4YXDC

Crystal structure of porcine heart mitochondrial complex ii bound with flutolanil
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
total genus 48
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4yxdC01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 4yxdC02
3AEFD 4YTMD 1YQ3D 3B71A 1ZP0D 3CIRD 2H88C 2WU2D 4YT0C 3AE6D 3P4RD 3AE1D 2WS3C 4YTPD 1L0VD 2H88D 2FBWC 2WDQD 2G3AA 3AE9C 1ZOYC 3S9OA 3VR8D 3AEAC 3SFEC 1K04A 3AEGC 4YT0D 2WU5C 1KF6C 2BS2C 2WS3D 2FBWD 4KX6D 4YSYC 4YSXC 3AEDC 2H89D 3AEEC 3SFED 3AE3C 3AE2C 3AE8C 1NEKC 3P4PC 1KF6D 3VR9C 3VRBD 4YSYD 4YSXD 3AEDD 3AE5C 3AE3D 1NEKD 3AE8D 3P4PD 3ABVC 3VRAC 4YTNC 1OW6A 1KFYC 4YXDC 3AE5D 3AE9D 1ZOYD 2BS3C 3ABVD 3AEAD 3AE7C 3AEGD 3VRAD 4YTND 2WU5D 3AEBC 4YSZC 3AECC 3P4QC 2WQYC 3CIRC 2WDVC 3AEED 3AE7D 1E7PC 1NENC 1K05A 3AE2D 3AEBD 2WU2C 3SFDC 3VR9D 3AE6C 2B76C 1YQ4C 2BS4C 4YSZD 3AECD 3AE1C 3P4QD 2WP9C 1KTMA 2WQYD 4YTPC 1L0VC 2WDVD 2WDQC 5C3JC 1NEND 2WDRC 2ACZC 3VR8C 3AE4C 1OW8A 1PV3A 5C2TC 3SFDD 2B76D 1YQ4D 1QLBC 3P4SC 2WP9D 1KFYD 4KX6C 4YXDD 5C3JD 2WDRD 3AEFC 4YTMC 1YQ3C 2ACZD 1ZP0C 2H89C 3AE4D 5C2TD 3P4SD 3VRBC 1OW7A 3P4RC
chains in the Genus database with same CATH superfamily
1LT9A 3L37A 2O01J 2JO1A 1FOSF 1NTKJ 3Q1MA 2R5BA 2KZIA 1FZEA 2JKVA 1GK4A 2GA1A 1PGJA 5CCHD 4KT0J 3S9OA 3Q3DA 4YT0D 3VMZA 2JDIH 3CCUP 3Q5PA 3JC22 1KC8Q 2LR2A 3CL3D 2R32A 1PPJG 4WY4C 4EOTA 2N1TB 3QWOC 1DEBA 1P84D 5KLVD 1NTKK 1BGYE 5H2FH 1S3JA 1ZMEC 3BRTB 4YSYD 1NTMD 2E74D 2WSFJ 1LTJB 1T8ZA 3AE8D 2R5DA 3OJAB 2Q3EA 2HYNA 1GU4A 3V2RA 3RK2B 2Y9YA 4GKGA 5CCGD 2J58A 1OMIA 1J1DC 1BGYJ 4B86A 1CI6A 1URQC 1PGQA 3HD7C 2XNDH 3WU2E 2YO2A 4WY4A 3CIRC 2WMMA 4NPDA 2KK7A 3WUVA 1S2EA 5GTIE 2B76C 3VR9D 5BVZA 3E7KA 3O6QA 3AECD 4UB6H 3CCQP 5APSA 1L0NK 1VDFA 3HUSC 1PV3A 1HJBA 2QJKB 3IFMA 2PP6A 2RN0A 4KX6C 1SQBJ 2ZVOB 3CD6P 2K9JB 3JCUH 1SQVJ 3H1HG 1URQA 3HD7A 2B88A 4C7NA 4TT3H 1EZVD 4HKZH 4C7RA 3HTKB 1IK7A 2P10A 4DDGA 3M91A 1H89A 1T6AA 3BATA 1SQBK 2FBWC 4I6MC 3HUSA 2WDQD 5KAFH 1NU1J 2W6AA 1SQVK 1BDCA 4HJGH 1KF6C 1PFIA 3LIEA 1IJDB 4YSXC 5KAIH 4UB8E 1LT1A 1NEKC 4OH8B 1DD4A 3BCCE 1JTHB 3A0BH 4WY4D 1SQXD 1S4XA 2IYPA 2Q7CA 1SFCB 1FZCC 5AW8B 2Z5HA 1DEEG 3C1LA 3BCCJ 3H25A 1JB0J 1IFJA 2CPSA 2AXTE 2WPVB 3VMXA 1GTWA 1E7PC 1URQD 1NO4A 3HD7D 3A2AA 1AV1A 1SQPD 2V7QH 1FZCA 1X22A 4IOIH 1R5SA 2FXMA 2B76D 1P84E 4AYCA 2FYNC 5KLVE 2XNXA 5APVA 1YQ3C 2QM8A 3B4SA 1NTME 1YTZI 4H0LB 3P8CD 1L4AC 1HH0A 1ZW0A 3G71P 3EFFK 1RE4A 2JR8A 2NRGA 2W6BA 3TSIA 2YKOA 2ZXEB 3KZIE 2W8ZA 3L73G 2JEEA 2OGUA 3FGAD 2WT7B 2CPBA 2L5GB 4ASVA 4Z1MH 2FBWD 1R5LA 3RBXA 1P84I 2YXQB 1G2CA 1KF6D 1L4AA 3L4FA 5APXA 2A45I 4YSXD 3L35A 2WSCJ 5KLIB 1NEKD 1EC5A 3LW5H 5AVVB 5AVQB 2ZAEB 1HBWA 3H1IG 2BCCJ 2XZRA 2WU5D 1BDDA 1EZVE 2QJPC 1EDKA 1EDJA 1Y9BA 2B87B 3P4QC 2VRSA 3SFDC 3CMEP 1KILC 1G1JA 1H0TB 4PV1B 4H44C 2XV5A 1KMIZ 3AE4C 1DH3A 4BRYA 3KYQA 4IFFA 2WSEJ 2NPSB 1BE3G 4EIJA 1SQXE 1QEXA 2WTYA 1YQ3D 1EZVI 2E76B 4DOJA 4H13C 1L4AD 2OTLP 3CI9A 1KILA 2K88A 1LJ2A 3AEGC 2B89A 3M9HA 2JJLA 3VYIA 3HE4A 5CJ4A 3SWKA 2QVAA 2HFED 4W7ZA 3V5BA 1CSBA 4N78D 1HF9A 3L71J 2IX7C 1SQPE 3G4SP 2WPRA 2OYIC 4ASWA 3KXDA 3R4YA 3CX5I 5KLVG 1GDTA 1FS0E 3MD0A 1KFYC 4YXDC 3P8CE 1NTKD 1NTMG 4XFJA 2ZT9C 1SQPJ 5AVWB 1YJWP 4YSZC 3P7KA 4DHJA 2KP8A 1NYHA 3AEED 2KSJA 4DHZA 4U3FJ 3SWYA 1VF5B 4PD4H 2KSEA 4U7JA 3P4QD 1MUUA 1JCDA 5B66H 2OYIA 3SFDD 3SWFA 3P4SC 3PLNA 1KILD 4H44D 1VQNP 4OGQD 4Y99C 3AE4D 4WWIA 1JY2N 1M1JB 2QIWA 3AE6D 1N73C 2QG4A 2W6JH 4ZKPA 2WS3C 1YIJP 2P2UA 1GZLA 2WSSH 1VQ7P 1K9MQ 2KB7P 4H13D 2E5TA 1BCCG 3AEAC 2KNCA 1LWUA 1SLQA 2M3EA 2HPCA 3T97A 3CXHD 5DJTB 3CPWO 1HTLC 2E75D 3KPEA 3KDPB 3PH0A 1FDIA 3VRBD 1MZ9A 3MZWB 1SQBD 2C9LY 5C39A 1SQVD 