3AE6C

Crystal structure of porcine heart mitochondrial complex ii bound with n-(3-isopropoxy-phenyl)-phthalamicacid
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with N-(3-Isopropoxy-phenyl)-phthalamicacid
rcsb
total genus 43
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3ae6C01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3ae6C02
3AEBC 3AE3C 3AE9D 1YQ3C 4YTND 1ZP0D 3AEEC 1NENC 3AEFD 1OW7A 3AE5D 3AEDD 4YTPD 5C3JD 1YQ3D 2H88C 3P4QC 2WDRD 4YSXC 1NEND 3VR9D 1KF6D 3AE2D 2WU5C 3VRBC 3AEGD 4YSYC 5C2TC 3ABVC 2FBWC 2WQYC 1ZOYC 1YQ4D 2WS3D 4YTMC 3SFDC 4YSXD 3AE7C 3AE1C 2G3AA 2WDQC 2WU5D 3VRAD 3P4RD 3AE4C 2BS4C 3AECC 2WDVC 1OW8A 3AE6C 2WQYD 3CIRD 3SFED 1OW6A 1K05A 3P4SD 1E7PC 3AEBD 3AE3D 4YT0C 3AEED 2B76C 2H89C 3AEAC 1NEKC 2WP9C 4KX6C 2BS3C 2H88D 3P4QD 1KFYC 2ACZC 3VRBD 4YSYD 5C2TD 3ABVD 3P4PC 4YSZC 2FBWD 1ZOYD 1L0VC 2WU2C 4YTMD 3S9OA 3SFDD 3AE7D 3AE1D 3VR8C 2WDQD 3AE4D 3AE9C 1K04A 1ZP0C 3AECD 2WDVD 3AE6D 2BS2C 4YXDC 3B71A 1L0VD 3AE8C 3AE5C 1KTMA 3VR8D 3AEDC 4YTPC 5C3JC 4YT0D 2WDRC 2B76D 2H89D 4YXDD 1NEKD 3AEAD 2WP9D 3VR9C 4KX6D 3AE2C 1KF6C 3AE8D 3AEGC 1KFYD 1YQ4C 2WS3C 2ACZD 3VRAC 4YTNC 3P4RC 3P4PD 4YSZD 3AEFC 2WU2D 1PV3A 1QLBC 3CIRC 3SFEC 3P4SC
chains in the Genus database with same CATH superfamily
1NTKE 2FY8A 3AE3C 1RHZB 5AVUB 4LLHA 2ZFYA 4U7JA 1NENC 2YMKA 1PIXA 3E1RA 1JO5A 3L74J 1NTKD 5AVZB 3FGAD 3V5BA 3NMDA 4GIFA 1SQBG 3S4RA 2K1AA 1LWUA 2WS3D 1JOCA 4GOEA 5BU5A 4DHZA 3TYYA 2WDVC 1PFIA 3TK1A 1L0NE 1FC2C 1ZLLA 4N3YB 1KQLA 2WP9C 2A06E 4KX6C 1ZMEC 1SQBJ 2E75C 1QX8A 2A06D 2ACZC 2VRSA 5C39A 1NKNA 1VL2A 1SQXD 3N4XA 5KLVE 3AE1D 3VR8C 2WDQD 2H43A 2KI7B 3RK3B 3KHUA 1QGKB 3L71E 4L75A 3AEDC 2JWDA 4R4MA 2RKLA 4DZOA 1LTTC 1Y8AA 3LW5J 1RF1C 3L71D 5AW6B 1PL5A 3VONA 1N73C 3VP9A 2LR2A 1YTZT 3KDPB 2A45I 1JY2O 2FFDC 3VTPC 5L8RJ 3A5TA 5KKZB 1FZBA 1WMKA 3L70E 1Q90D 3NXSA 3P7KA 3P4SC 1YQ3C 1W2EA 1VQ4P 3L70D 1L4AD 2IBZG 3G6EP 3EFGA 1J2JB 1W2BO 1N7SD 1SQQG 2WPQA 1SQVD 2H88C 3RBXA 1FS0E 4C7RA 5TISE 2MJZA 1QL1A 1FDMA 3SWKA 2Q7CA 3H1KE 4YSXD 1G1JA 3RK2C 3P4RD 2OYHB 3H1KD 3CIRD 1P84E 1RE3C 4OH8B 1RQVA 3HTKB 5CCGD 1SQQJ 1P84D 1L4AA 5AW9B 3PTZA 4XFJA 1N7SA 4I2LC 3CC2P 1DEEG 1T3JA 1NHLA 4U3FJ 1J1DC 2WTYA 3PP5A 3H32B 3MD0A 4YXDC 3P8CD 2QVAA 1KB9I 5AW8B 3M9HA 1Y9BA 1ZRTD 2M3BA 5CCGA 2WDRC 1L2PA 3TSIA 1L0LJ 2ZXXA 2M5AB 1FOSE 1BE3G 1S4XA 3MTUE 1BCCD 1VQ6P 4PV1D 3MP7B 1S3JA 2WPVB 2WSCH 2QA4P 1HWTC 1QLBC 3L73G 1HTLC 1OX3A 1EDJA 3V6IA 1ZP0D 4W7YA 1X9VA 1FOSF 1FDIA 1BE3J 1RF1B 3HUSC 5KLVK 2M0BA 1SFCD 3EWKA 1VQNP 3AE2D 1BGYJ 3KZIE 3F89A 2IFNA 1SQPK 4Y99B 1N73B 4I6LA 1VF5D 2KB7P 2FFDB 3L4FA 2KS1B 4ZKUA 1P84H 4NPEA 1PGJA 2WITA 4ASVA 2WSEJ 3TGUE 1S72P 3CI9A 4AYCA 2N1TB 2W90A 1HVVA 4L73A 2R44A 3GHGB 2YO3A 4HYTB 1SFCA 1KQFB 1KV4A 1EDLA 4A7PA 1U57A 1DD4A 5CMZA 1GD2E 1MZ9A 3RK3E 4O9BA 1IK7A 2WSFH 1GMJA 3FWNA 2ZJSE 1N8RQ 2XDJA 2FYUG 2O1JA 1QVGO 1BDDA 3VR9C 1HJ0A 3W68A 1YBKA 4PJ0E 1NAFA 1KFYD 4NPDA 3ZDMA 3B4SA 1J1DB 3P4PD 1NU1D 1EC5A 3SFEC 2FYUJ 1JY3O 1A02F 2RN0A 5BU8B 3OJAB 3L72G 1JM0A 2H8PD 3BRTB 1ZR4A 1SQBE 3VMXA 4YSXC 2M3EA 3HD7B 2KUBA 1YJ9P 1AJYA 3AE7C 2G3AA 3A0HE 3AE6C 3L72J 1SQXJ 2YIUC 4WY4B 2IBZI 3AE3D 5AVSB 1LNQA 4YT0C 3TNUB 3RL0C 2Y0DA 2H89C 2HLOA 4L76A 5APTA 2AXTE 3HUSB 1LT9A 1AVYA 4N78E 1GZLA 3CX5D 1GK6A 1YJNP 1ZW0A 2PFXA 3MUDC 1VQ7P 1LJ2A 4N78D 4PD4H 3V2NA 2QJPC 3BCCG 2WDVD 1DD3A 1LTIC 3B71A 4UB8E 1DH3A 2OYHA 1TFFA 2YKOA 2P1JA 3HTKA 1EXIA 2CK3H 2WP9D 4KX6D 1KF6C 3WU2E 1KFNA 4PJ0H 1SLQA 1GDTA 2BEQD 2Q5UA 3CXHI 3H1JD 2ACZD 4KHXA 3BCCJ 4ZKPA 1S9KE 2IBZE 5CCHA 3H32A 3AEEC 2ITAA 1SQQE 3B8EB 2GUVA 3C1LA 2FXOA 3AEDD 1GTWA 1CSBA 3SWYA 4RKUJ 3CLQA 2E5YA 2IFMA 2Y9YA 5CHXA 2M5AA 4YSYC 1PGQA 3OW2O 