HPC B;  3PJS K;  4N78 D;  3WUV A;  2Y9Z A;  2R5D A;  3CCS P;  1SQP K;  2Z4E A;  3EFF K;  2SPZ A;  5CCH C;  2D2C D;  4U3F D;  5B66 H;  2FYU D;  2WSF J;  5CCH A;  3VMY A;  3GW6 A;  3P8M C;  4YXW H;  2M5A A;  1YI2 P;  3Q5S A;  3H6P A;  2YMY A;  5CMZ A;  1IJD B;  3F89 A;  2WDR D;  3NFQ A;  2FFD B;  4GIF A;  5KAF H;  1KF6 C;  1PZQ A;  3V2P A;  2KS1 B;  3C9I A;  4DZO A;  5AVX B;  1Q81 Q;  3GF3 A;  2WSE H;  4PD4 H;  3VTP C;  2Y0E A;  1ZP0 C;  1N7S D;  1LT1 A;  3QH9 A;  4YSY C;  2NZ2 A;  1L4A B;  1VF5 D;  4MN4 C;  1TU3 F;  4OGQ D;  4EYY Q;  1PV3 A;  2KLV A;  2HLO A;  4WBA A;  5KLV J;  3LW5 H;  2WPV B;  2M3B A;  2R44 A;  3IAO A;  1SQV J;  1Y8A A;  3R2P A;  3PHL A;  4YT0 C;  2B76 C;  2HPC A;  1H89 A;  5AVR B;  5APT A;  1PPJ D;  3M0A A;  1GK6 A;  1USE A;  1NVO A;  1ZRT E;  1KFY D;  2ZFC A;  2JWD A;  1X8Y A;  5H2F E;  2L91 A;  2KYV A;  2QSI A;  4YSZ D;  5BVZ A;  2Y0C A;  2N9B A;  3VRB D;  3FXD A;  3U1A A;  5C2T D;  4PV1 D;  4BRY B;  1GU4 A;  3L73 J;  1RQU A;  2FFD C;  3VR8 C;  1NTM D;  2YIU B;  2YNY A;  2FFD A;  2WQY D;  2ZFY A;  3G6E P;  2OYH B;  2QEX P;  3L4F A;  3VOP A;  3AE5 D;  2KS1 A;  3H1I G;  2A06 G;  3CXH D;  1GTW A;  3AEB D;  4JQ0 D;  4YSX C;  4L73 A;  1ZR2 A;  2ZXX A;  3I5C A;  1VQN P;  3KYQ A;  1SQQ K;  5AW2 B;  3H1I E;  3TGU J;  2A06 E;  1M1J B;  3AE9 C;  4Y99 C;  2IBZ D;  1T3U A;  1W5C E;  1M90 Q;  3AE3 C;  5BU5 A;  3MGN A;  3PLN A;  2G8Y A;  1EDI A;  1L0N D;  4FJV A;  5APW A;  5KJ7 C;  4H44 D;  2P1J A;  3RL0 B;  3B5N C;  1KB9 D;  4JBZ A;  1SQP J;  4Y28 J;  5CHX A;  5KJ7 A;  3CC2 P;  3B5N A;  3L37 A;  2KB7 P;  1E7P C;  2P10 A;  2YIU C;  1NGM B;  3L73 D;  1MFZ A;  2IZ1 A;  4BRY A;  2KNC B;  1VQP P;  1G2C B;  3GLM A;  4Z1M H;  1FZC B;  1NTK G;  2WS3 D;  1IFI A;  5C3J D;  3O6Q A;  3BAS A;  3HUS C;  1XTC C;  2J58 A;  1NTZ E;  1L0L G;  4DCK A;  2E5T A;  3CC7 P;  2WU2 D;  2AEM A;  3B71 A;  3HUS A;  1KQL A;  2E76 D;  4YTP C;  1BCC J;  4WWI A;  2I8D A;  4W80 A;  2CPS A;  1NTK E;  1Q86 Q;  2XND H;  3AEF D;  3CCM P;  4ZMD A;  3KZI E;  1Q7Y Q;  2LKM A;  5EFW B;  1L0L E;  1M1J C;  3RK2 C;  1LWU B;  1L0V D;  2BS4 C;  3AEG D;  3G4S P;  1JTH B;  1M1J A;  1QL1 