3AE6C

Crystal structure of porcine heart mitochondrial complex ii bound with n-(3-isopropoxy-phenyl)-phthalamicacid
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with N-(3-Isopropoxy-phenyl)-phthalamicacid
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 43
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3ae6C01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3ae6C02
3AE3D 3AEDC 3P4PD 3AE8C 2WP9D 2B76D 2BS2C 2H89D 3VRBD 4YXDD 3P4RD 2WS3D 3AEFC 3ABVD 3P4SC 4YTPD 2FBWD 3VRAC 3AECC 1YQ3C 1NEND 3AE8D 1PV3A 3CIRC 4YT0C 1KF6C 1KTMA 2G3AA 3AE5D 5C2TD 1YQ4C 1KFYC 3AEBD 4YTNC 3AEED 2BS3C 1K04A 3P4SD 3AE9D 3VRAD 1YQ3D 1OW6A 2ACZC 2WU2C 3CIRD 5C3JD 3AE4C 3AEAC 2WQYC 2WDQC 4YSYC 1ZOYD 3AE2C 3VR9C 3AEDD 1NEKC 2WDVC 2WDRC 4KX6C 2ACZD 3SFDC 3B71A 3AE4D 3AEFD 3VR8C 2WQYD 4YSXC 3AE6C 4YSYD 1OW7A 3AECD 3VR9D 3AE1C 3AE3C 3P4PC 4YT0D 2H88C 2WP9C 3SFEC 1KF6D 4KX6D 3AE7C 1YQ4D 2H89C 1KFYD 2B76C 1QLBC 4YXDC 3P4QC 4YTND 2WS3C 4YSXD 3AE6D 3S9OA 1OW8A 2BS4C 3AE1D 2WU2D 2H88D 1NENC 1ZP0C 1L0VC 1K05A 3SFED 4YSZC 3AE7D 3AEAD 3AE5C 5C2TC 2WDQD 3P4QD 1E7PC 2WU5C 3AEBC 3AEGC 3AE2D 3AEEC 4YTMC 1NEKD 2WDVD 2WDRD 3AE9C 3SFDD 3VRBC 1ZP0D 1L0VD 5C3JC 4YSZD 3P4RC 3VR8D 2WU5D 3ABVC 3AEGD 1ZOYC 4YTPC 2FBWC 4YTMD
chains in the Genus database with same CATH superfamily
3H1JE 2YO2A 3TGUJ 1FZCC 4C46A 3FXEA 2E74C 2JR8A 3OW2O 1SQPD 1XTCC 3L71J 1VQMP 1EXJA 5AW4B 1Y9BA 1L4AB 2Z4EA 2LKMA 2ZYDA 1EDLA 1FDOA 3H1HJ 3M0DC 1HH0A 1SFCC 2E76D 1KB9E 2POHA 2W8ZA 1EQ7A 2HYNA 2M3EA 3I5CA 1PPJD 2NZ2A 1NTZK 2K88A 1PP9G 1IFJA 1NTMJ 3PH0A 1BGYJ 3TGUD 1QVGO 3L71E 4L75A 2NPSD 2MJZA 3RL0B 2KLUA 3TF5A 3H1HE 4YSXC 1GTWA 3E7KA 1T3UA 4O9BA 5AW1B 3MZWB 4BWNA 1KD1Q 3AE3C 1KQLA 1NU1K 4CPGA 3SFEC 1NTMK 2N1TB 1T6AA 3L70J 1ZRTE 1M57D 1QEXA 2QJPC 1NTMD 2H88D 1L0LJ 2AXTE 4GDOA 1BGYD 2O3JA 1E7PC 2KB7P 1VQ8P 1PFIA 3AEGC 1M1KQ 1R5LA 3L75E 5BU8B 1LTBC 1JO5A 3M06A 1M1JA 3L70E 4EIJA 1CI6B 1NJIQ 1MUUA 3M9HA 4YTMD 2AEFA 3L70D 3L36A 4U3FG 5AVXB 1EDIA 4ZKUA 1L0LE 3P4RD 2BCCJ 3HD7D 2JWAA 1NHLA 2FYZA 4H0LB 2FBWD 3IF4A 2K9YA 2IFNA 2Q5UA 1KF6C 2Q6QA 4NPFX 1YQ4C 1ZW0A 3C8VA 5KLIC 5GTHE 1NVOA 2E75D 5AVWB 4EI2A 1FZCB 3HE5B 1OW6A 4MN4C 2E74B 1NAFA 1ZOYD 2ITAA 2P1JA 1FDMA 2BCCE 1SQVJ 2PRRA 2ACZD 4RJTA 1BSNA 2KNCB 2RMZA 3H32A 4HKZH 2BEZF 1JUNA 3T97B 4ZNCA 1ZLLA 4KHXA 3VMYA 3K5BA 4KX6D 2QRXA 2QVAA 1LT9C 5APWA 1NTKK 2HG5D 3CCQP 2Z5IA 1SQVE 4GT1A 3AE7D 2WSEH 1SQVD 4D6TG 3PHLA 5CJ0A 3CWBE 2XDJA 3GG2A 1N73A 5CCHA 1BE3J 4WVZA 5B66E 1D7MA 1RH5B 1T3JA 4JPZB 1H8AA 3RBXA 3L73J 2QJPB 4BRYB 3PJSK 3MHVA 1ZMEC 2QJKC 5AW8B 5AVUB 1NWQA 3Q1MA 1AVYA 4WB4A 2I1KA 4RESB 2OTJP 3B4SA 2QM7A 1BE3D 1UIXA 3NFQA 2JWDA 5B5EH 3L73D 1JY3O 3CCMP 1SQQG 4AYCA 2YKPA 4JF7A 3B71A 1JTHA 5KLIB 4YXWH 3FWNA 2Q1KA 3E1RA 3FWLA 1DH3A 1VQKP 3P8CE 2WT7B 3P4QC 1UIIA 1SQPG 3CC4P 1KFMA 2FFDC 2J58A 1IK7A 3W68A 1KB9H 1URQA 1E5WA 1N7SA 5C39A 4GOFA 3B5ND 1PPJG 3RK2D 5KKZC 4YSZD 2XKMA 1AQ5A 1LT9B 3TGUG 2GA1A 2WITA 2WP9D 5AVTB 3SWFA 1OXZA 2H89D 4YXDD 4W80A 2KIKA 3SWKA 2ZFYA 3VRAC 3H1HG 1YTZI 4DHJA 1YJNP 5C2TD 1Q81Q 1LNQA 1SQBK 4PV1D 2OTKE 4JQ0D 2AXTH 3P4SD 3AE9D 1NTMG 3NXSA 1LWUA 3CC2P 2QJKB 1MFZA 2IZ1A 1BGYG 1X8YA 4PD4D 2WQYC 1JCDA 1GU4A 3RK3B 4DT0A 3C1LA 1RE3A 3L37A 5KLVK 3VMZA 1HUCA 5CMZA 3E1IA 1A02J 2FXOA 2M3BA 3L70G 1OX3A 2WTYA 1K9MQ 2YO3A 1KFYD 1HJ0A 2OARA 5CCHD 4U3FE 3TNUA 2GUVA 3HD7C 4L73A 3JC22 1L0LG 1OW8A 3USSA 1OVUA 2WU2D 5AW5B 2ZXEB 3AEAD 2QJYC 1RF0C 4AUWA 1NAYA 2IZ0A 3MD0A 2RH0A 1YJ9P 4FJVA 4HB1A 1ZP0D 5AVYB 1MFTA 1LTIC 1G1JA 2NPSA 3ABVC 1ZOYC 2FFDB 2XV5A 2JEEA 2JKVA 1GD2E 1N7LA 2CPBA 2E76B 3G3ZA 2C9NY 2JP3A 4YTPD 2B87B 1SP4A 1YQ3C 5KTBA 5KKZB 5KAIE 3CX5E 3PRJA 3CCJP 4EYYQ 3CCUP 3CX5D 4OGQD 