1X8YA 5M1BA 2QM7A 1SQQE 3ABVC 3VRAC 1N73A 2N9BA 1JY3O 1TU3F 2RKLA 1SQXG 1KYOH 2N1TC 2BEZF 1LTTC 1X0TA 1OFCX 1VQPP 1SQQJ 1NU1D 1L0LJ 3G3ZA 2ZT9D 3BASA 3HE5B 5AW0B 1LTJC 3K5BA 4YSZD 3B5ND 1GL2A 1ZR4A 3RK2C 4D6TJ 2FYUJ 3FWLA 3Q5RA 4N78E 1KD1Q 2M5AB 1JMMA 2N1TA 1RF0C 3P4SD 4LDTA 2E5YA 1M57D 3CWBJ 4WBAA 4NPFX 3B71A 4YXWH 2ZXXA 1OVRA 3BCCD 3CLQA 3RGUA 2IBZI 2FY8A 1LTJA 1S5LE 4RKUJ 1NTKE 3L75D 3M0AA 1S9KD 2QJKC 1NTZJ 2FYUK 5TISE 1EDLA 1HUCA 3H1JG 3KHUA 3TGUJ 2WS3D 5E79E 1CW5A 1RF0A 1DD3A 1NTZK 1S1CX 1KILE 3AE5C 3USSA 3FWNA 2L91A 1FU1A 1J1EB 1WMKA 2ZYAA 1GL2D 5AVRB 2P67A 3GLMA 3N4XA 2O3JA 3ABVD 3D6ZA 3VRAD 2ZVNB 2K9JA 2O1KA 3H32A 3IF4A 1ZXGA 1RY3A 5KTBA 1IFPA 2PRRA 1VQMP 3L72D 1YQ4C 1N7LA 2Z5IA 1SFCC 2YIUC 2E74B 3AE1C 3HTKA 4AQRD 1RF1B 2KI7B 1L0NJ 3VR8C 2P7JA 3CXHE 2Q9IA 4R4LA 4JQ0D 1AQTA 4HB1A 3W67A 3AEFC 3RL0D 4PJ0H 5B5EH 1SQBE 3C9IA 2K9YA 3A0HH 1SQVE 3II6A 2O01H 1IFIA 1FJKA 2M3BA 2O01N 4LGDE 5GTHE 1JTHA 1T2KC 2BCCD 5TISH 2K1AA 1SFCA 1KB9E 5EFWB 2IPPA 3MGNA 1L0VD 2QA4P 3GMAA 3H1KJ 1YI2P 2J5UA 3H1LD 1FBMA 1JY3P 3W68A 1NU1E 4JBZA 4N6JA 4H0LC 3CXHI 2QRXA 3G6EP 3AE2C 1OXZA 2QJYB 3N7NA 1FAVA 2WSFH 4AUWA 1FC2C 1OW6A 2KXPB 1YITP 1QVGO 4DDIA 2RMZA 3NTNA 1Q7YQ 3AE5D 5KKZC 1KB9I 1NKZB 2QSIA 1KQFB 3WUUA 2YXRB 3L75E 2CK3H 2YKPA 2G8YA 1S9KE 4KJMA 1J2JB 4WY4B 1PGPA 5KLIC 3CX5D 2ZJSE 4I2LC 2WP9C 4YTPC 3WU2H 1AA0A 4C46A 2ACZC 1YQ4D 2WT7A 1BSHA 3VTPC 1MFTA 3L71D 1PP9J 5GTIH 3L75J 2LXBA 2OYHB 1W2EA 1M7LA 5AW4B 1EXJA 3S1KA 1URQB 3AEFD 1U7MA 3CIRD 2YNYA 4PV1C 1R8EA 4LLHA 2YMYA 1T2KD 2G3AA 2NPSC 1MKMA 4GIFA 3FXDA 4U3FD 3TYYA 2KUBA 1BGYG 3HUSB 1W2BO 4MN4C 1XTCC 4KX6D 3LW5J 1YJNP 3L72E 1JNMA 1ZLLA 2B87A 3P4PC 1H8AA 4H0LD 3VOPA 4OVNF 3RBZA 4UB8H 4YTNC 3L72J 2Q3IA 1GK6A 1T3JA 3V4QA 3F5HA 3RL0g 1SQBG 2NPSA 2Z4EA 1SQVG 2BCCE 2WQYC 1K05A 2K3RA 4KHXA 1G1IA 1KFNA 1M56D 2M0BA 3H1LE 4TLFA 5C2TC 1NU1G 1N86A 2AXTH 5CBOA 2WP9D 1FZCB 3QH9A 1NTMK 1A02F 4GODA 2H89C 2ACZD 3U59A 1NGMB 3OA7A 1RQVA 4RO0A 3RK3C 4K35A 1D7MA 3H1LJ 1ZV8A 2IZ1A 1PZQA 3CC4P 2Y0CA 3LIDA 1P84H 2IZ0A 1VF5C 2K37A 2A45H 2ZYGA 3U1AA 1LTBC 3FX0A 5AW5B 1SQQD 1L0LD 3AE9C 4PV1D 1KQGB 3BCCG 3KZIH 1KZUB 1PIXA 1BCCJ 3AEDC 4EYYQ 3CCVP 1EDIA 3CX5E 2FYNB 3AE3C 3V6IA 2IBZD 1M1JC 3ITKA 3VMYA 4D6TD 2FYUD 4WB4A 5KJ7C 1L4AB 3L71E 3ZDMA 5AVZB 5APYA 3P4PD 1LTSC 3CWBD 3L70J 3R2PA 3L74E 2WWWA 3H1HD 4HYTB 3I56P 3AE7C 4YTND 1NTZD 1YTZT 3TGUD 2WU2C 3L74J 4PD4I 4U3FE 1KTMA 2WQYD 1VQ5P 4DT0A 5KJ7A 1PL5A 2A45G 3EFGA 1M8OB 2WSEH 3VP8A 1VQLP 3IAOA 3PJSK 3PTZA 3VONA 4BRYB 5C2TD 1RHZB 5DJUB 4RJTA 4FJVA 3Q2YA 1FJPA 3MHVA 2OTJP 2WVRA 3D6YA 3RK3D 3CCJP 3BRVB 1IK9A 1VF5D 3F89A 1ZOYC 1KILB 2N9YB 3SFEC 1K04A 4H44B 4I1LA 2BCCG 2YKQA 4OGQB 1WRGA 2HODB 2KOGA 3PHLA 1QVFO 1LP1B 1L0ND 3UIAA 3TNUB 1FE6A 2QEXP 4GT1A 3AEDD 2WPSA 1GU5A 1DX7A 3AE3D 3GHGB 3TK1A 1EZVG 1L2PA 2Y0DA 3H6PA 5KJ7D 4H13B 2R3CA 2KLUA 3V2NA 1HVVA 2BS3C 1NKNA 3AEGD 1FDOA 1S5LX 2M5AA 1DIPA 2E75B 1NHLA 1UIXA 2W27A 3P8MC 2WDVC 3H1KD 3AE7D 1AVYA 1OZHA 1L0LE 3V2PA 3I5CA 1N8RQ 3IR9A 4GOEA 1KB9D 2Q5UA 1HWTC 3CCSP 3TDKA 1VQKP 1KFYD 2IBZE 4YXDD 1ZP0C 4DCKA 4D6TE 2FYUE 3CCMP 2GM4A 1N7SB 1FZFA 3L71G 2ZT9B 3CWBE 2E74C 1RF1C 2O1JA 3H1HE 5AW1B 2BEQD 3B5NB 4L73A 1W5CE 3H1ID 1Y8AA 2I1JA 5H2FE 1M90Q 4JYBA 1NTZE 1SQPG 2WPQA 1JY2O 1NH4A 3TGUE 2D2CB 5CMZA 3H1HJ 1RE3C 3SFED 1LWUB 2Y0EA 2HPCB 1IFNA 2AXCA 1PP9D 3VR9C 4U3FG 1MFZA 5APWA 4O9BA 1RF1A 2IYOA 2KLVA 1E79H 1BE3D 3L36A 3MUDC 4A7PA 1AVOA 3IN6A 1LTAC 3AEAD 2KS1B 3S4RA 4CPGA 4UB6E 2C9NY 1S72P 3RK3E 3CCLP 2QJYC 1RE3A 1QLED 3CCEP 3MIWA 3JCUE 2WDVD 2WDQC 2WDRC 2Q1KA 1L0NE 1GL2B 3M0DC 3MUDA 5AVXB 4YPCA 1JOCA 1KORA 1YYCA 4LC1A 2N1TD 1OW7A 3P4RC 5KAFE 1NAFA 3KQGA 1LTGC 1NAYA 1ZP0D 