A;  1ZN5 A;  1YJN P;  1HGZ A;  1OWA A;  2HOD B;  4WY4 D;  3AE2 D;  1VQK P;  2W27 A;  5CJ0 A;  3H1J D;  1NTZ K;  3WUU A;  2WT7 A;  4YXD D;  1S3J A;  1X22 A;  4W7Z A;  2E75 B;  1JMM A;  2WQY C;  2WU5 D;  2R5B A;  3H32 B;  1AVO A;  1SQP D;  1OVV A;  2V7Q J;  1JY3 P;  3A0B E;  4ASV A;  1KQG B;  3QWO C;  1QVF O;  2YKP A;  3VMA A;  1HH0 A;  3HE5 A;  1N7L A;  2M0B A;  4L76 A;  1NKN A;  5AW0 B;  3CX5 D;  1LTT C;  2KNC A;  3RK3 D;  1G2C A;  2BCC D;  2YO3 A;  4GDO A;  1RF0 C;  5GTI E;  3TDK A;  2A45 I;  1RF0 A;  3P8C D;  1AA0 A;  1ZXG A;  5K5G B;  1Q2N A;  3FX0 A;  1RE3 C;  1BCC D;  1IFD A;  2A45 G;  1RE3 A;  2M3E A;  1IZN B;  2QJK B;  2WMM A;  2O01 N;  3A0H H;  1FS0 E;  2MKV A;  1EDK A;  1OZH A;  4DDI A;  1SQQ J;  3I56 P;  4KT0 J;  3SFE C;  1NEN D;  2J59 M;  1JY2 O;  4A7P A;  4D6T J;  2WDV C;  3M91 A;  2HOD A;  5AVW B;  2E75 C;  5KLV G;  2FYZ A;  1P84 D;  3L72 E;  1SQV G;  3VYI A;  5KTB A;  1VQ7 P;  3EQ2 A;  2XZR A;  3IFM A;  1IFP A;  3R4Y A;  2AXT H;  2ACZ C;  5AVS B;  3AEA D;  2IYO A;  3S4R A;  1EQ7 A;  2NPS D;  3FXE A;  2Z5I A;  5CBN A;  2HYN A;  5KLV E;  1X9V A;  1WT6 A;  3L71 G;  1FZF A;  3MD0 A;  3CCV P;  1M1K Q;  3CL3 D;  1RQV A;  2WSE J;  1KIL B;  1PGQ A;  3HD7 B;  4DJG A;  2O3J A;  3MUD C;  4W7Y A;  5AW3 B;  2WDQ D;  2PGD A;  4XE5 B;  1S5L X;  3L71 E;  3B4S A;  1YQ4 C;  2ZT9 D;  3MUD A;  5C39 A;  3WU2 H;  2WSC H;  1Q90 D;  3P4R C;  3WMM 0;  1ZOY C;  4DT0 A;  1OMI A;  3P4Q C;  5M1B A;  3U59 A;  2KZJ A;  2O1J A;  2KK7 A;  2ZYA A;  4GOF A;  1YBK A;  1EC5 A;  4U3F J;  1M8O B;  1VQ5 P;  2OYI C;  1SQB K;  2FYU J;  2N1T C;  3SWF A;  2P67 A;  2OYI A;  2N1T A;  3Q5P A;  2I1K A;  2FY8 A;  1SFC D;  5TJH A;  2I1J A;  1KFM A;  1LTA C;  1YQ3 D;  1K73 Q;  3CMA P;  4XFJ A;  1BGY G;  4JYB A;  2ZYD A;  1HF9 A;  3CCU P;  3H1I D;  1NEK D;  2A06 D;  4PD4 D;  2OGU A;  3VRA D;  1EZV I;  1KIL A;  1NEN C;  2OYO A;  4EI2 A;  1GZL A;  1HUC A;  1BGY E;  1JOC A;  2Q3E A;  3V4Q A;  1EZV G;  2IPP A;  4KX6 C;  1NJI Q;  5H2F H;  5APV A;  5APY A;  4H13 D;  4DDG A;  3CC4 P;  3CWB G;  1IFM A;  4R4M A;  1SQX K;  2K88 A;  1UII A;  3TNU B;  3ABV C;  1EZV E;  3H1H G;  3WU2 E;  4YTN D;  