3GHGC 2NPSB 1VQNP 3AE4C 2KSJA 1IFMA 1SQVG 4UB6E 2AEMA 2PGDA 5B66H 5EFWB 3HRNA 4D6TE 1U7JA 1HVVA 3TDKA 2HPCB 2W6BA 1PGOA 3WMM0 4DJGA 1URQD 3AECD 3EQ2A 1N7SD 2BEQD 4YT0D 3L72J 3KZIE 3TK1A 1L2PA 1H0TB 1RF1A 3AE6D 4JYCA 1OVVA 1SQQJ 1K05A 5DJTB 1IZNB 3RK3E 1PGPA 1EZVE 1L0NJ 1LTTC 1S2EA 2HLOA 1BE3G 2IX7C 1PGQA 3O8ZA 1EZVD 2ZAEB 4PJ0E 1FC2C 1OFCX 2V7QJ 3L73G 3L72E 3HD7B 2Y0CA 2ZVOB 2W6AA 3L72D 4R4LA 5AVZB 1FU1A 3BCCJ 3CL3D 1SQQE 1L0NK 3R2PA 4IL6X 4ASWA 2W27A 1DX7A 1ZR2A 3CCVP 5APVA 3AE8D 1S9KE 1L0ND 2I1JA 2W6JH 3H1IJ 2FYUK 1M1JC 4WY4A 1SQPE 1X22A 5C3JD 2E43A 3BCCE 1E79H 1NTZJ 1G2CB 3BCCD 2KUBA 5TISE 3VR9C 2IYOA 1MV8A 4PD4I 3RK2C 3IFMA 1GZLA 3CCSP 3I55P 1PPJE 3GHGB 2WPVB 1LP1B 3H1IE 2WP9C 1NU1J 4LGDE 3TGUE 3VP9A 2H89C 1Z56A 4YXDC 3H1ID 3C9IA 4H13D 2KZJA 1NTZD 3MUDA 2BS4C 1AFOA 5C2TC 1KQFB 1NYHA 3U59A 4PD4H 2IBZD 1GMJA 1CW5A 5AVVB 3H1KJ 1RQVA 3AE9C 4H44D 3JCUE 4LDTA 2O1JA 1NU1E 2KP8A 4C7NA 1NTME 1VF5D 1NU1D 3FGAD 1BGYE 1BDDA 4DDGA 1ZXGA 2XU6A 3D6ZA 1DEBA 3VOPA 2Y0DA 3D70A 1NEND 2WSCH 2YXRB 1R5SA 3H1KE 1KV4A 1KN7A 3HE4A 1KFYC 1N73C 5CCHC 3H1KD 1S5LE 3AEED 1JEKA 2WU2C 3CIRD 3AEAC 3M91A 3CX5I 3B5NA 3UIAA 2R3CA 1A02F 1JCCA 4JYBA 4I7ZC 4L76A 2QM8A 3AEFD 1P84D 1M1JB 3FXDA 3A0HE 1HGVA 1FZGA 4IFDK 1SFCA 1QLBC 3SWYA 1QX8A 1S3JA 5KAIH 2YNYA 1GDTA 3CX5H 1NTKJ 3O6QA 3B5NB 3CCRP 1IC2A 3RK2B 1FJPA 2ZXXA 1K73Q 4UB6H 4OGQC 4I6MC 2AXCA 1L0VD 1MZ9A 5APXA 4DCKA 2WPQA 2Q3EA 1EZVI 2KXPB 1W2EA 1KORA 3P4PD 1KMIZ 2FYNC 1L4AD 1JY3P 4WY4D 2OGUA 2KOGA 1NTKD 2FXMA 4PV1B 3U1CA 3H32B 3KZIH 1URQC 2WMMA 3AECC 1VQ5P 1SVFA 1N7SC 4C7RA 4YT0C 2WSFJ 3OA7A 1S4XA 5APYA 5AW3B 1K04A 2BS3C 2RKLA 1KYOD 1KILA 4W7ZA 4LC1A 4QMAA 1IFIA 1VPCA 3RK3C 3HUSA 4PJ0H 3AEDD 1SQXK 1EZVG 1BE3E 2M0BA 1N73B 2JJLA 5K5GB 3TSIA 2WZ7A 4YSYD 2OQQA 5AVSB 3L73E 3L72G 1YJWP 3CC7P 2XNDH 3AE1C 4TT3H 1TFFA 3CCEP 5AW0B 3D71A 4IL6E 4NPDA 1YIJP 1LWUC 4I7ZB 2V7QH 1L0NG 3G71P 1RE3C 2WU5C 2DW3A 1EXIA 4B86A 1OVRA 4JBZA 1AJYA 1HF9A 5TISH 5C3JC 2IBZI 4ASVA 2QE7H 3P8MC 3BCCG 1VQPP 4Y28J 4RO0A 1YTZT 2IFMA 2D2CD 2B76D 3VRBD 2KI7B 1JTHB 2E76C 1VQOP 1PL5A 3S1KA 4OGQB 2A45I 3N4XA 5M1BA 3Q5SA 1PV3A 3V2QA 3H1IG 3LIEA 1SQBJ 2ZVNB 1EDKA 2C0WA 2FYNB 1NTZG 2NPSC 5CHXA 2W83C 2OTLP 3P7KA 1Y8AA 1SFCD 2IBZG 3JCUH 1TU3F 1URQB 3KDPB 3D6YA 4IFMA 1N7SB 1R8EA 2ZYAA 4H44C 2A45H 1FS0E 5KLVJ 2QEXP 1MKMA 1NU1G 1VF5C 1IFPA 1SQBE 4PD4E 1N8RQ 2H88C 1SQBD 2A45G 3BATA 3CMEP 4YSXD 4UB8E 4N78E 5GTIE 4N78D 1S5LH 1NENC 1Q2NA 4GOEA 3SFED 1BSHA 2OYHA 5KLVE 3H1KG 4ZMDA 3AEEC 4YTMC 5KLVD 3M9BA 2Q9IA 1NEKD 1U7MA 2WDRD 3QH9A 1IFNA 2I8DA 3P4RC 1LWUB 3AEGD 2JO1A 1S5LX 2FBWC 1RF1C 1S1CX 1RY3A 3BVHA 3PLNA 1KILD 1J1EB 3A0HH 3AEFC 2E75C 1QL1A 3P32A 2ZJSE 2G3AA 1GL2A 1JY2N 2QG4A 1FOSF 1HBWA 4YPCA 3G4SP 3TNUB 1LJ2A 1KQSO 4EOTA 2ACZC 2LXBA 2C0XA 1PIXA 1VQ9P 1JY2O 1KYOI 2AEJA 3EFGA 3KHUA 3BRVB 4BXLA 2PP6A 2Q7CA 2P67A 5CBOA 3ITKA 3G9RA 4KX6C 1KZUB 3RL0g 3Q3DA 1RQUA 4H13B 5AVRB 2YKQA 1X0TA 3P4PC 2Q3IA 2WPSA 2HFED 3AE7C 1HWTC 2K3RA 2IYPA 4WY4C 1NTKG 2JDIH 4OVNF 1RE4A 4H44B 4I1LA 1OMIA 1YBKA 4M3LA 1X79B 2WDQD 4K35A 1VF5B 3NTNA 4IFFA 3V4WA 2WDVD 5AVQB 1FBMA 3Q5RA 2PFXA 2L5GB 1LTJA 2W90A 1Q7YQ 2YKOA 1H88A 2K9JA 1SS1A 3AEDC 2WSFH 1OIPA 3R4YA 2OYIA 3F89A 1DIPA 1NO4A 3MUDC 2O1KA 2CPSA 3NMDA 3A5TA 4IL6H 4KT0J 2N9BA 1DD4A 3L74J 2XNXA 1U57A 2B9BA 5APQA 1Q82Q 1K8AQ 1RF1B 1CSBA 3H6PA 2FYUJ 1M8OB 3WUTA 2ZT9D 1PZQA 2E75B 1L0NE 3BASA 3H1JJ 3WUVA 2WSSH 3VMXA 4L74A 5APSA 1L4AA 3I56P 4IOIH 1WT6A 1LGHB 2J5UA 3L74D 1QL2A 2D2CC 2B76C 2R5BA 3CXHE 2FYUD 2YMKA 3CXHD 1SQPK 3B5NC 1GU5A 3Q5PA 1FZAA 4YSZC 2L91A 3P4QD 3H1JD 1J1DB 1NOHA 1KC8Q 5CBNA 2IPPA 1FDIA 4N3YB 4WY4B 5AW6B 1NTZE 3VR8D 1NKNA 1T2KD 3VP8A 2G8YA 1GL2D 3HTKA 2N1TA 1RHZB 