2POHA 2FFDB 5KAIE 3OW2O 3RK2D 1AJYA 3A0BE 4IFDK 2DW3A 1USDA 3M0DA 2A06D 3H1KE 3RL0B 2OYHC 3E1IA 3L73E 1S5LH 4R4MA 1JUNA 2RH0A 1SQQG 3PRJA 4JF7A 1L0LG 1LT9B 1IFMA 3CC2P 2AEJA 2HLOA 5AW9B 5E79H 3L73J 2IBZG 2QE7H 4D6TG 1T3UA 2FYUG 1TFFA 4XE5B 4OWFA 2XDJA 3MP7B 4I7ZB 2OYHA 1A02J 1JMBA 4N3YB 3CWBG 3B8EB 1ZN5A 4QMAA 4JPZB 3H32B 5TJHA 3H1IE 3O8ZA 1SS1A 1BCCD 1NTZG 1KQLA 4XA4A 1OVUA 1OX3A 3TGUG 2V7QJ 5AVTB 1CI6B 1PP9E 1UIIA 2WDRD 1IZNB 3H1IJ 2B9BA 5APTA 3L70D 5BU5A 1NTKG 3G9RA 1JY2P 3GW6A 4PD4D 3CXHH 1BE3E 2JWDA 2MKVA 1E5WA 3OAKA 2JWAA 1IO4A 3O6QB 3FXEA 3BVHA 2V4HA 3P4RD 3A3YB 1SFCD 3AE1D 3SSUA 2IDBA 1Q90D 1PGOA 1NU1K 2YIUB 3VR8D 4Y28J 3L74D 5GTHH 2WU5C 2MJZA 1BE3J 1J1DB 1IC2A 1HGZA 3Q5SA 1KB9H 1KN7A 3HD7B 2BASA 2OQQA 5K5GB 4C7NB 1FZBA 2FXPA 1RE4C 1SVFA 2KIKA 1L0NG 4I6LA 2I8DA 1NOHA 1X79B 1Y47A 1MV8A 1JM0A 3I55P 1H88A 2M8RA 2J59M 1U7JA 4ZKUA 2E76C 1K73Q 5AW6B 2P58A 1RQUA 1Q81Q 4EDFA 1YJ9P 2PFXA 1H0TA 3M9BA 3AE2D 2PAJA 2Y9ZA 2AEFA 2ZFYA 2HR3A 3MTUE 4L75A 2H43A 4IL6X 1NJIQ 5C3JC 3H1JD 2A06E 3GG2A 2YMKA 4JYCA 1OW8A 5KLVJ 3H1KG 1KYOD 3CCRP 4GOFA 1SP4A 5CJ0A 1NTMJ 1RH5B 1VQ9P 5KKZB 3VMAA 1GW4A 2R3SA 5KLVK 1PPJD 2KYVA 4YTPD 4DJGA 4L76A 2Q6QA 1U57A 5APQA 3WMM0 2ZYDA 1X9VA 3AEEC 2SPZA 5BU8B 4M3LA 1BCCE 4ZNCA 2C0XA 4HH2A 1VQ8P 2AEMA 2FKWB 1PP9G 3L70E 4IL6E 4OGQC 3L75G 2NPSD 2XU6A 2NZ2A 4PD4E 1VL2A 1VQ6P 3TF5A 1ZRTD 1FZAA 1QL1A 5B66E 2WSCH 1G2CB 4K3AA 1Q2NA 1GD2E 1NENC 5CHXA 1USEA 3NFQA 3AE6C 2E76D 5APUA 2BS4C 3GHGC 2GUSA 1KV4A 4WVZA 1LTIC 4W7YA 1IFDA 4EI2A 1HGVA 1HJ0A 1YBKA 5C3JD 1OWAA 4W80A 5AW3B 4YTMC 1SQXJ 2HODA 2E75C 1LP1A 3TNUA 1M1JA 3JSVC 3VN0A 3VRBC 2PGDA 1AFOA 2H88C 3NXSA 1FOSE 3V4WA 2LKMA 4BXLA 2LXCB 3GHGA 5AVYB 3L72G 3V2QA 1SQXK 2E42A 1N2DC 1KFMA 5AW2B 1JY3N 1LNQA 1XTGB 2I1KA 2H89D 5AVSB 2QJPB 1N7SC 1JCCA 2R44A 2W83C 3H1JE 5AVUB 1EQ7A 1NWQA 2A06G 5AW7B 3RK3B 3B5NC 2H8PD 1KYOE 2UWJE 4IL6H 3E1RA 2WITA 2IFNA 1GMJA 3CX5H 4L74A 2WZ7A 1QX8A 3GF7A 2H7HA 3M9QA 3AE9D 3HE4B 4NPEA 3H1JJ 2D2CC 2E43A 3AEBC 1SQPK 3VP9A 1FDMA 3WUTA 1LWUC 1JO5A 3HE5A 3H1LG 1PPJE 1N7SA 2FXOA 3C8VA 1EXIA 1BGYD 2OTKE 3B5NA 2IFMA 3CC7P 1NEND 2KZJA 5L8RJ 1K8AQ 1VQ4P 1QLBC 1KQSO 1KYOI 1GW3A 2GUVA 4GDOA 2XKMA 4DHIB 2C0WA 2ITAA 2YO3A 2W90A 3L73D 1QGKB 3GF3A 1YHQP 4YTMD 5CCHC 2OYOA 1J1EC 2WU2D 4YT0C 3A7OA 2FYZA 3D70A 2JP3A 2OYIB 3L70G 1Z56A 3D71A 2H88D 1GL2C 1ZR2A 2OARA 1ZRTE 3U1CA 2BS2C 2KS1A 4YSYC 3M06A 3HRNA 1BSNA 3AE8C 1VQOP 3L74G 1OVVA 3CMAP 1N7SD 2FFDC 5CCHA 5CCGC 1OIPA 1WT6A 1QL2A 1CZQA 2ZFCA 4BWNA 2KNCB 3EQ2A 3RL0C 1ZOYD 2P1JA 4RESB 1LGHB 4DZOA 1FZGA 3T97B 4Y99B 3AECC 1SQQK 1LT9C 1L0LK 2D2CD 3AEBD 1Q86Q 5CBNA 1VPCA 2HG5D 4PJ0E 1AQ5A 5B5EE 1L0VC 3EWKA 2FFDA 3A5TA 1NVOA 3A0HE 3NMDA 1N73B 5CCGA 1M1KQ 4I7ZC 1Q82Q 4IFMA 1JEKA 3P32A 3PP5A 4ZMDA
chains in the Genus database with same CATH topology
3Q2YA 4TT3H 3AEFD 1YQ3D 2ZT9B 3B71A 1ZP0D 4YTMD 3CIRD 2MKVA 1VF5C 2H88C 2O01J 2JO1A 2E74C 2E76B 2QIWA 3D6YA 4PV1C 2WU2D 4H13C 3Q1MA 1R8EA 4YT0C 3AE6D 1IK7A 2P10A 2BEQD 3P4RD 4RKUJ 3D70A 2JP3A 3AE1D 2WS3C 4YTPD 2QJKC 1L0VD 1VF5D 3D71A 2H88D 2FBWC 2IDBA 3FGAD 1Q90D 2WDQD 2G3AA 3GMAA 3AE9C 1ZOYC 1ZRTE 1MKMA 4KT0J 4PV1D 3S9OA 4H13D 3Q3DA 1AJYA 3AEAC 4Y28J 1K04A 3AEGC 1KQGB 3SFEC 2J5UA 4YT0D 4H44B 2WU5C 1U57A 4Z1MH 3Q5PA 4OGQB 1KF6C 2BS2C 2WS3D 2FBWD 4KX6D 4YSYC 1PIXA 3LW5J 4H0LC 2D2CB 4R4MA 3Q5SA 4YSXC 3AEDC 2H89D 3AEEC 3SFED 2OQQA 2E75D 3AE3C 3AE2C 3AE8C 1NEKC 1DD3A 3P4PC 1DD4A 1KF6D 2FXPA 1HF9A 3VR9C 1FDIA 3VRBD 1ZMEC 4YSYD 4H0LD 4YSXD 3AEDD 2E74D 2WSCJ 1S1CX 1KILE 2WSFJ 3AE5C 5M1BA 3AE3D 1NEKD 3AE8D 3P4PD 3R4YA 1GMJA 3ABVC 3VRAC 4YTNC 1OW6A 3GF7A 1KFYC 4H13B 1WMKA 4YXDC 1TU3F 3AE5D 4OGQC 3RL0g 3IN6A 3AE9D 1OMIA 