1NGMB 3GG2A 3KPEA 3B5NB 2OTKE 1EXJA 3AE4C 3A0HH 4WWIA 3Q5PA 1DX7A 1LP1B 3P4SD 1SP4A 2AXTH 2V4HA 4N6JA 3CX5H 2H88D 1EZVG 3L75D 1RF1A 3PRJA 3CXHE 1OMIA 1E79H 1HBWA 1BCCJ 1N73A 1HH0A 3RK3C 1K9MQ 3RK2D 2W6JH 5CJ0A 2Q3IA 3I55P 1SQBK 2FFDA 1NH4A 4UB8H 3A3YB 3VMZA 3OAKA 3RL0B 5AVYB 2Q3EA 2P7JA 2B87B 2BCCE 2Z4EA 2HG5D 5APXA 1NTMD 2KLVA 4C7NB 2YNYA 3CCUP 2BCCD 3L73E 3O6QB 4LC1A 3E1IA 2QIWA 3N7NA 2GUSA 2K37A 1EDIA 5AW2B 1KYOD 5TJHA 2NPSB 1RE3A 4RESB 2WDRD 5KLIC 4HB1A 2IDBA 3H1HG 1OVVA 4HH2A 3HD7D 3M9BA 3T97B 1OVRA 3MIWA 4JYCA 4AUWA 2QJKC 3R2PA 4OGQC 3II6A 2HFED 3M9QA 2OYIB 2YXRB 1GU4A 3H1HJ 5AVRB 2QJYC 2JO1A 1IK9A 1OVUA 2O01J 5CCHC 4Z1MH 1URQB 3HD7A 1IJDB 2KZJA 1PP9G 1SQQK 2WPRA 1ZN5A 2L5GB 5B5EE 5KAIE 2IZ0A 3G3ZA 5K5GB 4C46A 4OWFA 1L0ND 1Q2NA 3AE5C 1K73Q 3CC7P 3A2AA 1MFTA 2B88A 2D2CB 4DHIB 1PP9J 3HUSA 3A0BE 1FZCB 1SQPE 5GTHE 5KLVD 1KYOH 2BASA 2C0WA 3L35A 1T8ZA 3L72E 3FX0A 1L0LK 1SQPD 2HODB 2NRGA 5APUA 5APQA 1RH5B 1U7MA 4Y99C 4D6TG 1S2EA 5APVA 3VR9D 2E43A 3IFMA 4JF7A 2Z5IA 3A7OA 2QG4A 4YTMC 2J59M 1YITP 1PPJE 4H44C 4H0LC 3SFED 3RGUA 2N1TC 1PPJD 5CBNA 3GHGC 1FBMA 4D6TJ 3CWBE 1BDCA 2B76C 3AEAC 2FKWB 1T2KC 3CWBD 5KLIB 3GLMA 4M3LA 1JUNA 4U3FG 5AW3B 1FZGA 3H1JJ 4W7ZA 3BCCE 3AE7D 1GL2C 4KT0J 2QJKB 5CBOA 4H13C 3GMAA 4OGQB 3AE6D 1YJWP 4YXWH 2C0XA 2Q1KA 5M1BA 4YTPC 1LP1A 3FXDA 3EQ2A 4YT0D 3RL0D 4ASWA 2H89D 1L0LG 2KP8A 1EZVI 1FZFA 2P10A 1R8EA 2JDIH 1Y47A 3AEGC 4B86A 3CCJP 2QJYB 2V7QJ 4XA4A 1NJIQ 1DEBA 3A0BH 3E7KA 3VMYA 5GTHH 3JC22 2XNDH 1H88A 2I1JA 3TF5A 2FYZA 1N2DC 1JCCA 1S1CX 3HD7C 3H25A 3P4QC 1USEA 3H1LJ 1BGYG 2YKPA 1KF6D 1NVOA 2KSEA 1JTHA 2FYUK 3ABVC 4R4LA 2YXQB 3HRNA 1X0TA 1VQ8P 1RE4C 4WY4C 1T3UA 3VOPA 4GDOA 2E76B 5GTIE 2W6BA 2W27A 3MUDA 3D6YA 3O6QA 2E74B 3BRVB 2ZT9C 4GKGA 4IFMA 3AEED 5TISH 3H1IE 1EZVE 2XKMA 1LTBC 2OARA 3RL0g 3LIEA 3H1ID 1NTZJ 1SQXK 2P58A 3IF4A 3S1KA 4YSYD 4YSZC 1NTMJ 3T97A 2QM7A 4UB6E 1KB9E 3AE4D 2N9BA 3WUUA 4H44B 1M56D 4H0LB 1KB9D 4IOIH 2OQQA 3TGUD 1Q81Q 1MFZA 1NTKG 2H7HA 5APYA 3U1AA 2A45H 2OYIA 3CCSP 4L74A 4HJGH 2BEZF 1CI6B 4RJTA 3CCVP 5KTBA 1H89A 1IZNB 3CCEP 1LTJB 2N9YB 3RK3D 1GL2B 3WUTA 4H13B 3L74E 1X22A 4JYBA 5KAFE 3HE5B 1NTKJ 2B89A 3L74D 1HGZA 3C8VA 3V4WA 3B5NC 2WT7B 5E79E 1FU1A 2AXCA 2A06G 2E5TA 1MV8A 1YI2P 1SQXG 1M57D 4IFDK 1K05A 1L0NJ 2W6AA 1NEKC 3KZIH 1SQBD 2J58A 4DCKA 2Z5HA 4RO0A 1IFNA 1UIIA 1KILC 3U59A 1KB9H 1Q82Q 2W8ZA 1AQTA 4OGQD 3CCLP 2ZT9B 3L70G 2HPCB 3CD6P 3PHLA 4EOTA 3L71J 2SPZA 1SQVG 1OFCX 2C9NY 1WT6A 2J5UA 2QM8A 5CCHD 2YO2A 3M91A 1RQUA 2NPSC 1AFOA 2WSCJ 3V4QA 5H2FE 3AEBC 1OZHA 2FYNB 3H1KG 3L70J 5AW4B 2WSSH 1S5LE 3AE5D 1SQVJ 1PGOA 1QL2A 3L37A 1RF0C 1M8OB 4GT1A 1FDOA 2LKMA 5C2TC 2OTLP 2PP6A 2Y9ZA 3M06A 1QLED 4OVNF 3H1KJ 3ITKA 1M1JB 1OW8A 3CL3D 1CZQA 4TT3H 3USSA 3IAOA 1S9KD 2ZVNB 2OYIC 2IBZD 1E7PC 3RBZA 1Q86Q 1M1KQ 1SQQD 2K9JB 1OWAA 2HR3A 1URQC 2WPSA 1JMMA 4U3FE 1PGPA 5AW1B 4LGDE 4BRYB 1N7LA 1BCCG 1SVFA 4YTMD 1NWQA 3AE9C 3V2RA 3F5HA 4H44D 2WSFJ 4H0LD 1HUCA 2ZYGA 2ZXEB 3CCRP 2N1TD 1L0LE 2D2CC 3QWOC 1M7LA 2B76D 1L4AB 1GW4A 3AEAD 1T2KD 1IFJA 1L0LD 4NPFX 1FZCC 1N7SB 3GF3A 3CXHD 1YQ4C 1OIPA 4QMAA 2KS1A 1KILB 3CMAP 4I1LA 1GL2D 1KD1Q 4DDGA 4YTND 1D7MA 1HF9A 4H13D 1BE3E 2Y0EA 3AEFD 3PLNA 1NOHA 3EFFK 4DDIA 1VQMP 3WU2H 4YTPD 2QRXA 2N1TA 1BGYE 1BE3D 1EDKA 1JY2N 3MHVA 3GHGA 3Q3DA 2XU6A 1BGYD 2DW3A 4IL6E 3AEGD 1WRGA 2FBWC 4Y28J 3L73D 2WU5D 2KNCB 3AECC 1AA0A 3VMAA 2WQYD 1LTJA 5AW5B 1M90Q 1GL2A 2GM4A 1IFPA 1IFMA 1XTGB 2P2UA 3HE5A 1BSNA 3P4QD 2M8RA 2UWJE 2AEMA 3HE4B 3M0DC 2K3RA 2WT7A 3ABVD 1CW5A 2WU2C 2POHA 4WY4D 4PV1B 3MZWB 1NU1G 2YKQA 1QVFO 2ZT9D 4JPZB 5C3JC 1MKMA 1A02J 3CXHH 3AE8D 1BSHA 2E42A 5KJ7D 1SFCB 1H8AA 5EFWB 3VRAC 4YSZD 2FYUE 4EDFA 3L36A 1NU1J 1RE4A 