3V6IA 2IBZE 2KS1A 1KB9D 1OZHA 4PV1C 2WS3D 5CCGA 2FY8A 4Y99C 3P4SC 4UB8H 3KXDA 2M5AA 1SQBG 5KJ7A 3L71D 5GTIH 3A3YB 3KPEA 3N7NA 4WWIA 3VRAD 2E5TA 3L75J 3H1HD 3HTKB 1CI6A 3H25A 1Q86Q 4GKGA 2KS1B 2O01N 1YITP 5APTA 5KLVG 2YIUB 1ZRTD 1NEKC 4Z1MH 1LTAC 2WDRC 1KFNA 1FZBA 2R3SA 5CJ4A 1G1IA 4KJMA 2WQYD 2M5AB 4C7NB 1M90Q 3LIDA 3V5BA 3LW5J 2O01J 5KAFE 3Q2YA 3OAKA 2XZRA 3VONA 4HYTB 1KILC 3IN6A 4YTND 3L75D 2K1AA 3SSUA 1FZCA 3HE5A 2VRSA 2BASA 1L0LK 1VL2A 3HUSC 1ZP0C 1P84E 2UWJE 4I2LC 3A0BE 3HE4B 3KYQA 1L0LD 3M0DA 2KLVA 2KNCA 2D2CB 2NRGA 4I6LA 3TYYA 2M8RA 3T97A 4AQRD 1FOSE 4YTPC 4OWFA 5AW2B 1VQLP 2N9YB 3CI9A 3GW6A 3ABVD 4XA4A 1H89A 3CMAP 5E79E 2BCCD 3GLMA 1IO4A 4HH2A 3AE5D 4DDIA 3CWBJ 1SFCB 2K37A 1JOCA 3VN0A 1YYCA 1NTKE 2WPRA 1AA0A 1YQ3D 1FZFA 3O6QB 3V4QA 3WU2E 2WDQC 4Y99B 1SQVK 4BRYA 1FJKA 2A06E 2WDVC 1SQXJ 2A06D 1KYOE 3AE4D 3CCLP 3AE6C 1W5CE 1AV1A 1N86A 3CWBD 1IJDB 3RL0D 2YMYA 1LTGC 2HODA 1EC5A 1BCCJ 4U7JA 3MGNA 3M0AA 2N1TD 1JM0A 1SQXE 4DZOA 3CXHI 3AE2D 1SQXD 4R4MA 1NGMB 5CCGD 3SFDD 2J59M 3A2AA 1KILB 2ZT9C 2C9LY 5KJ7D 1JY3N 3GF3A 3W67A 3H1LJ 2WT7A 3AE8C 3HUSB 1BCCE 1DD3A 2FKWB 2HODB 1QVFO 1LT1A 1QGKB 3B8EB 1JMMA 1BCCD 1J1EC 4ZKPA 2OYHC 3CXHH 3V2NA 1KB9I 3L74G 5H2FE 4EDFA 5DJUB 1JMBA 3ZDMA 1T8ZA 3AEBD 3GMAA 2FYUG 2B88A 3MP7B 4H0LD 4GIFA 4DOJA 3H1LE 1FZEA 1LT9A 1LTSC 3WUUA 1HJBA 3H1JG 1KQGB 3H1LD 3P8CD 1GW4A 3PP5A 1PP9J 2B89A 2E74D 2KYVA 3QWOC 3VR8C 1SLQA 4H13C 1T2KC 1GL2C 1OW7A 3VR9D 2Y9ZA 1BDCA 2HR3A 1S72P 1X9VA 2WS3C 4XFJA 3BRTB 3S9OA 1GK6A 2CK3H 1PP9E 1Q90D 4K3AA 2E5YA 1YI2P 3FX0A 1PP9D 5APUA 3L71G 5AW9B 1NH4A 2WVRA 3II6A 3G6EP 2GM4A 1P84I 4W7YA 4LLHA 2RN0A 1WMKA 3MIWA 3AE3D 1JY2P 2BS2C 2Y0EA 4U3FJ 1RE4C 2WSCJ 5KAFH 1M7LA 1OWAA 3CIRC 1AVOA 2PAJA 2ZT9B 3L4FA 2Z5HA 1HGZA 1P84H 1LTJC 3EWKA 4YTNC 3L75G 1KILE 2SPZA 3A0BH 1VQ7P 3CPWO 2OYIC 2FFDA 2OYHB 3LW5H 2O01H 2LXCB 1CZQA 4U3FD 3VTPC 4OH8B 2P2UA 3JSVC 3V2RA 5GTHH 2H43A 3M9QA 1GW3A 2B87A 5BVZA 4GODA 4TLFA 1KF6D 1YQ4D 1W2BO 1USDA 1JB0J 5E79H 2LR2A 2R44A 5BU5A 1WRGA 1L0VC 2KK7A 2BCCG 3AE5C 3OJAB 1J1DC 2ZFCA 1GL2B 3WU2H 3A7OA 4D6TJ 2OYOA 2HPCA 3U1AA 1L4AC 1ZV8A 1EDJA 1N2DC 2QIWA 5TJHA 2R32A 2P7JA 1M56D 3IAOA 2FXPA 2WSEJ 1PGJA 1KYOH 1H0TA 3L35A 4A7PA 2QA4P 2A06G 2E42A 2P58A 1VQ6P 1YHQP 2R5DA 2GUSA 3VMAA 3CWBG 1KTMA 4XE5B 3RL0C 4D6TD 1HTLC 4RKUJ 2H8PD 1GK4A 3CLQA 1FE6A 3HD7A 2N1TC 1FAVA 4YSYC 2P10A 2QSIA 3AE2C 1SQXG 2ZYGA 2YIUC 1XTGB 5CCGC 1DEEG 1RF0A 3PTZA 3SFDC 1IK9A 1VDFA 1LTJB 3IR9A 5KJ7C 1JNMA 4N6JA 3RK3D 5AW7B 2K9JB 2YXQB 3RBZA 1IFDA 3EFFK 3V2PA 2OYIB 1QLED 1BCCG 5H2FH 1AQTA 2IDBA 2MKVA 1VQ4P 3KQGA 2WWWA 2H7HA 1SQQK 1SQPJ 4HJGH 3MTUE 3AE1D 1NKZB 2KZIA 2V4HA 1G2CA 3L74E 3GF7A 2QJYB 3AEBC 3F5HA 1ZR4A 1ZN5A 2Y9YA 4DHIB 1SQQD 3CD6P 3RGUA 4H0LC 5B5EE 1USEA 3S4RA 2FYUE 5L8RJ 4WBAA 3VRBC 1Y47A 4DHZA 3VYIA 4NPEA 1J2JB 3GHGA 2WU5D 3H1LG 2KSEA 1S9KD 1LP1A
chains in the Genus database with same CATH topology
3AE3D 3AEDC 3P4PD 1KMIZ 3AE8C 2WP9D 2FYNC 1S1CX 1DD3A 3R4YA 3D6ZA 1DIPA 1ZMEC 2D2CD 2B76D 2BS2C 2H89D 3VRBD 4YXDD 2E74C 2QJKC 3P4RD 4PV1C 4PV1B 2WSCJ 2WS3D 2E76C 2E76B 3AEFC 4IL6X 2E75C 1PL5A 2JP3A 1EXJA 3ABVD 3P4SC 1Y9BA 4OGQB 4H0LB 4YTPD 4KT0J 3D70A 2FBWD 3VRAC 3AECC 5M1BA 1YQ3C 3Q5SA 1DD4A 3Q1MA 1PV3A 2K9YA 1NEND 3AE8D 3CIRC 4YT0C 3GLMA 1KF6C 1KTMA 2G3AA 1FDOA 1U57A 2WSFJ 2ZT9B 3AE5D 1YQ4C 5C2TD 1KFYC 3AEBD 3C8VA 3GMAA 4PV1D 5KLIC 2E76D 4YTNC 3EWKA 3AEED 2E75D 1K04A 4RKUJ 2BS3C 3P4SD 4OGQD 4H0LD 1KILE 3AE9D 1UIXA 3VRAD 1YQ3D 1OW6A 2ACZC 2WU2C 3CIRD 2NZ2A 5C3JD 2E74B 3AE4C 3GF3A 2ZT9D 3AEAC 3H25A 1PIXA 2WQYC 2WDQC 1KQGB 2E75B 4YSYC 2P10A 1ZOYD 1TU3F 2QSIA 3AE2C 3D6YA 3VR9C 3AEDD 4I7ZC 2YIUC 1NEKC 2WDVC 3G9RA 1R8EA 4Z1MH 2WDRC 4KX6C 3RL0g 