3GLMA 1ZOYD 2BS3C 5KKZC 2NZ2A 3ABVD 3AEAD 3AE7C 4XFJA 3D6ZA 3AEGD 3VRAD 1FDOA 1VL2A 2D2CC 4YTND 2WU5D 2ZT9C 4I7ZB 3H25A 2QJPC 3AEBC 3T97B 2BEZF 1JB0J 1S5LX 1Y9BA 2E76C 1DIPA 2QSIA 1KQFB 2E75B 3AECC 3RK3E 4YSZC 3P4QC 1RQUA 2QJYC 1UIXA 2WQYC 3CIRC 2WPVB 1NYHA 2WDVC 3AEED 3AE7D 1E7PC 2D2CD 1NENC 2G8YA 1K05A 2ZT9D 3AE2D 3AEBD 2WU2C 3SFDC 3VR9D 3AE6C 2B76C 1YQ4C 2E76D 3C8VA 2BS4C 1VF5B 4U7JA 5KLIC 2YIUC 2E74B 3AE1C 3O6QA 3AECD 3P4QD 4YSZD 3VR8D 2WP9C 1KTMA 1EXIA 4YTPC 2WQYD 4PV1B 1L0VC 4H44C 1PL5A 4IL6X 2WDVD 3EWKA 2WDQC 5C3JC 1NEND 2YMKA 2WDRC 5L8RJ 2ACZC 3VR8C 1KMIZ 1OW8A 1PV3A 3AE4C 3SFDD 5C2TC 2B76D 1YQ4D 1QLBC 3IAOA 3P4SC 2WSEJ 2WP9D 4R4LA 1HJ0A 2FYNC 2V7QJ 1KFYD 4H44D 4GDOA 4KX6C 4I7ZC 4YXDD 5C3JD 3Q5RA 4OGQD 3AEFC 2WDRD 1YQ3C 1KORA 1ZP0C 2H89C 2ACZD 1NGMB 3AE4D 4YTMC 5C2TD 2E75C 1RQVA 2K9YA 3P4SD 4H0LB 1EXJA 3G9RA 3GF3A 3VRBC 1OW7A 3P4RC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AEF D;  4YTM D;  1YQ3 D;  3B71 A;  1ZP0 D;  3CIR D;  2H88 C;  2WU2 D;  4YT0 C;  3AE6 D;  3P4R D;  3AE1 D;  2WS3 C;  4YTP D;  1L0V D;  2H88 D;  2FBW C;  2WDQ D;  2G3A A;  3AE9 C;  1ZOY C;  3S9O A;  3VR8 D;  3AEA C;  3SFE C;  1K04 A;  3AEG C;  4YT0 D;  2WU5 C;  1KF6 C;  2BS2 C;  2WS3 D;  2FBW D;  4KX6 D;  4YSY C;  4YSX C;  3AED C;  2H89 D;  3AEE C;  3SFE D;  3AE3 C;  3AE2 C;  3AE8 C;  1NEK C;  3P4P C;  1KF6 D;  3VR9 C;  3VRB D;  4YSY D;  4YSX D;  3AED D;  3AE5 C;  3AE3 D;  1NEK D;  3AE8 D;  3P4P D;  3ABV C;  3VRA C;  4YTN C;  1OW6 A;  1KFY C;  4YXD C;  3AE5 D;  3AE9 D;  1ZOY D;  2BS3 C;  3ABV D;  3AEA D;  3AE7 C;  3AEG D;  3VRA D;  4YTN D;  2WU5 D;  3AEB C;  4YSZ C;  3AEC C;  3P4Q C;  2WQY C;  3CIR C;  2WDV C;  3AEE D;  3AE7 D;  1E7P C;  1NEN C;  1K05 A;  3AE2 D;  3AEB D;  2WU2 C;  3SFD C;  3VR9 D;  3AE6 C;  2B76 C;  1YQ4 C;  2BS4 C;  4YSZ D;  3AEC D;  3AE1 C;  3P4Q D;  2WP9 C;  1KTM A;  2WQY D;  4YTP C;  1L0V C;  2WDV D;  2WDQ C;  5C3J C;  1NEN D;  2WDR C;  2ACZ C;  3VR8 C;  3AE4 C;  1OW8 A;  1PV3 A;  5C2T C;  3SFD D;  2B76 D;  1YQ4 D;  1QLB C;  3P4S C;  2WP9 D;  1KFY D;  4KX6 C;  4YXD D;  5C3J D;  2WDR D;  3AEF C;  4YTM C;  1YQ3 C;  2ACZ D;  1ZP0 C;  2H89 C;  3AE4 D;  5C2T D;  3P4S D;  3VRB C;  1OW7 A;  3P4R C; 
#chains in the Genus database with same CATH topology
 1LT9 A;  3L37 A;  2O01 J;  2JO1 A;  1FOS F;  1NTK J;  3Q1M A;  2R5B A;  2KZI A;  1FZE A;  2JKV A;  1GK4 A;  2GA1 A;  1PGJ A;  5CCH D;  4KT0 J;  3S9O A;  3Q3D A;  4YT0 D;  3VMZ A;  2JDI H;  3CCU P;  3Q5P A;  3JC2 2;  1KC8 Q;  2LR2 A;  3CL3 D;  2R32 A;  1PPJ G;  4WY4 C;  4EOT A;  2N1T B;  3QWO C;  1DEB A;  1P84 D;  5KLV D;  1NTK K;  1BGY E;  5H2F H;  1S3J A;  1ZME C;  3BRT B;  4YSY D;  1NTM D;  2E74 D;  2WSF J;  1LTJ B;  1T8Z A;  3AE8 D;  2R5D A;  3OJA B;  2Q3E A;  2HYN A;  1GU4 A;  3V2R A;  3RK2 B;  2Y9Y A;  4GKG A;  5CCG D;  2J58 A;  1OMI A;  1J1D C;  1BGY J;  4B86 A;  1CI6 A;  1URQ C;  1PGQ A;  3HD7 C;  2XND H;  3WU2 E;  2YO2 A;  4WY4 A;  3CIR C;  2WMM A;  4NPD A;  2KK7 A;  3WUV A;  1S2E A;  5GTI E;  2B76 C;  3VR9 D;  5BVZ A;  3E7K A;  3O6Q A;  3AEC D;  4UB6 H;  3CCQ P;  5APS A;  1L0N K;  1VDF A;  3HUS C;  1PV3 A;  1HJB A;  2QJK B;  3IFM A;  2PP6 A;  2RN0 A;  4KX6 C;  1SQB J;  2ZVO B;  3CD6 P;  2K9J B;  3JCU H;  1SQV J;  3H1H G;  1URQ A;  3HD7 A;  2B88 A;  4C7N A;  4TT3 H;  1EZV D;  4HKZ H;  4C7R A;  3HTK B;  1IK7 A;  2P10 A;  4DDG A;  3M91 A;  1H89 A;  1T6A A;  3BAT A;  1SQB K;  2FBW C;  4I6M C;  3HUS A;  2WDQ D;  5KAF H;  1NU1 J;  2W6A A;  1SQV K;  1BDC A;  4HJG H;  1KF6 C;  1PFI A;  3LIE A;  1IJD B;  4YSX C;  5KAI H;  4UB8 E;  1LT1 A;  1NEK C;  4OH8 B;  1DD4 A;  3BCC E;  1JTH B;  3A0B H;  4WY4 D;  1SQX D;  