3KPE A;  1NU1 G;  4DHJ A;  1L4A D;  1NTZ D;  2Q7C A;  2R32 A;  2ZVN B;  3CWB E;  3SFD D;  3C8V A;  2HFE D;  1U57 A;  3H1H E;  1S1C X;  1KIL E;  4ZNC A;  3PRJ A;  4NPE A;  1NTM J;  1X0T A;  5CCG C;  1NU1 E;  1HGV A;  1QGK B;  1BDC A;  2QJY C;  1S9K E;  2RKL A;  5CCG A;  4OH8 B;  3L70 D;  3VMZ A;  1JY3 N;  3C1L A;  3AE4 D;  1S5L H;  2J5U A;  2LR2 A;  3AE1 C;  2BAS A;  2GUV A;  3CIR D;  2W6J H;  3CCR P;  2WPQ A;  3AED C;  3L75 D;  3D6Y A;  3L74 D;  4XA4 A;  3IF4 A;  4R4L A;  2W90 A;  2WP9 C;  2QVA A;  3H25 A;  4M3L A;  1DD4 A;  1KFN A;  3GF7 A;  3BCC J;  4Y99 B;  4I2L C;  3U1C A;  4IFD K;  1L0N J;  3GG2 A;  2JEE A;  3TNU A;  4GOD A;  3AE8 D;  1N86 A;  5AW1 B;  3GHG B;  4H0L C;  1T6A A;  3KXD A;  3B5N B;  4RKU J;  3N4X A;  1D7M A;  4JYC A;  4D6T G;  1GDT A;  2E43 A;  1DH3 A;  1MKM A;  3P32 A;  2R3C A;  5AVY B;  1AV1 A;  2WTY A;  3O6Q B;  3AE7 D;  4UB8 H;  4OGQ B;  3UIA A;  3OJA B;  2GUS A;  3KZI H;  3KQG A;  3II6 A;  3O8Z A;  1ZR4 A;  1FZA A;  1Y47 A;  3HUS B;  2QRX A;  3H1L G;  2YXQ B;  4HYT B;  4OWF A;  3EWK A;  2M8R A;  3RL0 D;  2BS3 C;  1PP9 J;  1URQ D;  3BRT B;  2E74 D;  2FBW D;  4LDT A;  1YJ9 P;  2P7J A;  3CD6 P;  1DIP A;  1FZG A;  1GL2 D;  3AEC D;  2D2C C;  3H1L E;  3L72 D;  3HRN A;  3H1K J;  3RK2 B;  2H8P D;  1S5L E;  1JM0 A;  3ITK A;  1H8A A;  2KLU A;  1AJY A;  3HE4 A;  1KYO I;  3BCC D;  3M9H A;  3A0B H;  3GMA A;  4PV1 B;  3S9O A;  2WT7 B;  3H1J J;  1CW5 A;  2ITA A;  2WDR C;  3RL0 g;  3GHG C;  3MZW B;  3OAK A;  1SQX J;  1FC2 C;  2H89 D;  1BSN A;  3M06 A;  3GHG A;  5AW6 B;  1R5S A;  1HWT C;  5L8R J;  4AYC A;  5GTI H;  1EXJ A;  1ZLL A;  5AVT B;  3HE5 B;  1N7S C;  1SQB D;  1LTI C;  4LC1 A;  4U3F G;  1VF5 C;  4OGQ C;  1N7S A;  2FYU G;  2BCC J;  3V4W A;  2B88 A;  3N7N A;  4N78 E;  2WSF H;  4YTM D;  2AEJ A;  2JP3 A;  3Q5R A;  1OVR A;  3USS A;  2KZI A;  3CCL P;  4WB4 A;  1FE6 A;  4K3A A;  1PP9 D;  1Z56 A;  2YKQ A;  2PFX A;  2FYU E;  4UB8 E;  3P4S D;  2A45 H;  1CI6 A;  1KFY C;  1E79 H;  3F5H A;  2H88 D;  1XTG B;  2WSC J;  4YSZ C;  3H1K D;  4H44 B;  3M9Q A;  3VRB C;  2UWJ E;  1PL5 A;  5C2T C;  3G3Z A;  4PV1 C;  1AQ5 A;  3BRV B;  3M0D C;  1TFF A;  4IL6 