2ACZD 3SFDC 3B71A 4H44C 2E74D 3AE4D 3Q3DA 1MKMA 1RQUA 3AEFD 3VR8C 2BEZF 2WQYD 4H13C 4H13B 4YSXC 3AE6C 4YSYD 2OQQA 3T97B 1OW7A 2J5UA 1VF5C 3AECD 3VR9D 3AE1C 3LW5J 2WPVB 2BEQD 3AE3C 2O01J 2H88C 3P4PC 4YT0D 2WP9C 4TT3H 3SFEC 1KF6D 3AEGD 3AE7C 4KX6D 3Q2YA 2D2CC 2H89C 1KFYD 3D71A 1QLBC 1HJ0A 4YXDC 1YQ4D 2B76C 3P4QC 1ZRTE 3IN6A 4YTND 1JB0J 2WS3C 4H13D 4YSXD 4XFJA 3AE6D 2IDBA 2MKVA 2YMKA 4I7ZB 4U7JA 1OW8A 3S9OA 3O6QA 1IK7A 2QJPC 2BS4C 3AE1D 3Q5PA 2WU2D 4H44B 1VL2A 1NENC 2H88D 1Q90D 1ZP0C 1L0VC 1K05A 1OMIA 3SFED 3RK3E 4YSZC 3AE7D 4GDOA 3AEAD 3AE5C 5C2TC 1KQFB 1NYHA 2QJYC 3GF7A 1E7PC 2WDQD 2WU5C 3P4QD 1EXIA 3AEBC 3AEGC 3AE2D 1GMJA 1VF5B 3AEEC 4YTMC 4R4MA 1NGMB 1AJYA 4OGQC 4H0LC 1HF9A 1NEKD 2WDVD 1RQVA 3Q5RA 2WDRD 3AE9C 1FDIA 3SFDD 4H44D 5L8RJ 3VRBC 2D2CB 2QIWA 1ZP0D 1L0VD 5C3JC 5KKZC 4YSZD 3P4RC 2V7QJ 3VR8D 2ZT9C 2WU5D 3ABVC 3IAOA 2FXPA 2G8YA 2JO1A 1ZOYC 1S5LX 1VF5D 1WMKA 2WSEJ 4YTPC 3FGAD 2FBWC 4Y28J 4YTMD 4R4LA 1KORA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AE3 D;  3AED C;  3P4P D;  3AE8 C;  2WP9 D;  2B76 D;  2BS2 C;  2H89 D;  3VRB D;  4YXD D;  3P4R D;  2WS3 D;  3AEF C;  3ABV D;  3P4S C;  4YTP D;  2FBW D;  3VRA C;  3AEC C;  1YQ3 C;  1NEN D;  3AE8 D;  1PV3 A;  3CIR C;  4YT0 C;  1KF6 C;  1KTM A;  2G3A A;  3AE5 D;  5C2T D;  1YQ4 C;  1KFY C;  3AEB D;  4YTN C;  3AEE D;  2BS3 C;  1K04 A;  3P4S D;  3AE9 D;  3VRA D;  1YQ3 D;  1OW6 A;  2ACZ C;  2WU2 C;  3CIR D;  5C3J D;  3AE4 C;  3AEA C;  2WQY C;  2WDQ C;  4YSY C;  1ZOY D;  3AE2 C;  3VR9 C;  3AED D;  1NEK C;  2WDV C;  2WDR C;  4KX6 C;  2ACZ D;  3SFD C;  3B71 A;  3AE4 D;  3AEF D;  3VR8 C;  2WQY D;  4YSX C;  3AE6 C;  4YSY D;  1OW7 A;  3AEC D;  3VR9 D;  3AE1 C;  3AE3 C;  3P4P C;  4YT0 D;  2H88 C;  2WP9 C;  3SFE C;  1KF6 D;  4KX6 D;  3AE7 C;  1YQ4 D;  2H89 C;  1KFY D;  2B76 C;  1QLB C;  4YXD C;  3P4Q C;  4YTN D;  2WS3 C;  4YSX D;  3AE6 D;  3S9O A;  1OW8 A;  2BS4 C;  3AE1 D;  2WU2 D;  2H88 D;  1NEN C;  1ZP0 C;  1L0V C;  1K05 A;  3SFE D;  4YSZ C;  3AE7 D;  3AEA D;  3AE5 C;  5C2T C;  2WDQ D;  3P4Q D;  1E7P C;  2WU5 C;  3AEB C;  3AEG C;  3AE2 D;  3AEE C;  4YTM C;  1NEK D;  2WDV D;  2WDR D;  3AE9 C;  3SFD D;  3VRB C;  1ZP0 D;  1L0V D;  5C3J C;  4YSZ D;  3P4R C;  3VR8 D;  2WU5 D;  3ABV C;  3AEG D;  1ZOY C;  4YTP C;  2FBW C;  4YTM D; 
#chains in the Genus database with same CATH topology
 3H1J E;  2YO2 A;  3TGU J;  1FZC C;  4C46 A;  3FXE A;  2E74 C;  2JR8 A;  3OW2 O;  1SQP D;  1XTC C;  3L71 J;  1VQM P;  1EXJ A;  5AW4 B;  1Y9B A;  1L4A B;  2Z4E A;  2LKM A;  2ZYD A;  1EDL A;  1FDO A;  3H1H J;  3M0D C;  1HH0 A;  1SFC C;  2E76 D;  1KB9 E;  2POH A;  2W8Z A;  1EQ7 A;  2HYN A;  2M3E A;  3I5C A;  1PPJ D;  2NZ2 A;  1NTZ K;  2K88 A;  1PP9 G;  1IFJ A;  1NTM J;  3PH0 A;  1BGY J;  3TGU D;  1QVG O;  3L71 E;  4L75 A;  2NPS D;  2MJZ A;  3RL0 B;  2KLU A;  3TF5 A;  3H1H E;  4YSX C;  1GTW A;  3E7K A;  1T3U A;  4O9B A;  5AW1 B;  3MZW B;  4BWN A;  1KD1 Q;  3AE3 C;  1KQL A;  1NU1 K;  4CPG A;  3SFE C;  1NTM K;  2N1T B;  1T6A A;  3L70 J;  1ZRT E;  1M57 D;  1QEX A;  2QJP C;  1NTM D;  2H88 D;  1L0L J;  2AXT E;  4GDO A;  1BGY D;  2O3J A;  1E7P C;  2KB7 P;  1VQ8 P;  1PFI A;  3AEG C;  1M1K Q;  1R5L A;  3L75 E;  5BU8 B;  1LTB C;  1JO5 A;  3M06 A;  1M1J A;  3L70 E;  4EIJ A;  1CI6 B;  1NJI Q;  1MUU A;  3M9H A;  4YTM D;  2AEF A;  3L70 D;  3L36 A;  4U3F G;  5AVX B;  1EDI A;  4ZKU A;  1L0L E;  3P4R D;  2BCC J;  3HD7 D;  2JWA A;  1NHL A;  2FYZ A;  4H0L B;  2FBW D;  3IF4 A;  2K9Y A;  2IFN A;  2Q5U A;  1KF6 C;  2Q6Q A;  4NPF X;  1YQ4 C;  1ZW0 A;  3C8V A;  5KLI C;  5GTH E;  1NVO A;  2E75 D;  5AVW B;  4EI2 A;  1FZC B;  3HE5 B;  1OW6 A;  4MN4 C;  2E74 B;  1NAF A;  1ZOY D;  2ITA