1S4X A;  2IYP A;  2Q7C A;  1SFC B;  1FZC C;  5AW8 B;  2Z5H A;  1DEE G;  3C1L A;  3BCC J;  3H25 A;  1JB0 J;  1IFJ A;  2CPS A;  2AXT E;  2WPV B;  3VMX A;  1GTW A;  1E7P C;  1URQ D;  1NO4 A;  3HD7 D;  3A2A A;  1AV1 A;  1SQP D;  2V7Q H;  1FZC A;  1X22 A;  4IOI H;  1R5S A;  2FXM A;  2B76 D;  1P84 E;  4AYC A;  2FYN C;  5KLV E;  2XNX A;  5APV A;  1YQ3 C;  2QM8 A;  3B4S A;  1NTM E;  1YTZ I;  4H0L B;  3P8C D;  1L4A C;  1HH0 A;  1ZW0 A;  3G71 P;  3EFF K;  1RE4 A;  2JR8 A;  2NRG A;  2W6B A;  3TSI A;  2YKO A;  2ZXE B;  3KZI E;  2W8Z A;  3L73 G;  2JEE A;  2OGU A;  3FGA D;  2WT7 B;  2CPB A;  2L5G B;  4ASV A;  4Z1M H;  2FBW D;  1R5L A;  3RBX A;  1P84 I;  2YXQ B;  1G2C A;  1KF6 D;  1L4A A;  3L4F A;  5APX A;  2A45 I;  4YSX D;  3L35 A;  2WSC J;  5KLI B;  1NEK D;  1EC5 A;  3LW5 H;  5AVV B;  5AVQ B;  2ZAE B;  1HBW A;  3H1I G;  2BCC J;  2XZR A;  2WU5 D;  1BDD A;  1EZV E;  2QJP C;  1EDK A;  1EDJ A;  1Y9B A;  2B87 B;  3P4Q C;  2VRS A;  3SFD C;  3CME P;  1KIL C;  1G1J A;  1H0T B;  4PV1 B;  4H44 C;  2XV5 A;  1KMI Z;  3AE4 C;  1DH3 A;  4BRY A;  3KYQ A;  4IFF A;  2WSE J;  2NPS B;  1BE3 G;  4EIJ A;  1SQX E;  1QEX A;  2WTY A;  1YQ3 D;  1EZV I;  2E76 B;  4DOJ A;  4H13 C;  1L4A D;  2OTL P;  3CI9 A;  1KIL A;  2K88 A;  1LJ2 A;  3AEG C;  2B89 A;  3M9H A;  2JJL A;  3VYI A;  3HE4 A;  5CJ4 A;  3SWK A;  2QVA A;  2HFE D;  4W7Z A;  3V5B A;  1CSB A;  4N78 D;  1HF9 A;  3L71 J;  2IX7 C;  1SQP E;  3G4S P;  2WPR A;  2OYI C;  4ASW A;  3KXD A;  3R4Y A;  3CX5 I;  5KLV G;  1GDT A;  1FS0 E;  3MD0 A;  1KFY C;  4YXD C;  3P8C E;  1NTK D;  1NTM G;  4XFJ A;  2ZT9 C;  1SQP J;  5AVW B;  1YJW P;  4YSZ C;  3P7K A;  4DHJ A;  2KP8 A;  1NYH A;  3AEE D;  2KSJ A;  4DHZ A;  4U3F J;  3SWY A;  1VF5 B;  4PD4 H;  2KSE A;  4U7J A;  3P4Q D;  1MUU A;  1JCD A;  5B66 H;  2OYI A;  3SFD D;  3SWF A;  3P4S C;  3PLN A;  1KIL D;  4H44 D;  1VQN P;  4OGQ D;  4Y99 C;  3AE4 D;  4WWI A;  1JY2 N;  1M1J B;  2QIW A;  3AE6 D;  1N73 C;  2QG4 A;  2W6J H;  4ZKP A;  2WS3 C;  1YIJ P;  2P2U A;  1GZL A;  2WSS H;  1VQ7 P;  1K9M Q;  2KB7 P;  4H13 D;  2E5T A;  1BCC G;  3AEA C;  2KNC A;  1LWU A;  1SLQ A;  2M3E A;  2HPC A;  3T97 A;  3CXH D;  5DJT B;  3CPW O;  1HTL C;  2E75 D;  3KPE A;  3KDP B;  3PH0 A;  1FDI A;  3VRB D;  1MZ9 A;  3MZW B;  1SQB D;  2C9L Y;  5C39 A;  1SQV D;  1X8Y A;  5M1B A;  2QM7 A;  1SQQ E;  3ABV C;  3VRA C;  1N73 A;  2N9B A;  1JY3 O;  1TU3 F;  2RKL A;  1SQX G;  1KYO H;  2N1T C;  2BEZ F;  1LTT C;  1X0T A;  1OFC X;  1VQP P;  1SQQ J;  1NU1 D;  1L0L J;  3G3Z A;  2ZT9 D;  3BAS A;  3HE5 B;  5AW0 B;  1LTJ C;  3K5B A;  4YSZ D;  3B5N D;  1GL2 A;  1ZR4 A;  3RK2 C;  4D6T J;  2FYU J;  3FWL A;  3Q5R A;  4N78 E;  1KD1 Q;  2M5A B;  1JMM A;  2N1T A;  1RF0 C;  3P4S D;  4LDT A;  2E5Y A;  1M57 D;  3CWB J;  4WBA A;  4NPF X;  3B71 A;  4YXW H;  2ZXX A;  1OVR A;  3BCC D;  3CLQ A;  3RGU A;  2IBZ I;  2FY8 A;  1LTJ A;  1S5L E;  4RKU J;  1NTK E;  3L75 D;  3M0A A;  1S9K D;  2QJK C;  1NTZ J;  2FYU K;  5TIS E;  1EDL A;  1HUC A;  3H1J G;  3KHU A;  3TGU J;  2WS3 D;  5E79 E;  1CW5 A;  1RF0 A;  1DD3 A;  1NTZ K;  1S1C X;  1KIL E;  3AE5 C;  3USS A;  3FWN A;  2L91 A;  1FU1 A;  1J1E B;  1WMK A;  2ZYA A;  1GL2 D;  5AVR B;  2P67 A;  3GLM A;  3N4X A;  2O3J A;  3ABV D;  3D6Z A;  3VRA D;  2ZVN B;  2K9J A;  2O1K A;  3H32 A;  3IF4 A;  1ZXG A;  1RY3 A;  5KTB A;  1IFP A;  2PRR A;  1VQM P;  3L72 D;  1YQ4 C;  1N7L A;  2Z5I A;  1SFC C;  2YIU C;  2E74 B;  3AE1 C;  3HTK A;  4AQR D;  1RF1 B;  2KI7 B;  1L0N J;  3VR8 C;  2P7J A;  3CXH E;  2Q9I A;  4R4L A;  4JQ0 D;  1AQT A;  4HB1 A;  3W67 A;  3AEF C;  3RL0 D;  4PJ0 H;  5B5E H;  1SQB E;  3C9I A;  2K9Y A;  3A0H H;  1SQV E;  3II6 A;  2O01 H;  