1VQKP 2IYOA 4WY4A 1VF5B 2FYUD 2WWWA 3CCQP 3TNUA 2JJLA 1YIJP 2I8DA 3G71P 1FJPA 1JEKA 2HPCA 5B66E 2JWAA 5AVWB 4IL6H 2E76C 2W83C 4DJGA 1LTSC 2KSJA 4LDTA 1KN7A 2I1KA 4YPCA 5KJ7A 1SQXE 2E74C 2ZYDA 2KK7A 1G2CB 2WSEH 3L72D 1OW6A 3GF7A 3VYIA 1P84I 1RY3A 1H0TB 4MN4C 1XTCC 3VP8A 3Q5RA 2GA1A 1NKZB 1W5CE 5APWA 3B5ND 4WB4A 3Q2YA 4BXLA 3H1JG 4K35A 2JEEA 2KXPB 2L91A 3UIAA 1SS1A 1M1JA 1FZAA 3H6PA 1L0VD 1NTZK 4ZNCA 4HKZH 2Y0CA 1NTMK 1SQVE 1NEKD 4DHJA 2K9JA 3I5CA 3U1CA 1LT9B 3CCMP 3TDKA 1LTJC 1IFIA 5B5EH 2MKVA 1KILE 5KAIH 3B5NA 4TLFA 4YTNC 4BRYA 3AEFC 1KILD 1PV3A 3BCCD 1LTAC 1YYCA 3BATA 3H1LG 3O8ZA 5B66H 2WU5C 3VRBC 3L75G 3K5BA 2WQYC 1AQ5A 1ZOYC 1JY3N 3SFDC 1NTKK 2XZRA 2NPSD 1KILA 3MGNA 3P8CE 5DJTB 3AEBD 1ZRTE 2XV5A 1T6AA 4DOJA 2FXPA 2O3JA 1LWUC 2B87A 3L75J 2IX7C 1NTZG 1JB0J 1BCCE 4C7NA 3P32A 2E75B 1NTMG 5C2TD 2LXBA 4K3AA 3QH9A 3S9OA 1L0NK 2BCCG 2PRRA 4JQ0D 3OA7A 2JR8A 4I7ZC 3V2PA 2NZ2A 2KNCA 2OGUA 4PD4I 2Q6QA 2NPSA 3AE8C 1KTMA 4GODA 1LT1A 1AV1A 1VQLP 5KJ7C 1EZVD 1NYHA 3W67A 1YHQP 1URQD 2WS3C 1TU3F 1RF0A 2WMMA 2BCCJ 3HE4A 2OTJP 2FYNC 1DIPA 4XE5B 1K8AQ 3D70A 2AEJA 1E5WA 3L73J 5AVQB 3AE9D 1FE6A 3KQGA 1ZR2A 1JY2P 1AVOA 3M0AA 2D2CD 2WZ7A 3IN6A 2P67A 3C9IA 1URQA 1M1JC 2B9BA 2R3CA 1QEXA 1YQ4D 3PH0A 3AE1C 1Q7YQ 2WDQC 1ZV8A 1SQVK 2KYVA 2KZIA 1VDFA 4PD4E 3RK2B 2KOGA 1VPCA 3NFQA 3D71A 1L0NG 1IC2A 3H1HE 4PD4D 3BVHA 5AW7B 2R3SA 1GU5A 1R5SA 3H1HD 2CPSA 4GOFA 3CX5I 5GTIH 4KJMA 1FZCA 2FBWD 5APSA 1KC8Q 1L0VC 1NU1E 3AECD 5KLVG 2HODA 2BS2C 2OYOA 1G2CA 1L4AC 1SQPG 2K88A 3G4SP 5CJ4A 2QSIA 1N7SC 3L71G 2HYNA 1FAVA 1JMBA 2LXCB 1PP9E 1H0TA 2KIKA 1LWUB 1N86A 1IO4A 4UB6H 1PP9D 3WMM0 1KMIZ 2RMZA 2QE7H 3P4RC 1FJKA 5KLVJ 1OXZA 2WU2D 1U7JA 3CIRC 3GW6A 1SQPJ 4EYYQ 4I7ZB 3Q1MA 4EI2A 2XNXA 5CCGC 5AVTB 3KYQA 1OW7A 1PPJG 3JCUE 4I6MC 4ZMDA 5C3JD 2ZAEB 1FZEA 2C9LY 4JBZA 1NEND 1UIXA 3CWBG 3CX5E 3FWLA 3M0DA 1NO4A 3VRAD 2BS4C 5KAFH 1G1IA 4WBAA 2IPPA 4D6TE 2WVRA 4FJVA 3VN0A 2CPBA 4D6TD 1X79B 4W80A 5E79H 1YTZI 3CWBJ 4CPGA 2BS3C 2O01H 3CC4P 3CMEP 4PV1C 3H1JE 1J1EC 3JSVC 3PJSK 2E75D 2E76D 2G8YA 3SWFA 4AQRD 3FXEA 2ZVOB 2A45G 1USDA 1GK4A 1ZXGA 3R4YA 2E74D 5AW0B 1K04A 1ZP0C 2Q9IA 1KQSO 3VR8D 1S5LX 2O01N 2K9YA 5BVZA 1SFCC 3NTNA 3AE2C 1NAYA 2YMYA 4U3FD 1VQPP 1VF5C 5AVXB 3I56P 3LW5H 1KYOI 2O1KA 1PZQA 2ZYAA 4BWNA 1HGVA 3H1LE 3JCUH 2FXMA 2ZFCA 2IZ1A 1YQ3D 3V2QA 3G9RA 1NU1K 3P8MC 3H1LD 3L75E 1VQOP 1JY3P 3SSUA 3H1IG 4DT0A 3IR9A 1HJBA 5H2FH 2IYPA 2RH0A 3CPWO 1EQ7A 1S5LH 3WUVA 2PGDA 2JP3A 1JCDA 1X8YA 1GW3A 1KZUB 2JKVA 1MUUA 2YIUB 3TGUG 1LTGC 2R5DA 4WVZA 5DJUB 1NTZE 2PAJA 3H1IJ 2KLUA 1KFYC 1NTME 1VQ9P 3BASA 1NTZD 1JTHB 3Q5SA 1CI6A 3VRBD 3P4PC 1KFMA 1ZOYD 1Z56A 5KKZC 3SFDD 4EIJA 1KORA 1IFDA 3LIDA 1KYOE 2QJPB 3D6ZA 2AEFA 3TGUJ 2R5BA 2QEXP 1LT9C 1R5LA 4YXDD 3L74G 2V7QH 1KQGB 1LGHB 4IL6X 4IFFA 1J1EB 2R32A 1VQ5P 2OYHC 3KXDA 1JNMA 5AVVB
chains in the Genus database with same CATH topology
1VF5B 3Q1MA 3AEBC 3AE3C 3AE9D 1YQ3C 4H13B 1ZP0D 3P4SC 1HF9A 4H13D 4YTND 4U7JA 3AEEC 1NENC 3AEFD 2YMKA 1OW7A 1PIXA 3AE5D 1S1CX 3AEDD 4YTPD 1FDIA 2D2CD 3H25A 5C3JD 1YQ3D 2H88C 3P4QC 3C8VA 3FGAD 2WDRD 3G9RA 5KLIC 3IN6A 1NEND 3Q3DA 4RKUJ 4YSXC 3EWKA 3VR9D 1KF6D 3AE2D 2IDBA 1UIXA 2WU5C 1FDOA 3VRBC 3AEGD 4YSYC 2E76C 2WSCJ 3ABVC 4R4LA 3T97B 5C2TC 2FBWC 1NGMB 2WQYC 1AJYA 1ZOYC 1YQ4D 2WS3D 4YTMC 3SFDC 4Y28J 4YSXD 3AE7C 3AE1C 2G3AA 1VF5D 2E74C 1EXJA 2WDQC 2WU5D 4GDOA 3AE4C 3P4RD 2BS4C 2E76B 3VRAD 2QJKC 3AECC 2WDVC 1OW8A 3Q5PA 3AE6C 4H44C 3D6YA 4TT3H 4OGQC 2WQYD 3IAOA 3CIRD 3O6QA 2YIUC 4H0LC 3SFED 1OW6A 1K05A 3P4SD 1E7PC 1RQVA 2E74B 2JP3A 2ZT9C 3AE3D 2WSEJ 3AEBD 3D71A 3GF7A 1ZRTE 4YT0C 3AEED 2B76C 2H89C 3AEAC 1NEKC 2WP9C 4KX6C 1ZMEC 2E75C 2FXPA 3Q5RA 4XFJA 2BS3C 2H88D 3P4QD 