A;  2P1J A;  1FDM A;  2BCC E;  1SQV J;  2PRR A;  2ACZ D;  4RJT A;  1BSN A;  2KNC B;  2RMZ A;  3H32 A;  4HKZ H;  2BEZ F;  1JUN A;  3T97 B;  4ZNC A;  1ZLL A;  4KHX A;  3VMY A;  3K5B A;  4KX6 D;  2QRX A;  2QVA A;  1LT9 C;  5APW A;  1NTK K;  2HG5 D;  3CCQ P;  2Z5I A;  1SQV E;  4GT1 A;  3AE7 D;  2WSE H;  1SQV D;  4D6T G;  3PHL A;  5CJ0 A;  3CWB E;  2XDJ A;  3GG2 A;  1N73 A;  5CCH A;  1BE3 J;  4WVZ A;  5B66 E;  1D7M A;  1RH5 B;  1T3J A;  4JPZ B;  1H8A A;  3RBX A;  3L73 J;  2QJP B;  4BRY B;  3PJS K;  3MHV A;  1ZME C;  2QJK C;  5AW8 B;  5AVU B;  1NWQ A;  3Q1M A;  1AVY A;  4WB4 A;  2I1K A;  4RES B;  2OTJ P;  3B4S A;  2QM7 A;  1BE3 D;  1UIX A;  3NFQ A;  2JWD A;  5B5E H;  3L73 D;  1JY3 O;  3CCM P;  1SQQ G;  4AYC A;  2YKP A;  4JF7 A;  3B71 A;  1JTH A;  5KLI B;  4YXW H;  3FWN A;  2Q1K A;  3E1R A;  3FWL A;  1DH3 A;  1VQK P;  3P8C E;  2WT7 B;  3P4Q C;  1UII A;  1SQP G;  3CC4 P;  1KFM A;  2FFD C;  2J58 A;  1IK7 A;  3W68 A;  1KB9 H;  1URQ A;  1E5W A;  1N7S A;  5C39 A;  4GOF A;  3B5N D;  1PPJ G;  3RK2 D;  5KKZ C;  4YSZ D;  2XKM A;  1AQ5 A;  1LT9 B;  3TGU G;  2GA1 A;  2WIT A;  2WP9 D;  5AVT B;  3SWF A;  1OXZ A;  2H89 D;  4YXD D;  4W80 A;  2KIK A;  3SWK A;  2ZFY A;  3VRA C;  3H1H G;  1YTZ I;  4DHJ A;  1YJN P;  5C2T D;  1Q81 Q;  1LNQ A;  1SQB K;  4PV1 D;  2OTK E;  4JQ0 D;  2AXT H;  3P4S D;  3AE9 D;  1NTM G;  3NXS A;  1LWU A;  3CC2 P;  2QJK B;  1MFZ A;  2IZ1 A;  1BGY G;  1X8Y A;  4PD4 D;  2WQY C;  1JCD A;  1GU4 A;  3RK3 B;  4DT0 A;  3C1L A;  1RE3 A;  3L37 A;  5KLV K;  3VMZ A;  1HUC A;  5CMZ A;  3E1I A;  1A02 J;  2FXO A;  2M3B A;  3L70 G;  1OX3 A;  2WTY A;  1K9M Q;  2YO3 A;  1KFY D;  1HJ0 A;  2OAR A;  5CCH D;  4U3F E;  3TNU A;  2GUV A;  3HD7 C;  4L73 A;  3JC2 2;  1L0L G;  1OW8 A;  3USS A;  1OVU A;  2WU2 D;  5AW5 B;  2ZXE B;  3AEA D;  2QJY C;  1RF0 C;  4AUW A;  1NAY A;  2IZ0 A;  3MD0 A;  2RH0 A;  1YJ9 P;  4FJV A;  4HB1 A;  1ZP0 D;  5AVY B;  1MFT A;  1LTI C;  1G1J A;  2NPS A;  3ABV C;  1ZOY C;  2FFD B;  2XV5 A;  2JEE A;  2JKV A;  1GD2 E;  1N7L A;  2CPB A;  2E76 B;  3G3Z A;  2C9N Y;  2JP3 A;  4YTP D;  2B87 B;  1SP4 A;  1YQ3 C;  5KTB A;  5KKZ B;  5KAI E;  3CX5 E;  3PRJ A;  3CCJ P;  4EYY Q;  3CCU P;  3CX5 D;  4OGQ D;  3GHG C;  2NPS B;  1VQN P;  3AE4 C;  2KSJ A;  1IFM A;  1SQV G;  4UB6 E;  2AEM A;  2PGD A;  5B66 H;  5EFW B;  3HRN A;  4D6T E;  1U7J A;  1HVV A;  3TDK A;  2HPC B;  2W6B A;  1PGO A;  3WMM 0;  4DJG A;  1URQ D;  3AEC D;  3EQ2 A;  1N7S D;  2BEQ D;  4YT0 D;  3L72 J;  3KZI E;  3TK1 A;  1L2P A;  1H0T B;  1RF1 A;  3AE6 D;  4JYC A;  1OVV A;  1SQQ J;  1K05 A;  5DJT B;  1IZN B;  3RK3 E;  1PGP A;  1EZV E;  1L0N J;  1LTT C;  1S2E A;  2HLO A;  1BE3 G;  2IX7 C;  1PGQ A;  3O8Z A;  1EZV D;  2ZAE B;  4PJ0 E;  1FC2 C;  1OFC X;  2V7Q J;  3L73 G;  3L72 E;  3HD7 B;  2Y0C A;  2ZVO B;  2W6A A;  3L72 D;  4R4L A;  5AVZ B;  1FU1 A;  3BCC J;  3CL3 D;  1SQQ E;  1L0N K;  3R2P A;  4IL6 X;  4ASW A;  2W27 A;  1DX7 A;  1ZR2 A;  3CCV P;  5APV A;  3AE8 D;  1S9K E;  1L0N D;  2I1J A;  2W6J H;  3H1I J;  2FYU K;  1M1J C;  4WY4 A;  1SQP E;  1X22 A;  5C3J D;  2E43 A;  3BCC E;  1E79 H;  1NTZ J;  1G2C B;  3BCC D;  2KUB A;  5TIS E;  3VR9 C;  2IYO A;  1MV8 A;  4PD4 I;  3RK2 C;  3IFM A;  1GZL A;  3CCS P;  3I55 P;  1PPJ E;  3GHG B;  2WPV B;  1LP1 B;  3H1I E;  2WP9 C;  1NU1 J;  4LGD E;  3TGU E;  3VP9 A;  2H89 C;  1Z56 A;  4YXD C;  3H1I D;  3C9I A;  4H13 D;  2KZJ A;  1NTZ D;  3MUD A;  2BS4 C;  1AFO A;  5C2T C;  1KQF B;  1NYH A;  3U59 A;  4PD4 H;  2IBZ D;  1GMJ A;  1CW5 A;  5AVV B;  3H1K J;  1RQV A;  3AE9 C;  4H44 D;  3JCU E;  4LDT A;  2O1J A;  1NU1 E;  2KP8 A;  4C7N A;  1NTM E;  1VF5 D;  1NU1 D;  3FGA D;  1BGY E;  1BDD A;  4DDG A;  1ZXG