3AE6C

Crystal structure of porcine heart mitochondrial complex ii bound with n-(3-isopropoxy-phenyl)-phthalamicacid
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with N-(3-Isopropoxy-phenyl)-phthalamicacid
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 43
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3ae6C01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3ae6C02
3AE3C 3AEEC 5C3JC 3AEDD 1KFYD 1KF6C 2B76C 4YSYC 3P4QD 2WU2C 3AE2D 1KTMA 4YSXC 3AE4C 3AE1C 1QLBC 3ABVD 3P4QC 1NEKC 3AE6D 2WDQD 3P4SD 3AE8D 2WU5C 3AE5D 3AEGC 3AEED 2FBWC 1OW6A 5C3JD 1YQ3D 1KF6D 2B76D 2BS3C 4YSYD 3ABVC 3P4SC 3AE8C 3VR9C 4KX6D 3AE5C 2WS3C 2WU2D 3AEAD 1OW7A 1YQ3C 3B71A 4YT0D 3CIRD 4YSXD 3AE4D 3AE1D 2ACZD 2WP9C 4YTND 1NEKD 4KX6C 3AEAC 1YQ4D 2WU5D 3AEBD 3AEGD 1L0VD 2FBWD 4YT0C 3CIRC 2WDRC 3VRAC 2ACZC 4YTNC 1YQ4C 3VR9D 2WDVC 3AEBC 2WS3D 1L0VC 4YSZC 3S9OA 3SFDC 1PV3A 1ZOYD 2WP9D 5C2TD 3AE7D 2H89C 1NEND 1ZP0D 2WQYC 3P4RC 2WDRD 3VRAD 1ZOYC 5C2TC 2WDVD 3AE7C 1NENC 1ZP0C 2H88C 4YSZD 3SFDD 1OW8A 4YXDC 3SFED 2H89D 2WQYD 3AEFD 3P4RD 3P4PD 3AE9C 3SFEC 1K05A 2H88D 2G3AA 3VR8D 3AEFC 3AEDC 4YTMD 1KFYC 3P4PC 4YXDD 2BS2C 1E7PC 3AECD 4YTPD 3VRBD 3AE2C 2BS4C 3VR8C 3AE3D 4YTMC 1K04A 3AE9D 3AECC 4YTPC 3AE6C 2WDQC 3VRBC
chains in the Genus database with same CATH superfamily
1NTME 1LT9B 3VN0A 1NTKJ 1BE3J 4QMAA 1CI6B 3O6QB 3CL3D 1HGZA 3L71J 3H32B 4EIJA 3B5NC 1J1EB 2NPSD 3ABVD 3L75J 2WPSA 2YXRB 1NGMB 1PPJD 5DJTB 5C3JD 3CXHE 2OYHC 4W7ZA 1A02J 2CPSA 1M57D 1IFNA 5B66H 1KILC 4WY4C 5AVYB 3CIRD 2C9LY 4BRYB 1NEKD 2IBZE 4Y99C 1KB9E 1UIIA 1N73A 1OIPA 3CXHH 5AW0B 3S1KA 1EC5A 1BGYD 1YTZT 1JY3O 1ZW0A 1FZGA 1PP9G 3VR9D 1FE6A 4K3AA 4Z1MH 4XA4A 2E74C 3V4QA 1KB9H 5C2TD 1HVVA 3W67A 2QG4A 2KI7B 2D2CD 1L0LJ 4GDOA 4XFJA 4D6TD 2PGDA 2QE7H 1X79B 3L74G 3P4RD 3G71P 3LIEA 2HLOA 3VR8D 3AEFC 4IFFA 3P4PC 3HUSC 1SQVK 5CJ0A 1LTBC 1KFNA 1VQOP 3E7KA 3GW6A 2IPPA 3I55P 3CMEP 2Q7CA 3H1KJ 2B76C 3BRTB 3SWYA 1LTTC 3M0AA 3P4QD 1SVFA 2YKOA 1Q82Q 3AE1C 3IN6A 2YXQB 2WDQD 2FYUK 1LTJA 2IBZI 5AW3B 1KF6D 1AA0A 1S72P 2FYNC 2WU2D 2WS3C 1JY2O 2LXCB 2KB7P 2NPSB 4IOIH 1NTMG 3CCUP 5APXA 5E79H 2WT7B 1IC2A 1SQPE 3T97A 4YT0C 1VQKP 1X9VA 2WDRC 1FZCC 3CCVP 4EOTA 1JTHA 4DHJA 3HE4B 2AEJA 1SP4A 2CK3H 1BGYJ 1BDCA 5AW9B 1GW3A 5AW4B 3CWBG 2Y0EA 3A0HH 1KYOH 2H88C 2FFDC 2IBZG 1XTCC 3R2PA 1RE3C 2R5BA 4RKUJ 3OA7A 3I56P 3L35A 1BSHA 2OTJP 2WITA 4GKGA 3RK3D 2HG5D 2YO2A 4YTMC 2ZT9D 1RHZB 2PRRA 4I7ZB 3WMM0 4H44D 1SQVD 4ASVA 3L73D 