X;  2IDB A;  3A2A A;  2O1K A;  3M0D A;  4U7J A;  1T2K D;  1BE3 D;  2AXC A;  5APU A;  1SQX D;  3AE5 C;  4EDF A;  1JMB A;  1PPJ G;  1RHZ B;  4K35 A;  1S4X A;  1NTK K;  1JB0 J;  3AEB C;  5APX A;  1MUU A;  1FJP A;  4EIJ A;  1L0L K;  2E76 B;  3BAT A;  2E42 A;  2PP6 A;  2KIK A;  2OTK E;  2WWW A;  1GK4 A;  1FZB A;  1PPJ E;  2KXP B;  5E79 H;  1LTJ B;  2BEZ F;  3VR9 D;  1NTM G;  2PRR A;  3CXH I;  1LTG C;  1ZV8 A;  1LJ2 A;  1R8E A;  1OVU A;  1YTZ I;  3RBZ A;  2JWA A;  4H44 C;  2K9J A;  2WVR A;  1IK9 A;  1NTM E;  2RN0 A;  2KSE A;  2LXB A;  1A02 F;  4I7Z C;  1AQT A;  2JO1 A;  4NPD A;  3CWB D;  2IBZ I;  4N6J A;  3L36 A;  1J1D C;  3FGA D;  1KIL D;  3HD7 D;  2O01 H;  2WS3 C;  1NU1 D;  5C3J C;  2IBZ G;  1FZE A;  2XKM A;  3T97 A;  2W8Z A;  2OYI B;  2WU2 C;  1KB9 I;  2N1T B;  4CPG A;  1G1I A;  3HTK A;  2E76 C;  2JR8 A;  1L0N G;  1EDL A;  3AEE D;  1FDM A;  1MV8 A;  2ZYG A;  2FYN C;  1SQV E;  3P4P D;  3AEF C;  1N73 B;  3AE6 D;  1K9M Q;  1LTJ C;  3Q2Y A;  3H1I J;  2Y0D A;  2H43 A;  1L0V C;  1JY2 P;  2HR3 A;  3L73 G;  1QLB C;  3AEG C;  1GU5 A;  1L0N E;  1JCD A;  1JEK A;  4C46 A;  1LTJ A;  5CCH D;  1FDO A;  1KB9 E;  1W2E A;  3RGU A;  4WY4 C;  3AE2 C;  2AEF A;  1ZRT D;  2GM4 A;  3LIE A;  4YXD C;  1K8A Q;  1K05 A;  3LW5 J;  4WY4 A;  5E79 E;  3L73 E;  2WU5 C;  2B9B A;  4N3Y B;  4OVN F;  1QL2 A;  5KLV K;  1PGO A;  1GMJ A;  1J2J B;  3W67 A;  4IL6 H;  1VPC A;  2ZVO B;  1KF6 D;  4HB1 A;  4L75 A;  1H88 A;  2NPS B;  5KKZ B;  3TGU G;  3RK3 C;  5KLI B;  1ZP0 D;  2HG5 D;  4WVZ A;  4YSY D;  1LTB C;  1NTZ J;  4LGD E;  1FOS E;  4RO0 A;  3TSI A;  1J1E B;  3H1J G;  3P7K A;  1SVF A;  4IOI H;  1KN7 A;  1JNM A;  3TGU E;  1N73 C;  1NTK J;  1HVV A;  1H0T A;  1SQP G;  3CX5 I;  3K5B A;  4YT0 D;  2V7Q H;  1N73 A;  5AVQ B;  2B76 D;  1G1J A;  2QJY B;  1T3J A;  3L70 J;  1U7J A;  4ZKP A;  1HJ0 A;  3IR9 A;  4JPZ B;  1WRG A;  2OAR A;  2BCC G;  1BSH A;  1SQP E;  3L75 J;  3WUT A;  3L74 J;  1NOH A;  2K3R A;  2OTJ P;  1RF1 B;  1NKZ B;  3CPW O;  1OW7 A;  3PTZ A;  1AVY A;  1BCC G;  3CX5 E;  3CLQ A;  5AVZ B;  3VR8 D;  3E1R A;  3VMX A;  2KSJ A;  5GTH E;  3AEA C;  2BCC E;  2NPS C;  2FXM A;  5KKZ C;  5KLI C;  