A;  2XU6 A;  3D6Z A;  1DEB A;  3VOP A;  2Y0D A;  3D70 A;  1NEN D;  2WSC H;  2YXR B;  1R5S A;  3H1K E;  1KV4 A;  1KN7 A;  3HE4 A;  1KFY C;  1N73 C;  5CCH C;  3H1K D;  1S5L E;  3AEE D;  1JEK A;  2WU2 C;  3CIR D;  3AEA C;  3M91 A;  3CX5 I;  3B5N A;  3UIA A;  2R3C A;  1A02 F;  1JCC A;  4JYB A;  4I7Z C;  4L76 A;  2QM8 A;  3AEF D;  1P84 D;  1M1J B;  3FXD A;  3A0H E;  1HGV A;  1FZG A;  4IFD K;  1SFC A;  1QLB C;  3SWY A;  1QX8 A;  1S3J A;  5KAI H;  2YNY A;  1GDT A;  3CX5 H;  1NTK J;  3O6Q A;  3B5N B;  3CCR P;  1IC2 A;  3RK2 B;  1FJP A;  2ZXX A;  1K73 Q;  4UB6 H;  4OGQ C;  4I6M C;  2AXC A;  1L0V D;  1MZ9 A;  5APX A;  4DCK A;  2WPQ A;  2Q3E A;  1EZV I;  2KXP B;  1W2E A;  1KOR A;  3P4P D;  1KMI Z;  2FYN C;  1L4A D;  1JY3 P;  4WY4 D;  2OGU A;  2KOG A;  1NTK D;  2FXM A;  4PV1 B;  3U1C A;  3H32 B;  3KZI H;  1URQ C;  2WMM A;  3AEC C;  1VQ5 P;  1SVF A;  1N7S C;  4C7R A;  4YT0 C;  2WSF J;  3OA7 A;  1S4X A;  5APY A;  5AW3 B;  1K04 A;  2BS3 C;  2RKL A;  1KYO D;  1KIL A;  4W7Z A;  4LC1 A;  4QMA A;  1IFI A;  1VPC A;  3RK3 C;  3HUS A;  4PJ0 H;  3AED D;  1SQX K;  1EZV G;  1BE3 E;  2M0B A;  1N73 B;  2JJL A;  5K5G B;  3TSI A;  2WZ7 A;  4YSY D;  2OQQ A;  5AVS B;  3L73 E;  3L72 G;  1YJW P;  3CC7 P;  2XND H;  3AE1 C;  4TT3 H;  1TFF A;  3CCE P;  5AW0 B;  3D71 A;  4IL6 E;  4NPD A;  1YIJ P;  1LWU C;  4I7Z B;  2V7Q H;  1L0N G;  3G71 P;  1RE3 C;  2WU5 C;  2DW3 A;  1EXI A;  4B86 A;  1OVR A;  4JBZ A;  1AJY A;  1HF9 A;  5TIS H;  5C3J C;  2IBZ I;  4ASV A;  2QE7 H;  3P8M C;  3BCC G;  1VQP P;  4Y28 J;  4RO0 A;  1YTZ T;  2IFM A;  2D2C D;  2B76 D;  3VRB D;  2KI7 B;  1JTH B;  2E76 C;  1VQO P;  1PL5 A;  3S1K A;  4OGQ B;  2A45 I;  3N4X A;  5M1B A;  3Q5S A;  1PV3 A;  3V2Q A;  3H1I G;  3LIE A;  1SQB J;  2ZVN B;  1EDK A;  2C0W A;  2FYN B;  1NTZ G;  2NPS C;  5CHX A;  2W83 C;  2OTL P;  3P7K A;  1Y8A A;  1SFC D;  2IBZ G;  3JCU H;  1TU3 F;  1URQ B;  3KDP B;  3D6Y A;  4IFM A;  1N7S B;  1R8E A;  2ZYA A;  4H44 C;  2A45 H;  1FS0 E;  5KLV J;  2QEX P;  1MKM A;  1NU1 G;  1VF5 C;  1IFP A;  1SQB E;  4PD4 E;  1N8R Q;  2H88 C;  1SQB D;  2A45 G;  3BAT A;  3CME P;  4YSX D;  4UB8 E;  4N78 E;  5GTI E;  4N78 D;  1S5L H;  1NEN C;  1Q2N A;  4GOE A;  3SFE D;  1BSH A;  2OYH A;  5KLV E;  3H1K G;  4ZMD A;  3AEE C;  4YTM C;  5KLV D;  3M9B A;  2Q9I A;  1NEK D;  1U7M A;  2WDR D;  3QH9 A;  1IFN A;  2I8D A;  3P4R C;  1LWU B;  3AEG D;  2JO1 A;  1S5L X;  2FBW C;  1RF1 C;  1S1C X;  1RY3 A;  3BVH A;  3PLN A;  1KIL D;  1J1E B;  3A0H H;  3AEF C;  2E75 C;  1QL1 A;  3P32 A;  2ZJS E;  2G3A A;  1GL2 A;  1JY2 N;  2QG4 A;  1FOS F;  1HBW A;  4YPC A;  3G4S P;  3TNU B;  1LJ2 A;  1KQS O;  4EOT A;  2ACZ C;  2LXB A;  2C0X A;  1PIX A;  1VQ9 P;  1JY2 O;  1KYO I;  2AEJ A;  3EFG A;  3KHU A;  3BRV B;  4BXL A;  2PP6 A;  2Q7C A;  2P67 A;  5CBO A;  3ITK A;  3G9R A;  4KX6 C;  1KZU B;  3RL0 g;  3Q3D A;  1RQU A;  4H13 B;  5AVR B;  2YKQ A;  1X0T A;  3P4P C;  2Q3I A;  2WPS A;  2HFE D;  3AE7 C;  1HWT C;  2K3R A;  2IYP A;  4WY4 C;  1NTK G;  2JDI H;  4OVN F;  1RE4 A;  4H44 B;  4I1L A;  1OMI A;  1YBK A;  4M3L A;  1X79 B;  2WDQ D;  4K35 A;  1VF5 B;  3NTN A;  4IFF A;  3V4W A;  2WDV D;  5AVQ B;  1FBM A;  3Q5R A;  2PFX A;  2L5G B;  1LTJ A;  2W90 A;  1Q7Y Q;  2YKO A;  1H88 A;  2K9J A;  1SS1 A;  3AED C;  2WSF H;  1OIP A;  3R4Y A;  2OYI A;  3F89 A;  1DIP A;  1NO4 A;  3MUD C;  2O1K A;  2CPS A;  3NMD A;  3A5T A;  4IL6 H;  4KT0 J;  2N9B A;  1DD4 A;  3L74 J;  2XNX A;  1U57 A;  2B9B A;  5APQ A;  1Q82 Q;  1K8A Q;  1RF1 B;  1CSB A;  3H6P A;  2FYU J;  1M8O B;  3WUT A;  2ZT9 D;  1PZQ A;  2E75 B;  1L0N E;  3BAS A;  3H1J J;  3WUV A;  2WSS H;  3VMX A;  4L74 A;  5APS A;  1L4A A;  3I56 P;  4IOI H;  