1IFI A;  1FJK A;  2M3B A;  2O01 N;  4LGD E;  5GTH E;  1JTH A;  1T2K C;  2BCC D;  5TIS H;  2K1A A;  1SFC A;  1KB9 E;  5EFW B;  2IPP A;  3MGN A;  1L0V D;  2QA4 P;  3GMA A;  3H1K J;  1YI2 P;  2J5U A;  3H1L D;  1FBM A;  1JY3 P;  3W68 A;  1NU1 E;  4JBZ A;  4N6J A;  4H0L C;  3CXH I;  2QRX A;  3G6E P;  3AE2 C;  1OXZ A;  2QJY B;  3N7N A;  1FAV A;  2WSF H;  4AUW A;  1FC2 C;  1OW6 A;  2KXP B;  1YIT P;  1QVG O;  4DDI A;  2RMZ A;  3NTN A;  1Q7Y Q;  3AE5 D;  5KKZ C;  1KB9 I;  1NKZ B;  2QSI A;  1KQF B;  3WUU A;  2YXR B;  3L75 E;  2CK3 H;  2YKP A;  2G8Y A;  1S9K E;  4KJM A;  1J2J B;  4WY4 B;  1PGP A;  5KLI C;  3CX5 D;  2ZJS E;  4I2L C;  2WP9 C;  4YTP C;  3WU2 H;  1AA0 A;  4C46 A;  2ACZ C;  1YQ4 D;  2WT7 A;  1BSH A;  3VTP C;  1MFT A;  3L71 D;  1PP9 J;  5GTI H;  3L75 J;  2LXB A;  2OYH B;  1W2E A;  1M7L A;  5AW4 B;  1EXJ A;  3S1K A;  1URQ B;  3AEF D;  1U7M A;  3CIR D;  2YNY A;  4PV1 C;  1R8E A;  4LLH A;  2YMY A;  1T2K D;  2G3A A;  2NPS C;  1MKM A;  4GIF A;  3FXD A;  4U3F D;  3TYY A;  2KUB A;  1BGY G;  3HUS B;  1W2B O;  4MN4 C;  1XTC C;  4KX6 D;  3LW5 J;  1YJN P;  3L72 E;  1JNM A;  1ZLL A;  2B87 A;  3P4P C;  1H8A A;  4H0L D;  3VOP A;  4OVN F;  3RBZ A;  4UB8 H;  4YTN C;  3L72 J;  2Q3I A;  1GK6 A;  1T3J A;  3V4Q A;  3F5H A;  3RL0 g;  1SQB G;  2NPS A;  2Z4E A;  1SQV G;  2BCC E;  2WQY C;  1K05 A;  2K3R A;  4KHX A;  1G1I A;  1KFN A;  1M56 D;  2M0B A;  3H1L E;  4TLF A;  5C2T C;  1NU1 G;  1N86 A;  2AXT H;  5CBO A;  2WP9 D;  1FZC B;  3QH9 A;  1NTM K;  1A02 F;  4GOD A;  2H89 C;  2ACZ D;  3U59 A;  1NGM B;  3OA7 A;  1RQV A;  4RO0 A;  3RK3 C;  4K35 A;  1D7M A;  3H1L J;  1ZV8 A;  2IZ1 A;  1PZQ A;  3CC4 P;  2Y0C A;  3LID A;  1P84 H;  2IZ0 A;  1VF5 C;  2K37 A;  2A45 H;  2ZYG A;  3U1A A;  1LTB C;  3FX0 A;  5AW5 B;  1SQQ D;  1L0L D;  3AE9 C;  4PV1 D;  1KQG B;  3BCC G;  3KZI H;  1KZU B;  1PIX A;  1BCC J;  3AED C;  4EYY Q;  3CCV P;  1EDI A;  3CX5 E;  2FYN B;  3AE3 C;  3V6I A;  2IBZ D;  1M1J C;  3ITK A;  3VMY A;  4D6T D;  2FYU D;  4WB4 A;  5KJ7 C;  1L4A B;  3L71 E;  3ZDM A;  5AVZ B;  5APY A;  3P4P D;  1LTS C;  3CWB D;  3L70 J;  3R2P A;  3L74 E;  2WWW A;  3H1H D;  4HYT B;  3I56 P;  3AE7 C;  4YTN D;  1NTZ D;  1YTZ T;  3TGU D;  2WU2 C;  3L74 J;  4PD4 I;  4U3F E;  1KTM A;  2WQY D;  1VQ5 P;  4DT0 A;  5KJ7 A;  1PL5 A;  2A45 G;  3EFG A;  1M8O B;  2WSE H;  3VP8 A;  1VQL P;  3IAO A;  3PJS K;  3PTZ A;  3VON A;  4BRY B;  5C2T D;  1RHZ B;  5DJU B;  4RJT A;  4FJV A;  3Q2Y A;  1FJP A;  3MHV A;  2OTJ P;  2WVR A;  3D6Y A;  3RK3 D;  3CCJ P;  3BRV B;  1IK9 A;  1VF5 D;  3F89 A;  1ZOY C;  1KIL B;  2N9Y B;  3SFE C;  1K04 A;  4H44 B;  4I1L A;  2BCC G;  2YKQ A;  4OGQ B;  1WRG A;  2HOD B;  2KOG A;  3PHL A;  1QVF O;  1LP1 B;  1L0N D;  3UIA A;  3TNU B;  1FE6 A;  2QEX P;  4GT1 A;  3AED D;  2WPS A;  1GU5 A;  1DX7 A;  3AE3 D;  3GHG B;  3TK1 A;  1EZV G;  1L2P A;  2Y0D A;  3H6P A;  5KJ7 D;  4H13 B;  2R3C A;  2KLU A;  3V2N A;  1HVV A;  2BS3 C;  1NKN A;  3AEG D;  1FDO A;  1S5L X;  2M5A A;  1DIP A;  2E75 B;  1NHL A;  1UIX A;  2W27 A;  3P8M C;  2WDV C;  3H1K D;  3AE7 D;  1AVY A;  1OZH A;  1L0L E;  3V2P A;  3I5C A;  1N8R Q;  3IR9 A;  4GOE A;  1KB9 D;  2Q5U A;  1HWT C;  3CCS P;  3TDK A;  1VQK P;  1KFY D;  2IBZ E;  4YXD D;  1ZP0 C;  4DCK A;  4D6T E;  2FYU E;  3CCM P;  2GM4 A;  1N7S B;  1FZF A;  3L71 G;  2ZT9 B;  3CWB E;  2E74 C;  1RF1 C;  2O1J A;  3H1H E;  5AW1 B;  2BEQ D;  3B5N B;  4L73 A;  1W5C E;  3H1I D;  1Y8A A;  2I1J A;  5H2F E;  1M90 Q;  4JYB A;  1NTZ E;  1SQP G;  2WPQ A;  1JY2 O;  1NH4 A;  3TGU E;  2D2C B;  5CMZ A;  3H1H J;  1RE3 C;  3SFE D;  1LWU B;  2Y0E A;  2HPC B;  1IFN A;  2AXC A;  1PP9 D;  3VR9 C;  4U3F G;  1MFZ A;  5APW