2QJYC 3RL0g 3GLMA 2JO1A 1KFYC 1JB0J 4PV1C 2ACZC 1KQFB 2O01J 3Q5SA 3VRBD 4Z1MH 2E75B 2E75D 4YSYD 2E76D 5C2TD 3ABVD 3Q2YA 1OMIA 2G8YA 2FBWD 3P4PC 1U57A 3VR8D 1DD4A 4YSZC 1ZOYD 1VL2A 1L0VC 2WU2C 5KKZC 4YTMD 3R4YA 2QJPC 3S9OA 4PV1B 3SFDD 3AE7D 3AE1D 4KT0J 3RK3E 1IK7A 3VR8C 2E74D 1GMJA 2WDQD 4I7ZC 3AE4D 3AE9C 1KORA 1K04A 1ZP0C 3AECD 2NZ2A 4H13C 4H44B 2WDVD 1DD3A 3GMAA 4H44D 4OGQB 2BS2C 4OGQD 4YXDC 3B71A 4H0LB 3AE6D 2WSFJ 4H0LD 1L0VD 3D6ZA 3AE8C 3AE5C 2OQQA 1S5LX 1Y9BA 2ZT9B 1KTMA 2ZT9D 3AEDC 5M1BA 2QSIA 2D2CC 2K9YA 4YTPC 5C3JC 4R4MA 4YT0D 1MKMA 1EXIA 2WDRC 3LW5J 2B76D 2H89D 4YXDD 1NYHA 1NEKD 3AEAD 2WP9D 3VR9C 4KX6D 3AE2C 2P10A 1KF6C 1R8EA 1HJ0A 3AE8D 1KQGB 2D2CB 3AEGC 1PL5A 3GF3A 4IL6X 2BEQD 2J5UA 2V7QJ 1KFYD 2BEZF 1YQ4C 2WS3C 1TU3F 2MKVA 1KILE 4PV1D 2ACZD 1KMIZ 2WPVB 1VF5C 3VRAC 2FYNC 1DIPA 3P4RC 4YTNC 3P4PD 4YSZD 5L8RJ 1RQUA 3D70A 3AEFC 1WMKA 1PV3A 1QLBC 2WU2D 3CIRC 3SFEC 1Q90D 2QIWA 4I7ZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AEB C;  3AE3 C;  3AE9 D;  1YQ3 C;  4YTN D;  1ZP0 D;  3AEE C;  1NEN C;  3AEF D;  1OW7 A;  3AE5 D;  3AED D;  4YTP D;  5C3J D;  1YQ3 D;  2H88 C;  3P4Q C;  2WDR D;  4YSX C;  1NEN D;  3VR9 D;  1KF6 D;  3AE2 D;  2WU5 C;  3VRB C;  3AEG D;  4YSY C;  5C2T C;  3ABV C;  2FBW C;  2WQY C;  1ZOY C;  1YQ4 D;  2WS3 D;  4YTM C;  3SFD C;  4YSX D;  3AE7 C;  3AE1 C;  2G3A A;  2WDQ C;  2WU5 D;  3VRA D;  3P4R D;  3AE4 C;  2BS4 C;  3AEC C;  2WDV C;  1OW8 A;  3AE6 C;  2WQY D;  3CIR D;  3SFE D;  1OW6 A;  1K05 A;  3P4S D;  1E7P C;  3AEB D;  3AE3 D;  4YT0 C;  3AEE D;  2B76 C;  2H89 C;  3AEA C;  1NEK C;  2WP9 C;  4KX6 C;  2BS3 C;  2H88 D;  3P4Q D;  1KFY C;  2ACZ C;  3VRB D;  4YSY D;  5C2T D;  3ABV D;  3P4P C;  4YSZ C;  2FBW D;  1ZOY D;  1L0V C;  2WU2 C;  4YTM D;  3S9O A;  3SFD D;  3AE7 D;  3AE1 D;  3VR8 C;  2WDQ D;  3AE4 D;  3AE9 C;  1K04 A;  1ZP0 C;  3AEC D;  2WDV D;  3AE6 D;  2BS2 C;  4YXD C;  3B71 A;  1L0V D;  3AE8 C;  3AE5 C;  1KTM A;  3VR8 D;  3AED C;  4YTP C;  5C3J C;  4YT0 D;  2WDR C;  2B76 D;  2H89 D;  4YXD D;  1NEK D;  3AEA D;  2WP9 D;  3VR9 C;  4KX6 D;  3AE2 C;  1KF6 C;  3AE8 D;  3AEG C;  1KFY D;  1YQ4 C;  2WS3 C;  2ACZ D;  3VRA C;  4YTN C;  3P4R C;  3P4P D;  4YSZ D;  3AEF C;  2WU2 D;  1PV3 A;  1QLB C;  3CIR C;  3SFE C;  3P4S C; 
#chains in the Genus database with same CATH topology
 1NTK E;  2FY8 A;  3AE3 C;  1RHZ B;  5AVU B;  4LLH A;  2ZFY A;  4U7J A;  1NEN C;  2YMK A;  1PIX A;  3E1R A;  1JO5 A;  3L74 J;  1NTK D;  5AVZ B;  3FGA D;  3V5B A;  3NMD A;  4GIF A;  1SQB G;  3S4R A;  2K1A A;  1LWU A;  2WS3 D;  1JOC A;  4GOE A;  5BU5 A;  4DHZ A;  3TYY A;  2WDV C;  1PFI A;  3TK1 A;  1L0N E;  1FC2 C;  1ZLL A;  4N3Y B;  1KQL A;  2WP9 C;  2A06 E;  4KX6 C;  1ZME C;  1SQB J;  2E75 C;  1QX8 A;  2A06 D;  2ACZ C;  2VRS A;  5C39 A;  1NKN A;  1VL2 A;  1SQX D;  3N4X A;  5KLV E;  3AE1 D;  3VR8 C;  2WDQ D;  2H43 A;  2KI7 B;  3RK3 B;  3KHU A;  1QGK B;  3L71 E;  4L75 A;  3AED C;  2JWD A;  4R4M A;  2RKL A;  4DZO A;  1LTT C;  1Y8A A;  3LW5 J;  1RF1 C;  3L71 D;  5AW6 B;  1PL5 A;  3VON A;  1N73 C;  3VP9 A;  2LR2 A;  1YTZ T;  3KDP B;  2A45 I;  1JY2 O;  2FFD C;  3VTP C;  5L8R J;  3A5T A;  5KKZ B;  1FZB A;  1WMK A;  3L70 E;  1Q90 D;  3NXS A;  3P7K A;  3P4S C;  1YQ3 C;  1W2E A;  1VQ4 P;  3L70 D;  1L4A D;  2IBZ G;  3G6E P;  3EFG A;  1J2J B;  1W2B O;  1N7S D;  1SQQ G;  2WPQ A;  1SQV D;  2H88 C;  3RBX A;  1FS0 E;  4C7R A;  5TIS E;  2MJZ A;  1QL1 A;  1FDM A;  3SWK A;  2Q7C A;  3H1K E;  4YSX D;  1G1J A;  3RK2 C;  3P4R D;  2OYH B;  3H1K D;  3CIR D;  1P84 E;  1RE3 C;  4OH8 B;  1RQV A;  3HTK B;  5CCG D;  1SQQ J;  1P84 D;  1L4A A;  5AW9 B;  3PTZ A;  4XFJ A;  1N7S A;  4I2L C;  3CC2 P;  1DEE