1WT6 A;  1LGH B;  2J5U A;  3L74 D;  1QL2 A;  2D2C C;  2B76 C;  2R5B A;  3CXH E;  2FYU D;  2YMK A;  3CXH D;  1SQP K;  3B5N C;  1GU5 A;  3Q5P A;  1FZA A;  4YSZ C;  2L91 A;  3P4Q D;  3H1J D;  1J1D B;  1NOH A;  1KC8 Q;  5CBN A;  2IPP A;  1FDI A;  4N3Y B;  4WY4 B;  5AW6 B;  1NTZ E;  3VR8 D;  1NKN A;  1T2K D;  3VP8 A;  2G8Y A;  1GL2 D;  3HTK A;  2N1T A;  1RHZ B;  3V6I A;  2IBZ E;  2KS1 A;  1KB9 D;  1OZH A;  4PV1 C;  2WS3 D;  5CCG A;  2FY8 A;  4Y99 C;  3P4S C;  4UB8 H;  3KXD A;  2M5A A;  1SQB G;  5KJ7 A;  3L71 D;  5GTI H;  3A3Y B;  3KPE A;  3N7N A;  4WWI A;  3VRA D;  2E5T A;  3L75 J;  3H1H D;  3HTK B;  1CI6 A;  3H25 A;  1Q86 Q;  4GKG A;  2KS1 B;  2O01 N;  1YIT P;  5APT A;  5KLV G;  2YIU B;  1ZRT D;  1NEK C;  4Z1M H;  1LTA C;  2WDR C;  1KFN A;  1FZB A;  2R3S A;  5CJ4 A;  1G1I A;  4KJM A;  2WQY D;  2M5A B;  4C7N B;  1M90 Q;  3LID A;  3V5B A;  3LW5 J;  2O01 J;  5KAF E;  3Q2Y A;  3OAK A;  2XZR A;  3VON A;  4HYT B;  1KIL C;  3IN6 A;  4YTN D;  3L75 D;  2K1A A;  3SSU A;  1FZC A;  3HE5 A;  2VRS A;  2BAS A;  1L0L K;  1VL2 A;  3HUS C;  1ZP0 C;  1P84 E;  2UWJ E;  4I2L C;  3A0B E;  3HE4 B;  3KYQ A;  1L0L D;  3M0D A;  2KLV A;  2KNC A;  2D2C B;  2NRG A;  4I6L A;  3TYY A;  2M8R A;  3T97 A;  4AQR D;  1FOS E;  4YTP C;  4OWF A;  5AW2 B;  1VQL P;  2N9Y B;  3CI9 A;  3GW6 A;  3ABV D;  4XA4 A;  1H89 A;  3CMA P;  5E79 E;  2BCC D;  3GLM A;  1IO4 A;  4HH2 A;  3AE5 D;  4DDI A;  3CWB J;  1SFC B;  2K37 A;  1JOC A;  3VN0 A;  1YYC A;  1NTK E;  2WPR A;  1AA0 A;  1YQ3 D;  1FZF A;  3O6Q B;  3V4Q A;  3WU2 E;  2WDQ C;  4Y99 B;  1SQV K;  4BRY A;  1FJK A;  2A06 E;  2WDV C;  1SQX J;  2A06 D;  1KYO E;  3AE4 D;  3CCL P;  3AE6 C;  1W5C E;  1AV1 A;  1N86 A;  3CWB D;  1IJD B;  3RL0 D;  2YMY A;  1LTG C;  2HOD A;  1EC5 A;  1BCC J;  4U7J A;  3MGN A;  3M0A A;  2N1T D;  1JM0 A;  1SQX E;  4DZO A;  3CXH I;  3AE2 D;  1SQX D;  4R4M A;  1NGM B;  5CCG D;  3SFD D;  2J59 M;  3A2A A;  1KIL B;  2ZT9 C;  2C9L Y;  5KJ7 D;  1JY3 N;  3GF3 A;  3W67 A;  3H1L J;  2WT7 A;  3AE8 C;  3HUS B;  1BCC E;  1DD3 A;  2FKW B;  2HOD B;  1QVF O;  1LT1 A;  1QGK B;  3B8E B;  1JMM A;  1BCC D;  1J1E C;  4ZKP A;  2OYH C;  3CXH H;  3V2N A;  1KB9 I;  3L74 G;  5H2F E;  4EDF A;  5DJU B;  1JMB A;  3ZDM A;  1T8Z A;  3AEB D;  3GMA A;  2FYU G;  2B88 A;  3MP7 B;  4H0L D;  4GIF A;  4DOJ A;  3H1L E;  1FZE A;  1LT9 A;  1LTS C;  3WUU A;  1HJB A;  3H1J G;  1KQG B;  3H1L D;  3P8C D;  1GW4 A;  3PP5 A;  1PP9 J;  2B89 A;  2E74 D;  2KYV A;  3QWO C;  3VR8 C;  1SLQ A;  4H13 C;  1T2K C;  1GL2 C;  1OW7 A;  3VR9 D;  2Y9Z A;  1BDC A;  2HR3 A;  1S72 P;  1X9V A;  2WS3 C;  4XFJ A;  3BRT B;  3S9O A;  1GK6 A;  2CK3 H;  1PP9 E;  1Q90 D;  4K3A A;  2E5Y A;  1YI2 P;  3FX0 A;  1PP9 D;  5APU A;  3L71 G;  5AW9 B;  1NH4 A;  2WVR A;  3II6 A;  3G6E P;  2GM4 A;  1P84 I;  4W7Y A;  4LLH A;  2RN0 A;  1WMK A;  3MIW A;  3AE3 D;  1JY2 P;  2BS2 C;  2Y0E A;  4U3F J;  1RE4 C;  2WSC J;  5KAF H;  1M7L A;  1OWA A;  3CIR C;  1AVO A;  2PAJ A;  2ZT9 B;  3L4F A;  2Z5H A;  1HGZ A;  1P84 H;  1LTJ C;  3EWK A;  4YTN C;  3L75 G;  1KIL E;  2SPZ A;  3A0B H;  1VQ7 P;  3CPW O;  2OYI C;  2FFD A;  2OYH B;  3LW5 H;  2O01 H;  2LXC B;  1CZQ A;  4U3F D;  3VTP C;  4OH8 B;  2P2U A;  3JSV C;  3V2R A;  5GTH H;  2H43 A;  3M9Q A;  1GW3 A;  2B87 A;  5BVZ A;  4GOD A;  4TLF A;  1KF6 D;  1YQ4 D;  1W2B O;  1USD A;  1JB0 J;  5E79 H;  2LR2 A;  2R44 A;  5BU5 A;  1WRG A;  1L0V C;  2KK7 A;  2BCC G;  3AE5 C;  3OJA B;  1J1D C;  2ZFC A;  1GL2 B;  3WU2 H;  3A7O A;  4D6T J;  2OYO A;  2HPC A;  3U1A A;  1L4A C;  1ZV8 A;  1EDJ A;  1N2D C;  2QIW A;  5TJH A;  2R32 A;  2P7J A;  1M56 D;  3IAO A;  2FXP A;  2WSE J;  1PGJ A;  1KYO H;  1H0T A;  3L35 A;  4A7P A;  