3P8C E;  1ZW0 A;  1KV4 A;  1YHQ P;  1JUN A;  2NPS A;  4TT3 H;  2WZ7 A;  1BCC E;  2C9L Y;  1P84 I;  4YSX D;  1J1E C;  2BS2 C;  3CCJ P;  1RH5 B;  2V4H A;  4H0L B;  4IL6 E;  5AW8 B;  4AQR D;  4I1L A;  1NAF A;  2WPR A;  2JKV A;  2OQQ A;  4GKG A;  4B86 A;  1HTL C;  1RY3 A;  2K37 A;  1MZ9 A;  1KMI Z;  1DEB A;  3S1K A;  2WDQ C;  3AE9 D;  1NTK D;  2QA4 P;  2WSS H;  2IFN A;  3B8E B;  2C0X A;  2ZT9 C;  5KAI E;  1L0L D;  3CI9 A;  3CME P;  4KHX A;  3AE3 D;  2XDJ A;  1FBM A;  1P84 E;  2FXP A;  4JF7 A;  3VP8 A;  5KJ7 D;  2E5Y A;  2G3A A;  4GOE A;  3B5N D;  4H13 B;  1QEX A;  1RF1 C;  4DOJ A;  4UB6 H;  1QLE D;  3OA7 A;  5TIS E;  1KQF B;  1ZME C;  1RF1 A;  3L72 J;  1HBW A;  2D2C B;  3HE4 B;  1CSB A;  1NO4 A;  4IFF A;  4C7N A;  5DJT B;  1NU1 K;  3JCU H;  2KOG A;  1SFC C;  2IX7 C;  4QMA A;  1YQ3 C;  3L35 A;  1N8R Q;  1SFC A;  1KYO H;  1SQQ G;  4YTP D;  1GD2 E;  2RMZ A;  1VQL P;  1OW8 A;  1U7M A;  1VQ9 P;  1NEK C;  3VRA C;  1IFJ A;  1CZQ A;  1SQB J;  3RK2 D;  1LT9 B;  5AVU B;  1WMK A;  1N7S B;  2RH0 A;  1AFO A;  1YIT P;  1SQQ E;  3L71 J;  1FJK A;  1VF5 B;  4D6T E;  5APQ A;  1L2P A;  2Z5H A;  3VN0 A;  4H13 C;  5B66 E;  3NXS A;  1HJB A;  4PD4 I;  2L5G B;  1CI6 B;  3TK1 A;  4KJM A;  2K9Y A;  4DHZ A;  4YTN C;  1IO4 A;  2K1A A;  1VQ8 P;  1UIX A;  3D70 A;  1L4A C;  1LNQ A;  3G9R A;  1JY2 N;  2FKW B;  3MHV A;  5KAF E;  3SFD C;  1L4A A;  3FWL A;  3V2Q A;  1KTM A;  4UB6 E;  2Q6Q A;  2WIT A;  5KLV D;  3JC2 2;  3CCE P;  2O01 J;  4PD4 E;  1SQV D;  3PH0 A;  1BE3 J;  1Q82 Q;  5AW9 B;  2Q5U A;  1KQS O;  2VRS A;  3JCU E;  1OX3 A;  1IFN A;  3AE4 C;  1LT9 C; 
#chains in the Genus database with same CATH homology
 1ZP0 C;  5KKZ C;  1U57 A;  4OGQ B;  4YTP D;  1S1C X;  1KIL E;  2NZ2 A;  5KLI C;  3D6Z A;  3ABV D;  4YSY C;  2E75 C;  3P4R D;  3CIR C;  1GMJ A;  3AEC C;  1VF5 D;  1NYH A;  1TU3 F;  4H44 C;  4OGQ D;  1ZOY D;  3P4Q D;  1OW8 A;  2QJP C;  1NEK C;  3AE9 C;  3P4S D;  4TT3 H;  1K04 A;  1PV3 A;  2QJY C;  3EWK A;  3Q5P A;  3VRA C;  3AE2 D;  1KFY C;  1KF6 D;  2BS3 C;  4YSX D;  2E74 B;  1OW6 A;  4YXD D;  2BS2 C;  3RK3 E;  3R4Y A;  4I7Z C;  3SFE D;  1WMK A;  4H0L B;  3Q1M A;  2JO1 A;  