G;  1T3J A;  1NHL A;  4U3F J;  1J1D C;  2WTY A;  3PP5 A;  3H32 B;  3MD0 A;  4YXD C;  3P8C D;  2QVA A;  1KB9 I;  5AW8 B;  3M9H A;  1Y9B A;  1ZRT D;  2M3B A;  5CCG A;  2WDR C;  1L2P A;  3TSI A;  1L0L J;  2ZXX A;  2M5A B;  1FOS E;  1BE3 G;  1S4X A;  3MTU E;  1BCC D;  1VQ6 P;  4PV1 D;  3MP7 B;  1S3J A;  2WPV B;  2WSC H;  2QA4 P;  1HWT C;  1QLB C;  3L73 G;  1HTL C;  1OX3 A;  1EDJ A;  3V6I A;  1ZP0 D;  4W7Y A;  1X9V A;  1FOS F;  1FDI A;  1BE3 J;  1RF1 B;  3HUS C;  5KLV K;  2M0B A;  1SFC D;  3EWK A;  1VQN P;  3AE2 D;  1BGY J;  3KZI E;  3F89 A;  2IFN A;  1SQP K;  4Y99 B;  1N73 B;  4I6L A;  1VF5 D;  2KB7 P;  2FFD B;  3L4F A;  2KS1 B;  4ZKU A;  1P84 H;  4NPE A;  1PGJ A;  2WIT A;  4ASV A;  2WSE J;  3TGU E;  1S72 P;  3CI9 A;  4AYC A;  2N1T B;  2W90 A;  1HVV A;  4L73 A;  2R44 A;  3GHG B;  2YO3 A;  4HYT B;  1SFC A;  1KQF B;  1KV4 A;  1EDL A;  4A7P A;  1U57 A;  1DD4 A;  5CMZ A;  1GD2 E;  1MZ9 A;  3RK3 E;  4O9B A;  1IK7 A;  2WSF H;  1GMJ A;  3FWN A;  2ZJS E;  1N8R Q;  2XDJ A;  2FYU G;  2O1J A;  1QVG O;  1BDD A;  3VR9 C;  1HJ0 A;  3W68 A;  1YBK A;  4PJ0 E;  1NAF A;  1KFY D;  4NPD A;  3ZDM A;  3B4S A;  1J1D B;  3P4P D;  1NU1 D;  1EC5 A;  3SFE C;  2FYU J;  1JY3 O;  1A02 F;  2RN0 A;  5BU8 B;  3OJA B;  3L72 G;  1JM0 A;  2H8P D;  3BRT B;  1ZR4 A;  1SQB E;  3VMX A;  4YSX C;  2M3E A;  3HD7 B;  2KUB A;  1YJ9 P;  1AJY A;  3AE7 C;  2G3A A;  3A0H E;  3AE6 C;  3L72 J;  1SQX J;  2YIU C;  4WY4 B;  2IBZ I;  3AE3 D;  5AVS B;  1LNQ A;  4YT0 C;  3TNU B;  3RL0 C;  2Y0D A;  2H89 C;  2HLO A;  4L76 A;  5APT A;  2AXT E;  3HUS B;  1LT9 A;  1AVY A;  4N78 E;  1GZL A;  3CX5 D;  1GK6 A;  1YJN P;  1ZW0 A;  2PFX A;  3MUD C;  1VQ7 P;  1LJ2 A;  4N78 D;  4PD4 H;  3V2N A;  2QJP C;  3BCC G;  2WDV D;  1DD3 A;  1LTI C;  3B71 A;  4UB8 E;  1DH3 A;  2OYH A;  1TFF A;  2YKO A;  2P1J A;  3HTK A;  1EXI A;  2CK3 H;  2WP9 D;  4KX6 D;  1KF6 C;  3WU2 E;  1KFN A;  4PJ0 H;  1SLQ A;  1GDT A;  2BEQ D;  2Q5U A;  3CXH I;  3H1J D;  2ACZ D;  4KHX A;  3BCC J;  4ZKP A;  1S9K E;  2IBZ E;  5CCH A;  3H32 A;  3AEE C;  2ITA A;  1SQQ E;  3B8E B;  2GUV A;  3C1L A;  2FXO A;  3AED D;  1GTW A;  1CSB A;  3SWY A;  4RKU J;  3CLQ A;  2E5Y A;  2IFM A;  2Y9Y A;  5CHX A;  2M5A A;  4YSY C;  1PGQ A;  3OW2 O;  1NGM B;  3GG2 A;  3KPE A;  3B5N B;  2OTK E;  1EXJ A;  3AE4 C;  3A0H H;  4WWI A;  3Q5P A;  1DX7 A;  1LP1 B;  3P4S D;  1SP4 A;  2AXT H;  2V4H A;  4N6J A;  3CX5 H;  2H88 D;  1EZV G;  3L75 D;  1RF1 A;  3PRJ A;  3CXH E;  1OMI A;  1E79 H;  1HBW A;  1BCC J;  1N73 A;  1HH0 A;  3RK3 C;  1K9M Q;  3RK2 D;  2W6J H;  5CJ0 A;  2Q3I A;  3I55 P;  1SQB K;  2FFD A;  1NH4 A;  4UB8 H;  3A3Y B;  3VMZ A;  3OAK A;  3RL0 B;  5AVY B;  2Q3E A;  2P7J A;  2B87 B;  2BCC E;  2Z4E A;  2HG5 D;  5APX A;  1NTM D;  2KLV A;  4C7N B;  2YNY A;  3CCU P;  2BCC D;  3L73 E;  3O6Q B;  4LC1 A;  3E1I A;  2QIW A;  3N7N A;  2GUS A;  2K37 A;  1EDI A;  5AW2 B;  1KYO D;  5TJH A;  2NPS B;  1RE3 A;  4RES B;  2WDR D;  5KLI C;  4HB1 A;  2IDB A;  3H1H G;  1OVV A;  4HH2 A;  3HD7 D;  3M9B A;  3T97 B;  1OVR A;  3MIW A;  4JYC A;  4AUW A;  2QJK C;  3R2P A;  4OGQ C;  3II6 A;  2HFE D;  3M9Q A;  2OYI B;  2YXR B;  1GU4 A;  3H1H J;  5AVR B;  2QJY C;  2JO1 A;  1IK9 A;  1OVU A;  2O01 J;  5CCH C;  4Z1M H;  1URQ B;  3HD7 A;  1IJD B;  2KZJ A;  1PP9 G;  1SQQ K;  2WPR A;  1ZN5 A;  2L5G B;  5B5E E;  5KAI E;  2IZ0 A;  3G3Z A;  5K5G B;  4C46 A;  4OWF A;  1L0N D;  1Q2N A;  3AE5 C;  1K73 Q;  3CC7 P;  3A2A A;  1MFT A;  2B88 A;  2D2C B;  4DHI B;  1PP9 J;  3HUS A;  3A0B E;  1FZC B;  1SQP E;  5GTH E;  5KLV D;  1KYO H;  2BAS A;  2C0W A;  3L35 A;  1T8Z A;  3L72 E;  3FX0 A;  1L0L K;  1SQP D;  2HOD B;  2NRG A;  5APU A;  5APQ A;  1RH5 B;  