A;  4O9B A;  1RF1 A;  2IYO A;  2KLV A;  1E79 H;  1BE3 D;  3L36 A;  3MUD C;  4A7P A;  1AVO A;  3IN6 A;  1LTA C;  3AEA D;  2KS1 B;  3S4R A;  4CPG A;  4UB6 E;  2C9N Y;  1S72 P;  3RK3 E;  3CCL P;  2QJY C;  1RE3 A;  1QLE D;  3CCE P;  3MIW A;  3JCU E;  2WDV D;  2WDQ C;  2WDR C;  2Q1K A;  1L0N E;  1GL2 B;  3M0D C;  3MUD A;  5AVX B;  4YPC A;  1JOC A;  1KOR A;  1YYC A;  4LC1 A;  2N1T D;  1OW7 A;  3P4R C;  5KAF E;  1NAF A;  3KQG A;  1LTG C;  1NAY A;  1ZP0 D;  2POH A;  2FFD B;  5KAI E;  3OW2 O;  3RK2 D;  1AJY A;  3A0B E;  4IFD K;  2DW3 A;  1USD A;  3M0D A;  2A06 D;  3H1K E;  3RL0 B;  2OYH C;  3E1I A;  3L73 E;  1S5L H;  4R4M A;  1JUN A;  2RH0 A;  1SQQ G;  3PRJ A;  4JF7 A;  1L0L G;  1LT9 B;  1IFM A;  3CC2 P;  2AEJ A;  2HLO A;  5AW9 B;  5E79 H;  3L73 J;  2IBZ G;  2QE7 H;  4D6T G;  1T3U A;  2FYU G;  1TFF A;  4XE5 B;  4OWF A;  2XDJ A;  3MP7 B;  4I7Z B;  2OYH A;  1A02 J;  1JMB A;  4N3Y B;  3CWB G;  3B8E B;  1ZN5 A;  4QMA A;  4JPZ B;  3H32 B;  5TJH A;  3H1I E;  3O8Z A;  1SS1 A;  1BCC D;  1NTZ G;  1KQL A;  4XA4 A;  1OVU A;  1OX3 A;  3TGU G;  2V7Q J;  5AVT B;  1CI6 B;  1PP9 E;  1UII A;  2WDR D;  1IZN B;  3H1I J;  2B9B A;  5APT A;  3L70 D;  5BU5 A;  1NTK G;  3G9R A;  1JY2 P;  3GW6 A;  4PD4 D;  3CXH H;  1BE3 E;  2JWD A;  2MKV A;  1E5W A;  3OAK A;  2JWA A;  1IO4 A;  3O6Q B;  3FXE A;  3BVH A;  2V4H A;  3P4R D;  3A3Y B;  1SFC D;  3AE1 D;  3SSU A;  2IDB A;  1Q90 D;  1PGO A;  1NU1 K;  2YIU B;  3VR8 D;  4Y28 J;  3L74 D;  5GTH H;  2WU5 C;  2MJZ A;  1BE3 J;  1J1D B;  1IC2 A;  1HGZ A;  3Q5S A;  1KB9 H;  1KN7 A;  3HD7 B;  2BAS A;  2OQQ A;  5K5G B;  4C7N B;  1FZB A;  2FXP A;  1RE4 C;  1SVF A;  2KIK A;  1L0N G;  4I6L A;  2I8D A;  1NOH A;  1X79 B;  1Y47 A;  1MV8 A;  1JM0 A;  3I55 P;  1H88 A;  2M8R A;  2J59 M;  1U7J A;  4ZKU A;  2E76 C;  1K73 Q;  5AW6 B;  2P58 A;  1RQU A;  1Q81 Q;  4EDF A;  1YJ9 P;  2PFX A;  1H0T A;  3M9B A;  3AE2 D;  2PAJ A;  2Y9Z A;  2AEF A;  2ZFY A;  2HR3 A;  3MTU E;  4L75 A;  2H43 A;  4IL6 X;  1NJI Q;  5C3J C;  3H1J D;  2A06 E;  3GG2 A;  2YMK A;  4JYC A;  1OW8 A;  5KLV J;  3H1K G;  1KYO D;  3CCR P;  4GOF A;  1SP4 A;  5CJ0 A;  1NTM J;  1RH5 B;  1VQ9 P;  5KKZ B;  3VMA A;  1GW4 A;  2R3S A;  5KLV K;  1PPJ D;  2KYV A;  4YTP D;  4DJG A;  4L76 A;  2Q6Q A;  1U57 A;  5APQ A;  3WMM 0;  2ZYD A;  1X9V A;  3AEE C;  2SPZ A;  5BU8 B;  4M3L A;  1BCC E;  4ZNC A;  2C0X A;  4HH2 A;  1VQ8 P;  2AEM A;  2FKW B;  1PP9 G;  3L70 E;  4IL6 E;  4OGQ C;  3L75 G;  2NPS D;  2XU6 A;  2NZ2 A;  4PD4 E;  1VL2 A;  1VQ6 P;  3TF5 A;  1ZRT D;  1FZA A;  1QL1 A;  5B66 E;  2WSC H;  1G2C B;  4K3A A;  1Q2N A;  1GD2 E;  1NEN C;  5CHX A;  1USE A;  3NFQ A;  3AE6 C;  2E76 D;  5APU A;  2BS4 C;  3GHG C;  2GUS A;  1KV4 A;  4WVZ A;  1LTI C;  4W7Y A;  1IFD A;  4EI2 A;  1HGV A;  1HJ0 A;  1YBK A;  5C3J D;  1OWA A;  4W80 A;  5AW3 B;  4YTM C;  1SQX J;  2HOD A;  2E75 C;  1LP1 A;  3TNU A;  1M1J A;  3JSV C;  3VN0 A;  3VRB C;  2PGD A;  1AFO A;  2H88 C;  3NXS A;  1FOS E;  3V4W A;  2LKM A;  4BXL A;  2LXC B;  3GHG A;  5AVY B;  3L72 G;  3V2Q A;  1SQX K;  2E42 A;  1N2D C;  1KFM A;  5AW2 B;  1JY3 N;  1LNQ A;  1XTG B;  2I1K A;  2H89 D;  5AVS B;  2QJP B;  1N7S C;  1JCC A;  2R44 A;  2W83 C;  3H1J E;  5AVU B;  1EQ7 A;  1NWQ A;  2A06 G;  5AW7 B;  3RK3 B;  3B5N C;  2H8P D;  1KYO E;  2UWJ E;  4IL6 H;  3E1R A;  2WIT A;  2IFN A;  1GMJ A;  3CX5 H;  4L74 A;  2WZ7 A;  1QX8 A;  3GF7 A;  2H7H A;  3M9Q A;  3AE9 D;  3HE4 B;  4NPE A;  3H1J J;  2D2C C;  2E43 A;  3AEB C;  1SQP K;  3VP9 A;  1FDM A;  3WUT A;  1LWU C;  1JO5 A;  3HE5 A;  3H1L G;  1PPJ E;  1N7S A;  2FXO A;  3C8V A;  1EXI A;  1BGY D;  2OTK E;  3B5N A;  2IFM A;  3CC7 P;  1NEN D;  2KZJ A;  5L8R