2ACZ C;  1YQ3 D;  3AEA D;  2WPV B;  3AE3 C;  3IAO A;  2E75 B;  2E74 D;  2WQY C;  2H88 D;  2WSC J;  2FBW D;  4YSZ C;  2WDV D;  3AE4 D;  2WU5 D;  2OQQ A;  4XFJ A;  4H44 B;  1ZP0 D;  1VF5 B;  1Y9B A;  2G8Y A;  2J5U A;  3FGA D;  1DIP A;  4YSY D;  1PL5 A;  3AE1 C;  4YT0 C;  3VRB C;  3AEE C;  2E75 D;  2V7Q J;  2B76 C;  5C2T C;  3CIR D;  1HF9 A;  1KMI Z;  3AEC D;  1DD3 A;  2D2C C;  2QJK C;  4H44 D;  4PV1 C;  1IK7 A;  2WS3 C;  2WDQ C;  1NEK D;  1KQG B;  3AE9 D;  3P4P C;  3AED C;  5C3J C;  3D71 A;  1ZRT E;  3VRA D;  3AE6 C;  3D6Y A;  1KFY D;  2H89 C;  1AJY A;  4Y28 J;  2ZT9 C;  4IL6 X;  1NEN C;  4H13 C;  2IDB A;  2WU2 C;  2ACZ D;  1RQV A;  1VL2 A;  2WSE J;  4R4L A;  3AE8 C;  3IN6 A;  3AE3 D;  2WP9 C;  2QSI A;  3Q3D A;  1FDI A;  3H25 A;  2P10 A;  1E7P C;  4YSZ D;  4U7J A;  2YIU C;  3GMA A;  4GDO A;  1NGM B;  2E76 C;  4PV1 B;  3S9O A;  1DD4 A;  3VRB D;  3AE5 C;  3AE1 D;  4YT0 D;  4KX6 C;  2K9Y A;  3GF7 A;  2B76 D;  2WDR C;  3AEE D;  2FXP A;  5C2T D;  3RL0 g;  2BEQ D;  4YTN C;  2D2C D;  3GLM A;  2G3A A;  4PV1 D;  4Z1M H;  2FYN C;  2WS3 D;  1UIX A;  2WDQ D;  1JB0 J;  4H13 B;  3D70 A;  3AEF C;  1S5L X;  3AED D;  3AEB C;  3P4P D;  5C3J D;  2QIW A;  3G9R A;  3O6Q A;  4I7Z B;  3AE6 D;  1RQU A;  2WSF J;  1YQ4 C;  3AEG D;  3VR9 C;  1HJ0 A;  2H89 D;  3VR8 C;  4YTM C;  2ZT9 D;  4H13 D;  2WU2 D;  2E76 B;  5L8R J;  3Q2Y A;  1EXJ A;  3SFD C;  3AE8 D;  3B71 A;  1KQF B;  3Q5S A;  2YMK A;  1ZME C;  1L0V C;  2WP9 D;  4R4M A;  3AE7 C;  1QLB C;  2WQY D;  3AEG C;  4H0L C;  2E76 D;  2D2C B;  4YTP C;  3T97 B;  1KTM A;  1KOR A;  3ABV C;  3AE5 D;  4KX6 D;  1Q90 D;  2WDR D;  4RKU J;  3P4R C;  4YTN D;  1VF5 C;  1FDO A;  1ZOY C;  4OGQ C;  2O01 J;  1OMI A;  3P4Q C;  3P4S C;  2ZT9 B;  2MKV A;  5M1B A;  3AEB D;  1OW7 A;  3AEF D;  3AE2 C;  1KF6 C;  2BEZ F;  1YQ4 D;  4YSX C;  4YTM D;  2JP3 A;  1MKM A;  3Q5R A;  3VR9 D;  3VR8 D;  4KT0 J;  4YXD C;  1PIX A;  3SFE C;  1NEN D;  1K05 A;  1YQ3 C;  3AEA C;  3GF3 A;  3LW5 J;  1R8E A;  3SFD D;  1L0V D;  2H88 C;  3C8V A;  2E74 C;  2FBW C;  2BS4 C;  1EXI A;  3AE7 D;  2WDV C;  4H0L D;  3AE4 C;  2WU5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...