1U7M A;  4Y99 C;  4D6T G;  1S2E A;  5APV A;  3VR9 D;  2E43 A;  3IFM A;  4JF7 A;  2Z5I A;  3A7O A;  2QG4 A;  4YTM C;  2J59 M;  1YIT P;  1PPJ E;  4H44 C;  4H0L C;  3SFE D;  3RGU A;  2N1T C;  1PPJ D;  5CBN A;  3GHG C;  1FBM A;  4D6T J;  3CWB E;  1BDC A;  2B76 C;  3AEA C;  2FKW B;  1T2K C;  3CWB D;  5KLI B;  3GLM A;  4M3L A;  1JUN A;  4U3F G;  5AW3 B;  1FZG A;  3H1J J;  4W7Z A;  3BCC E;  3AE7 D;  1GL2 C;  4KT0 J;  2QJK B;  5CBO A;  4H13 C;  3GMA A;  4OGQ B;  3AE6 D;  1YJW P;  4YXW H;  2C0X A;  2Q1K A;  5M1B A;  4YTP C;  1LP1 A;  3FXD A;  3EQ2 A;  4YT0 D;  3RL0 D;  4ASW A;  2H89 D;  1L0L G;  2KP8 A;  1EZV I;  1FZF A;  2P10 A;  1R8E A;  2JDI H;  1Y47 A;  3AEG C;  4B86 A;  3CCJ P;  2QJY B;  2V7Q J;  4XA4 A;  1NJI Q;  1DEB A;  3A0B H;  3E7K A;  3VMY A;  5GTH H;  3JC2 2;  2XND H;  1H88 A;  2I1J A;  3TF5 A;  2FYZ A;  1N2D C;  1JCC A;  1S1C X;  3HD7 C;  3H25 A;  3P4Q C;  1USE A;  3H1L J;  1BGY G;  2YKP A;  1KF6 D;  1NVO A;  2KSE A;  1JTH A;  2FYU K;  3ABV C;  4R4L A;  2YXQ B;  3HRN A;  1X0T A;  1VQ8 P;  1RE4 C;  4WY4 C;  1T3U A;  3VOP A;  4GDO A;  2E76 B;  5GTI E;  2W6B A;  2W27 A;  3MUD A;  3D6Y A;  3O6Q A;  2E74 B;  3BRV B;  2ZT9 C;  4GKG A;  4IFM A;  3AEE D;  5TIS H;  3H1I E;  1EZV E;  2XKM A;  1LTB C;  2OAR A;  3RL0 g;  3LIE A;  3H1I D;  1NTZ J;  1SQX K;  2P58 A;  3IF4 A;  3S1K A;  4YSY D;  4YSZ C;  1NTM J;  3T97 A;  2QM7 A;  4UB6 E;  1KB9 E;  3AE4 D;  2N9B A;  3WUU A;  4H44 B;  1M56 D;  4H0L B;  1KB9 D;  4IOI H;  2OQQ A;  3TGU D;  1Q81 Q;  1MFZ A;  1NTK G;  2H7H A;  5APY A;  3U1A A;  2A45 H;  2OYI A;  3CCS P;  4L74 A;  4HJG H;  2BEZ F;  1CI6 B;  4RJT A;  3CCV P;  5KTB A;  1H89 A;  1IZN B;  3CCE P;  1LTJ B;  2N9Y B;  3RK3 D;  1GL2 B;  3WUT A;  4H13 B;  3L74 E;  1X22 A;  4JYB A;  5KAF E;  3HE5 B;  1NTK J;  2B89 A;  3L74 D;  1HGZ A;  3C8V A;  3V4W A;  3B5N C;  2WT7 B;  5E79 E;  1FU1 A;  2AXC A;  2A06 G;  2E5T A;  1MV8 A;  1YI2 P;  1SQX G;  1M57 D;  4IFD K;  1K05 A;  1L0N J;  2W6A A;  1NEK C;  3KZI H;  1SQB D;  2J58 A;  4DCK A;  2Z5H A;  4RO0 A;  1IFN A;  1UII A;  1KIL C;  3U59 A;  1KB9 H;  1Q82 Q;  2W8Z A;  1AQT A;  4OGQ D;  3CCL P;  2ZT9 B;  3L70 G;  2HPC B;  3CD6 P;  3PHL A;  4EOT A;  3L71 J;  2SPZ A;  1SQV G;  1OFC X;  2C9N Y;  1WT6 A;  2J5U A;  2QM8 A;  5CCH D;  2YO2 A;  3M91 A;  1RQU A;  2NPS C;  1AFO A;  2WSC J;  3V4Q A;  5H2F E;  3AEB C;  1OZH A;  2FYN B;  3H1K G;  3L70 J;  5AW4 B;  2WSS H;  1S5L E;  3AE5 D;  1SQV J;  1PGO A;  1QL2 A;  3L37 A;  1RF0 C;  1M8O B;  4GT1 A;  1FDO A;  2LKM A;  5C2T C;  2OTL P;  2PP6 A;  2Y9Z A;  3M06 A;  1QLE D;  4OVN F;  3H1K J;  3ITK A;  1M1J B;  1OW8 A;  3CL3 D;  1CZQ A;  4TT3 H;  3USS A;  3IAO A;  1S9K D;  2ZVN B;  2OYI C;  2IBZ D;  1E7P C;  3RBZ A;  1Q86 Q;  1M1K Q;  1SQQ D;  2K9J B;  1OWA A;  2HR3 A;  1URQ C;  2WPS A;  1JMM A;  4U3F E;  1PGP A;  5AW1 B;  4LGD E;  4BRY B;  1N7L A;  1BCC G;  1SVF A;  4YTM D;  1NWQ A;  3AE9 C;  3V2R A;  3F5H A;  4H44 D;  2WSF J;  4H0L D;  1HUC A;  2ZYG A;  2ZXE B;  3CCR P;  2N1T D;  1L0L E;  2D2C C;  3QWO C;  1M7L A;  2B76 D;  1L4A B;  1GW4 A;  3AEA D;  1T2K D;  1IFJ A;  1L0L D;  4NPF X;  1FZC C;  1N7S B;  3GF3 A;  3CXH D;  1YQ4 C;  1OIP A;  4QMA A;  2KS1 A;  1KIL B;  3CMA P;  4I1L A;  1GL2 D;  1KD1 Q;  4DDG A;  4YTN D;  1D7M A;  1HF9 A;  4H13 D;  1BE3 E;  2Y0E A;  3AEF D;  3PLN A;  1NOH A;  3EFF K;  4DDI A;  1VQM P;  3WU2 H;  4YTP D;  2QRX A;  2N1T A;  1BGY E;  1BE3 D;  1EDK A;  1JY2 N;  3MHV A;  3GHG A;  3Q3D A;  2XU6 A;  1BGY D;  2DW3 A;  4IL6 E;  3AEG D;  1WRG A;  2FBW C;  4Y28 J;  3L73 D;  2WU5 D;  2KNC B;  3AEC C;  1AA0 A;  3VMA A;  2WQY D;  1LTJ A;  5AW5 B;  1M90 Q;  1GL2 A;  2GM4 A;  1IFP A;  1IFM