J;  1K8A Q;  1VQ4 P;  1QLB C;  1KQS O;  1KYO I;  1GW3 A;  2GUV A;  4GDO A;  2XKM A;  4DHI B;  2C0W A;  2ITA A;  2YO3 A;  2W90 A;  3L73 D;  1QGK B;  3GF3 A;  1YHQ P;  4YTM D;  5CCH C;  2OYO A;  1J1E C;  2WU2 D;  4YT0 C;  3A7O A;  2FYZ A;  3D70 A;  2JP3 A;  2OYI B;  3L70 G;  1Z56 A;  3D71 A;  2H88 D;  1GL2 C;  1ZR2 A;  2OAR A;  1ZRT E;  3U1C A;  2BS2 C;  2KS1 A;  4YSY C;  3M06 A;  3HRN A;  1BSN A;  3AE8 C;  1VQO P;  3L74 G;  1OVV A;  3CMA P;  1N7S D;  2FFD C;  5CCH A;  5CCG C;  1OIP A;  1WT6 A;  1QL2 A;  1CZQ A;  2ZFC A;  4BWN A;  2KNC B;  3EQ2 A;  3RL0 C;  1ZOY D;  2P1J A;  4RES B;  1LGH B;  4DZO A;  1FZG A;  3T97 B;  4Y99 B;  3AEC C;  1SQQ K;  1LT9 C;  1L0L K;  2D2C D;  3AEB D;  1Q86 Q;  5CBN A;  1VPC A;  2HG5 D;  4PJ0 E;  1AQ5 A;  5B5E E;  1L0V C;  3EWK A;  2FFD A;  3A5T A;  1NVO A;  3A0H E;  3NMD A;  1N73 B;  5CCG A;  1M1K Q;  4I7Z C;  1Q82 Q;  4IFM A;  1JEK A;  3P32 A;  3PP5 A;  4ZMD A; 
#chains in the Genus database with same CATH homology
 3Q2Y A;  4TT3 H;  3AEF D;  1YQ3 D;  2ZT9 B;  3B71 A;  1ZP0 D;  4YTM D;  3CIR D;  2MKV A;  1VF5 C;  2H88 C;  2O01 J;  2JO1 A;  2E74 C;  2E76 B;  2QIW A;  3D6Y A;  4PV1 C;  2WU2 D;  4H13 C;  3Q1M A;  1R8E A;  4YT0 C;  3AE6 D;  1IK7 A;  2P10 A;  2BEQ D;  3P4R D;  4RKU J;  3D70 A;  2JP3 A;  3AE1 D;  2WS3 C;  4YTP D;  2QJK C;  1L0V D;  1VF5 D;  3D71 A;  2H88 D;  2FBW C;  2IDB A;  3FGA D;  1Q90 D;  2WDQ D;  2G3A A;  3GMA A;  3AE9 C;  1ZOY C;  1ZRT E;  1MKM A;  4KT0 J;  4PV1 D;  3S9O A;  4H13 D;  3Q3D A;  1AJY A;  3AEA C;  4Y28 J;  1K04 A;  3AEG C;  1KQG B;  3SFE C;  2J5U A;  4YT0 D;  4H44 B;  2WU5 C;  1U57 A;  4Z1M H;  3Q5P A;  4OGQ B;  1KF6 C;  2BS2 C;  2WS3 D;  2FBW D;  4KX6 D;  4YSY C;  1PIX A;  3LW5 J;  4H0L C;  2D2C B;  4R4M A;  3Q5S A;  4YSX C;  3AED C;  2H89 D;  3AEE C;  3SFE D;  2OQQ A;  2E75 D;  3AE3 C;  3AE2 C;  3AE8 C;  1NEK C;  1DD3 A;  3P4P C;  1DD4 A;  1KF6 D;  2FXP A;  1HF9 A;  3VR9 C;  1FDI A;  3VRB D;  1ZME C;  4YSY D;  4H0L D;  4YSX D;  3AED D;  2E74 D;  2WSC J;  1S1C X;  1KIL E;  2WSF J;  3AE5 C;  5M1B A;  3AE3 D;  1NEK D;  3AE8 D;  3P4P D;  3R4Y A;  1GMJ A;  3ABV C;  3VRA C;  4YTN C;  1OW6 A;  3GF7 A;  1KFY C;  4H13 B;  1WMK A;  4YXD C;  1TU3 F;  3AE5 D;  4OGQ C;  3RL0 g;  3IN6 A;  3AE9 D;  1OMI A;  3GLM A;  1ZOY D;  2BS3 C;  5KKZ C;  2NZ2 A;  3ABV D;  3AEA D;  3AE7 C;  4XFJ A;  3D6Z A;  3AEG D;  3VRA D;  1FDO A;  1VL2 A;  2D2C C;  4YTN D;  2WU5 D;  2ZT9 C;  4I7Z B;  3H25 A;  2QJP C;  3AEB C;  3T97 B;  2BEZ F;  1JB0 J;  1S5L X;  1Y9B A;  2E76 C;  1DIP A;  2QSI A;  1KQF B;  2E75 B;  3AEC C;  3RK3 E;  4YSZ C;  3P4Q C;  1RQU A;  2QJY C;  1UIX A;  2WQY C;  3CIR C;  2WPV B;  1NYH A;  2WDV C;  3AEE D;  3AE7 D;  1E7P C;  2D2C D;  1NEN C;  2G8Y A;  1K05 A;  2ZT9 D;  3AE2 D;  3AEB D;  2WU2 C;  3SFD C;  3VR9 D;  3AE6 C;  2B76 C;  1YQ4 C;  2E76 D;  3C8V A;  2BS4 C;  1VF5 B;  4U7J A;  5KLI C;  2YIU C;  2E74 B;  3AE1 C;  3O6Q A;  3AEC D;  3P4Q D;  4YSZ D;  3VR8 D;  2WP9 C;  1KTM A;  1EXI A;  4YTP C;  2WQY D;  4PV1 B;  1L0V C;  4H44 C;  1PL5 A;  4IL6 X;  2WDV D;  3EWK A;  2WDQ C;  5C3J C;  1NEN D;  2YMK A;  2WDR C;  5L8R J;  2ACZ C;  3VR8 C;  1KMI Z;  1OW8 A;  1PV3 A;  3AE4 C;  3SFD D;  5C2T C;  2B76 D;  1YQ4 D;  1QLB C;  3IAO A;  3P4S C;  2WSE J;  2WP9 D;  4R4L A;  1HJ0 A;  2FYN C;  2V7Q J;  1KFY D;  4H44 D;  4GDO A;  4KX6 C;  4I7Z C;  4YXD D;  5C3J D;  3Q5R A;  4OGQ D;  3AEF C;  2WDR D;  1YQ3 C;  1KOR A;  1ZP0 C;  2H89 C;  2ACZ D;  1NGM B;  3AE4 D;  4YTM C;  5C2T D;  2E75 C;  1RQV A;  2K9Y A;  3P4S D;  4H0L B;  1EXJ A;  3G9R A;  3GF3 A;  3VRB C;  1OW7 A;  3P4R C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...