2QA4 P;  2A06 G;  2E42 A;  2P58 A;  1VQ6 P;  1YHQ P;  2R5D A;  2GUS A;  3VMA A;  3CWB G;  1KTM A;  4XE5 B;  3RL0 C;  4D6T D;  1HTL C;  4RKU J;  2H8P D;  1GK4 A;  3CLQ A;  1FE6 A;  3HD7 A;  2N1T C;  1FAV A;  4YSY C;  2P10 A;  2QSI A;  3AE2 C;  1SQX G;  2ZYG A;  2YIU C;  1XTG B;  5CCG C;  1DEE G;  1RF0 A;  3PTZ A;  3SFD C;  1IK9 A;  1VDF A;  1LTJ B;  3IR9 A;  5KJ7 C;  1JNM A;  4N6J A;  3RK3 D;  5AW7 B;  2K9J B;  2YXQ B;  3RBZ A;  1IFD A;  3EFF K;  3V2P A;  2OYI B;  1QLE D;  1BCC G;  5H2F H;  1AQT A;  2IDB A;  2MKV A;  1VQ4 P;  3KQG A;  2WWW A;  2H7H A;  1SQQ K;  1SQP J;  4HJG H;  3MTU E;  3AE1 D;  1NKZ B;  2KZI A;  2V4H A;  1G2C A;  3L74 E;  3GF7 A;  2QJY B;  3AEB C;  3F5H A;  1ZR4 A;  1ZN5 A;  2Y9Y A;  4DHI B;  1SQQ D;  3CD6 P;  3RGU A;  4H0L C;  5B5E E;  1USE A;  3S4R A;  2FYU E;  5L8R J;  4WBA A;  3VRB C;  1Y47 A;  4DHZ A;  3VYI A;  4NPE A;  1J2J B;  3GHG A;  2WU5 D;  3H1L G;  2KSE A;  1S9K D;  1LP1 A; 
#chains in the Genus database with same CATH homology
 3AE3 D;  3AED C;  3P4P D;  1KMI Z;  3AE8 C;  2WP9 D;  2FYN C;  1S1C X;  1DD3 A;  3R4Y A;  3D6Z A;  1DIP A;  1ZME C;  2D2C D;  2B76 D;  2BS2 C;  2H89 D;  3VRB D;  4YXD D;  2E74 C;  2QJK C;  3P4R D;  4PV1 C;  4PV1 B;  2WSC J;  2WS3 D;  2E76 C;  2E76 B;  3AEF C;  4IL6 X;  2E75 C;  1PL5 A;  2JP3 A;  1EXJ A;  3ABV D;  3P4S C;  1Y9B A;  4OGQ B;  4H0L B;  4YTP D;  4KT0 J;  3D70 A;  2FBW D;  3VRA C;  3AEC C;  5M1B A;  1YQ3 C;  3Q5S A;  1DD4 A;  3Q1M A;  1PV3 A;  2K9Y A;  1NEN D;  3AE8 D;  3CIR C;  4YT0 C;  3GLM A;  1KF6 C;  1KTM A;  2G3A A;  1FDO A;  1U57 A;  2WSF J;  2ZT9 B;  3AE5 D;  1YQ4 C;  5C2T D;  1KFY C;  3AEB D;  3C8V A;  3GMA A;  4PV1 D;  5KLI C;  2E76 D;  4YTN C;  3EWK A;  3AEE D;  2E75 D;  1K04 A;  4RKU J;  2BS3 C;  3P4S D;  4OGQ D;  4H0L D;  1KIL E;  3AE9 D;  1UIX A;  3VRA D;  1YQ3 D;  1OW6 A;  2ACZ C;  2WU2 C;  3CIR D;  2NZ2 A;  5C3J D;  2E74 B;  3AE4 C;  3GF3 A;  2ZT9 D;  3AEA C;  3H25 A;  1PIX A;  2WQY C;  2WDQ C;  1KQG B;  2E75 B;  4YSY C;  2P10 A;  1ZOY D;  1TU3 F;  2QSI A;  3AE2 C;  3D6Y A;  3VR9 C;  3AED D;  4I7Z C;  2YIU C;  1NEK C;  2WDV C;  3G9R A;  1R8E A;  4Z1M H;  2WDR C;  4KX6 C;  3RL0 g;  2ACZ D;  3SFD C;  3B71 A;  4H44 C;  2E74 D;  3AE4 D;  3Q3D A;  1MKM A;  1RQU A;  3AEF D;  3VR8 C;  2BEZ F;  2WQY D;  4H13 C;  4H13 B;  4YSX C;  3AE6 C;  4YSY D;  2OQQ A;  3T97 B;  1OW7 A;  2J5U A;  1VF5 C;  3AEC D;  3VR9 D;  3AE1 C;  3LW5 J;  2WPV B;  2BEQ D;  3AE3 C;  2O01 J;  2H88 C;  3P4P C;  4YT0 D;  2WP9 C;  4TT3 H;  3SFE C;  1KF6 D;  3AEG D;  3AE7 C;  4KX6 D;  3Q2Y A;  2D2C C;  2H89 C;  1KFY D;  3D71 A;  1QLB C;  1HJ0 A;  4YXD C;  1YQ4 D;  2B76 C;  3P4Q C;  1ZRT E;  3IN6 A;  4YTN D;  1JB0 J;  2WS3 C;  4H13 D;  4YSX D;  4XFJ A;  3AE6 D;  2IDB A;  2MKV A;  2YMK A;  4I7Z B;  4U7J A;  1OW8 A;  3S9O A;  3O6Q A;  1IK7 A;  2QJP C;  2BS4 C;  3AE1 D;  3Q5P A;  2WU2 D;  4H44 B;  1VL2 A;  1NEN C;  2H88 D;  1Q90 D;  1ZP0 C;  1L0V C;  1K05 A;  1OMI A;  3SFE D;  3RK3 E;  4YSZ C;  3AE7 D;  4GDO A;  3AEA D;  3AE5 C;  5C2T C;  1KQF B;  1NYH A;  2QJY C;  3GF7 A;  1E7P C;  2WDQ D;  2WU5 C;  3P4Q D;  1EXI A;  3AEB C;  3AEG C;  3AE2 D;  1GMJ A;  1VF5 B;  3AEE C;  4YTM C;  4R4M A;  1NGM B;  1AJY A;  4OGQ C;  4H0L C;  1HF9 A;  1NEK D;  2WDV D;  1RQV A;  3Q5R A;  2WDR D;  3AE9 C;  1FDI A;  3SFD D;  4H44 D;  5L8R J;  3VRB C;  2D2C B;  2QIW A;  1ZP0 D;  1L0V D;  5C3J C;  5KKZ C;  4YSZ D;  3P4R C;  2V7Q J;  3VR8 D;  2ZT9 C;  2WU5 D;  3ABV C;  3IAO A;  2FXP A;  2G8Y A;  2JO1 A;  1ZOY C;  1S5L X;  1VF5 D;  1WMK A;  2WSE J;  4YTP C;  3FGA D;  2FBW C;  4Y28 J;  4YTM D;  4R4L A;  1KOR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...