A;  1XTG B;  2P2U A;  3HE5 A;  1BSN A;  3P4Q D;  2M8R A;  2UWJ E;  2AEM A;  3HE4 B;  3M0D C;  2K3R A;  2WT7 A;  3ABV D;  1CW5 A;  2WU2 C;  2POH A;  4WY4 D;  4PV1 B;  3MZW B;  1NU1 G;  2YKQ A;  1QVF O;  2ZT9 D;  4JPZ B;  5C3J C;  1MKM A;  1A02 J;  3CXH H;  3AE8 D;  1BSH A;  2E42 A;  5KJ7 D;  1SFC B;  1H8A A;  5EFW B;  3VRA C;  4YSZ D;  2FYU E;  4EDF A;  3L36 A;  1NU1 J;  1RE4 A;  1VQK P;  2IYO A;  4WY4 A;  1VF5 B;  2FYU D;  2WWW A;  3CCQ P;  3TNU A;  2JJL A;  1YIJ P;  2I8D A;  3G71 P;  1FJP A;  1JEK A;  2HPC A;  5B66 E;  2JWA A;  5AVW B;  4IL6 H;  2E76 C;  2W83 C;  4DJG A;  1LTS C;  2KSJ A;  4LDT A;  1KN7 A;  2I1K A;  4YPC A;  5KJ7 A;  1SQX E;  2E74 C;  2ZYD A;  2KK7 A;  1G2C B;  2WSE H;  3L72 D;  1OW6 A;  3GF7 A;  3VYI A;  1P84 I;  1RY3 A;  1H0T B;  4MN4 C;  1XTC C;  3VP8 A;  3Q5R A;  2GA1 A;  1NKZ B;  1W5C E;  5APW A;  3B5N D;  4WB4 A;  3Q2Y A;  4BXL A;  3H1J G;  4K35 A;  2JEE A;  2KXP B;  2L91 A;  3UIA A;  1SS1 A;  1M1J A;  1FZA A;  3H6P A;  1L0V D;  1NTZ K;  4ZNC A;  4HKZ H;  2Y0C A;  1NTM K;  1SQV E;  1NEK D;  4DHJ A;  2K9J A;  3I5C A;  3U1C A;  1LT9 B;  3CCM P;  3TDK A;  1LTJ C;  1IFI A;  5B5E H;  2MKV A;  1KIL E;  5KAI H;  3B5N A;  4TLF A;  4YTN C;  4BRY A;  3AEF C;  1KIL D;  1PV3 A;  3BCC D;  1LTA C;  1YYC A;  3BAT A;  3H1L G;  3O8Z A;  5B66 H;  2WU5 C;  3VRB C;  3L75 G;  3K5B A;  2WQY C;  1AQ5 A;  1ZOY C;  1JY3 N;  3SFD C;  1NTK K;  2XZR A;  2NPS D;  1KIL A;  3MGN A;  3P8C E;  5DJT B;  3AEB D;  1ZRT E;  2XV5 A;  1T6A A;  4DOJ A;  2FXP A;  2O3J A;  1LWU C;  2B87 A;  3L75 J;  2IX7 C;  1NTZ G;  1JB0 J;  1BCC E;  4C7N A;  3P32 A;  2E75 B;  1NTM G;  5C2T D;  2LXB A;  4K3A A;  3QH9 A;  3S9O A;  1L0N K;  2BCC G;  2PRR A;  4JQ0 D;  3OA7 A;  2JR8 A;  4I7Z C;  3V2P A;  2NZ2 A;  2KNC A;  2OGU A;  4PD4 I;  2Q6Q A;  2NPS A;  3AE8 C;  1KTM A;  4GOD A;  1LT1 A;  1AV1 A;  1VQL P;  5KJ7 C;  1EZV D;  1NYH A;  3W67 A;  1YHQ P;  1URQ D;  2WS3 C;  1TU3 F;  1RF0 A;  2WMM A;  2BCC J;  3HE4 A;  2OTJ P;  2FYN C;  1DIP A;  4XE5 B;  1K8A Q;  3D70 A;  2AEJ A;  1E5W A;  3L73 J;  5AVQ B;  3AE9 D;  1FE6 A;  3KQG A;  1ZR2 A;  1JY2 P;  1AVO A;  3M0A A;  2D2C D;  2WZ7 A;  3IN6 A;  2P67 A;  3C9I A;  1URQ A;  1M1J C;  2B9B A;  2R3C A;  1QEX A;  1YQ4 D;  3PH0 A;  3AE1 C;  1Q7Y Q;  2WDQ C;  1ZV8 A;  1SQV K;  2KYV A;  2KZI A;  1VDF A;  4PD4 E;  3RK2 B;  2KOG A;  1VPC A;  3NFQ A;  3D71 A;  1L0N G;  1IC2 A;  3H1H E;  4PD4 D;  3BVH A;  5AW7 B;  2R3S A;  1GU5 A;  1R5S A;  3H1H D;  2CPS A;  4GOF A;  3CX5 I;  5GTI H;  4KJM A;  1FZC A;  2FBW D;  5APS A;  1KC8 Q;  1L0V C;  1NU1 E;  3AEC D;  5KLV G;  2HOD A;  2BS2 C;  2OYO A;  1G2C A;  1L4A C;  1SQP G;  2K88 A;  3G4S P;  5CJ4 A;  2QSI A;  1N7S C;  3L71 G;  2HYN A;  1FAV A;  1JMB A;  2LXC B;  1PP9 E;  1H0T A;  2KIK A;  1LWU B;  1N86 A;  1IO4 A;  4UB6 H;  1PP9 D;  3WMM 0;  1KMI Z;  2RMZ A;  2QE7 H;  3P4R C;  1FJK A;  5KLV J;  1OXZ A;  2WU2 D;  1U7J A;  3CIR C;  3GW6 A;  1SQP J;  4EYY Q;  4I7Z B;  3Q1M A;  4EI2 A;  2XNX A;  5CCG C;  5AVT B;  3KYQ A;  1OW7 A;  1PPJ G;  3JCU E;  4I6M C;  4ZMD A;  5C3J D;  2ZAE B;  1FZE A;  2C9L Y;  4JBZ A;  1NEN D;  1UIX A;  3CWB G;  3CX5 E;  3FWL A;  3M0D A;  1NO4 A;  3VRA D;  2BS4 C;  5KAF H;  1G1I A;  4WBA A;  2IPP A;  4D6T E;  2WVR A;  4FJV A;  3VN0 A;  2CPB A;  4D6T D;  1X79 B;  4W80 A;  5E79 H;  1YTZ I;  3CWB J;  4CPG A;  2BS3 C;  2O01 H;  3CC4 P;  3CME P;  4PV1 C;  3H1J E;  1J1E C;  3JSV C;  3PJS K;  2E75 D;  2E76 D;  2G8Y A;  3SWF A;  4AQR D;  3FXE A;  2ZVO B;  2A45 G;  1USD A;  1GK4 A;  1ZXG A;  3R4Y A;  2E74 D;  5AW0 B;  1K04 A;  1ZP0 C;  2Q9I A;  1KQS O;  3VR8 D;  1S5L X;  2O01 N;  2K9Y A;  5BVZ A;  1SFC C;  3NTN A;  3AE2 C;  1NAY A;  2YMY A;  4U3F D;  1VQP P;  1VF5 C;  5AVX B;  3I56 P;  3LW5 H;  1KYO I;  2O1K A;  1PZQ A;  2ZYA A;  4BWN A;  1HGV A;  3H1L E;  3JCU H;  2FXM A;  2ZFC A;  2IZ1 A;  1YQ3 D;  3V2Q A;  3G9R A;  1NU1 K;  3P8M C;  3H1L D;  3L75 E;  1VQO P;  1JY3 P;  3SSU A;  3H1I G;  4DT0 A;  3IR9 A;  1HJB A;  5H2F H;  2IYP A;  2RH0 A;  3CPW O;  1EQ7 A;  1S5L H;  3WUV A;  2PGD A;  2JP3 A;  1JCD A;  1X8Y A;  1GW3 A;  1KZU B;  2JKV A;  1MUU A;  2YIU B;  3TGU G;  1LTG C;  2R5D A;  4WVZ A;  5DJU B;  1NTZ E;  2PAJ A;  3H1I J;  2KLU A;  1KFY C;  1NTM E;  1VQ9 P;  3BAS A;  1NTZ D;  1JTH B;  3Q5S A;  1CI6 A;  3VRB D;  3P4P C;  1KFM A;  1ZOY D;  1Z56 A;  5KKZ C;  3SFD D;  4EIJ A;  1KOR A;  1IFD A;  3LID A;  1KYO E;  2QJP B;  3D6Z A;  2AEF A;  3TGU J;  2R5B A;  2QEX P;  1LT9 C;  1R5L A;  4YXD D;  3L74 G;  2V7Q H;  1KQG B;  1LGH B;  4IL6 X;  4IFF A;  1J1E B;  2R32 A;  1VQ5 P;  2OYH C;  3KXD A;  1JNM A;  5AVV B; 
#chains in the Genus database with same CATH homology
 1VF5 B;  3Q1M A;  3AEB C;  3AE3 C;  3AE9 D;  1YQ3 C;  4H13 B;  1ZP0 D;  3P4S C;  1HF9 A;  4H13 D;  4YTN D;  4U7J A;  3AEE C;  1NEN C;  3AEF D;  2YMK A;  1OW7 A;  1PIX A;  3AE5 D;  1S1C X;  3AED D;  4YTP D;  1FDI A;  2D2C D;  3H25 A;  5C3J D;  1YQ3 D;  2H88 C;  3P4Q C;  3C8V A;  3FGA D;  2WDR D;  3G9R A;  5KLI C;  3IN6 A;  1NEN D;  3Q3D A;  4RKU J;  4YSX C;  3EWK A;  3VR9 D;  1KF6 D;  3AE2 D;  2IDB A;  1UIX A;  2WU5 C;  1FDO A;  3VRB C;  3AEG D;  4YSY C;  2E76 C;  2WSC J;  3ABV C;  4R4L A;  3T97 B;  5C2T C;  2FBW C;  1NGM B;  2WQY C;  1AJY A;  1ZOY C;  1YQ4 D;  2WS3 D;  4YTM C;  3SFD C;  4Y28 J;  4YSX D;  3AE7 C;  3AE1 C;  2G3A A;  1VF5 D;  2E74 C;  1EXJ A;  2WDQ C;  2WU5 D;  4GDO A;  3AE4 C;  3P4R D;  2BS4 C;  2E76 B;  3VRA D;  2QJK C;  3AEC C;  2WDV C;  1OW8 A;  3Q5P A;  3AE6 C;  4H44 C;  3D6Y A;  4TT3 H;  4OGQ C;  2WQY D;  3IAO A;  3CIR D;  3O6Q A;  2YIU C;  4H0L C;  3SFE D;  1OW6 A;  1K05 A;  3P4S D;  1E7P C;  1RQV A;  2E74 B;  2JP3 A;  2ZT9 C;  3AE3 D;  2WSE J;  3AEB D;  3D71 A;  3GF7 A;  1ZRT E;  4YT0 C;  3AEE D;  2B76 C;  2H89 C;  3AEA C;  1NEK C;  2WP9 C;  4KX6 C;  1ZME C;  2E75 C;  2FXP A;  3Q5R A;  4XFJ A;  2BS3 C;  2H88 D;  3P4Q D;  2QJY C;  3RL0 g;  3GLM A;  2JO1 A;  1KFY C;  1JB0 J;  4PV1 C;  2ACZ C;  1KQF B;  2O01 J;  3Q5S A;  3VRB D;  4Z1M H;  2E75 B;  2E75 D;  4YSY D;  2E76 D;  5C2T D;  3ABV D;  3Q2Y A;  1OMI A;  2G8Y A;  2FBW D;  3P4P C;  1U57 A;  3VR8 D;  1DD4 A;  4YSZ C;  1ZOY D;  1VL2 A;  1L0V C;  2WU2 C;  5KKZ C;  4YTM D;  3R4Y A;  2QJP C;  3S9O A;  4PV1 B;  3SFD D;  3AE7 D;  3AE1 D;  4KT0 J;  3RK3 E;  1IK7 A;  3VR8 C;  2E74 D;  1GMJ A;  2WDQ D;  4I7Z C;  3AE4 D;  3AE9 C;  1KOR A;  1K04 A;  1ZP0 C;  3AEC D;  2NZ2 A;  4H13 C;  4H44 B;  2WDV D;  1DD3 A;  3GMA A;  4H44 D;  4OGQ B;  2BS2 C;  4OGQ D;  4YXD C;  3B71 A;  4H0L B;  3AE6 D;  2WSF J;  4H0L D;  1L0V D;  3D6Z A;  3AE8 C;  3AE5 C;  2OQQ A;  1S5L X;  1Y9B A;  2ZT9 B;  1KTM A;  2ZT9 D;  3AED C;  5M1B A;  2QSI A;  2D2C C;  2K9Y A;  4YTP C;  5C3J C;  4R4M A;  4YT0 D;  1MKM A;  1EXI A;  2WDR C;  3LW5 J;  2B76 D;  2H89 D;  4YXD D;  1NYH A;  1NEK D;  3AEA D;  2WP9 D;  3VR9 C;  4KX6 D;  3AE2 C;  2P10 A;  1KF6 C;  1R8E A;  1HJ0 A;  3AE8 D;  1KQG B;  2D2C B;  3AEG C;  1PL5 A;  3GF3 A;  4IL6 X;  2BEQ D;  2J5U A;  2V7Q J;  1KFY D;  2BEZ F;  1YQ4 C;  2WS3 C;  1TU3 F;  2MKV A;  1KIL E;  4PV1 D;  2ACZ D;  1KMI Z;  2WPV B;  1VF5 C;  3VRA C;  2FYN C;  1DIP A;  3P4R C;  4YTN C;  3P4P D;  4YSZ D;  5L8R J;  1RQU A;  3D70 A;  3AEF C;  1WMK A;  1PV3 A;  1QLB C;  2WU2 D;  3CIR C;  3SFE C;  1Q90 D;  2QIW A;  4I7Z B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...