1PPJE 3H1JE 3E1RA 2WWWA 1Y9BA 3L71G 3H1HD 1PL5A 1BCCD 3AE4C 2C0XA 3IF4A 1GL2D 1AFOA 2WSCH 3L70E 2IZ0A 5CCHD 1JMBA 1SQBK 1USEA 5AVZB 2FYUD 3L72E 3RL0C 2WSFJ 1FZEA 3AEGD 1L0VD 2ACZC 2OQQA 1RY3A 3FX0A 2P67A 4D6TE 1L0NE 4LLHA 1BDDA 3HTKA 2KNCA 4EI2A 4IFDK 2FYZA 4TT3H 3USSA 3AE7C 1N73B 1Z56A 3WUUA 5BU8B 1URQC 1SQPG 1RE4C 1QEXA 2GUVA 1HTLC 2JWAA 4ZNCA 2PFXA 1SFCA 3KYQA 2V4HA 2XZRA 4RO0A 1FS0E 1LP1B 1N7LA 3G3ZA 1PIXA 5KLVK 4YXDD 2BCCE 1GTWA 1KD1Q 2V7QJ 3PHLA 3JCUE 1QVGO 3AE9D 3AE6C 2ZYAA 1LT9A 3AE3C 1VDFA 1NTKK 3O6QA 3PLNA 3H32A 3RK2D 3H1KG 4C7NB 1P84E 2XU6A 4PD4E 5KLIB 1UIXA 4DJGA 1AVYA 1SQVJ 1LWUA 1ZR2A 2B87A 1T6AA 3AE8D 3AE5D 4PV1B 2WMMA 2JO1A 3H1HJ 3KHUA 4DZOA 4PD4H 3HRNA 5CCGD 4LC1A 3CCJP 4FJVA 1W5CE 1IK7A 1NHLA 1PPJG 3H1JG 1FAVA 1SQQE 4LGDE 5M1BA 2WSEJ 1SQBD 5KJ7D 1N8RQ 2FYUJ 3LW5H 2IZ1A 4OGQC 1EZVE 1LTJB 5CHXA 1N7SA 4ZKPA 2KS1B 5APWA 2PP6A 3G9RA 2RMZA 4PJ0E 1L0LK 2KZJA 3VYIA 1LT9C 2OYIB 3T97B 3L72G 3CX5H 3M91A 1S5LE 5AW2B 3Q5SA 2M3EA 1J1EC 1JTHB 4PJ0H 2JKVA 1GDTA 2E75B 3LIDA 2OTLP 3NXSA 3L73E 3AEDC 4D6TG 2AXTE 3CC7P 4U3FE 1L0NG 1G1IA 3AECD 1VQ4P 3RGUA 1P84I 1K04A 1BCCE 2K1AA 3RL0B 2P10A 5KLVD 4LDTA 4GT1A 1CZQA 2A45G 4M3LA 2OTKE 1EXIA 3AE2D 1OVVA 2ZXEB 2WPQA 2LR2A 3H1LD 1J1DB 1NTKD 1QLED 2WVRA 5GTHH 1YQ3D 3BCCD 3TYYA 2QVAA 1L4AA 3RK2B 3L4FA 1HJBA 1KQLA 2ZXXA 1IZNB 2NPSA 2HODB 3D70A 4N78E 2I8DA 2E5YA 2AEFA 2ZFYA 3W68A 1NU1E 1FBMA 2ZVNB 1VPCA 1SQBJ 2WTYA 3VRAD 4U7JA 4YSZD 3Q2YA 3M9HA 1H0TA 3L74E 3SFED 3CC4P 3R4YA 2DW3A 1L0LD 2WQYD 1Y47A 2B88A 2PAJA 2KXPB 3MUDA 3ZDMA 5BU5A 1Y8AA 2KNCB 4I6LA 1M1KQ 1S1CX 1KQSO 1NYHA 2BS4C 1VQ7P 2NPSC 4XE5B 1IJDB 4H13B 1AQTA 2I1JA 5C3JC 3CCQP 1SFCB 1ZRTE 1QX8A 2QJKB 1W2EA 2WSSH 4KHXA 5KLVJ 3TGUD 3Q3DA 1KYOD 4A7PA 2QJYB 1SQVG 4C46A 1NEKC 3L73G 2J5UA 2UWJE 4EDFA 1NTZD 1RF0A 4U3FG 1S9KE 4YSYD 3I5CA 3H1LJ 1ZR4A 1KN7A 3H1HG 3VR9C 1BCCG 4IFMA 1L4AD 4YTND 4KX6C 3WUVA 3BCCJ 1WMKA 1YQ4D 2OYOA 1LWUB 1JY3N 2B87B 1NKNA 3MUDC 3NTNA 2E5TA 2FYUG 3GHGB 1PV3A 1JCCA 3CWBE 5CMZA 2J58A 4I7ZC 2W90A 3P4RC 2BEZF 2W8ZA 1M90Q 1DX7A 1OMIA 4Y28J 4GIFA 1JB0J 1JNMA 2KZIA 1E79H 3H1IJ 1FJPA 1N7SB 3SSUA 1RQVA 1OZHA 1NJIQ 2ZYDA 3TNUA 1NU1G 1LP1A 1E5WA 2KP8A 1OVRA 2R3SA 2JR8A 1IFMA 2MJZA 1KV4A 1NTKE 1BE3E 3A0BE 4YTPC 1U7MA 2WDQC 3P8CE 3IR9A 1ZLLA 3B5ND 3L71E 5APYA 1JUNA 1KF6C 4C7NA 1Q86Q 2ITAA 2WU2C 3RBZA 1JOCA 2O01H 2Q3IA 1KZUB 1PGOA 3L75E 1QLBC 1KILD 3AEED 4YXWH 1PGPA 3TGUJ 2L91A 1QVFO 1N73C 5K5GB 5AVTB 1JY2N 1NTZJ 1PFIA 1IFPA 1JEKA 3V2NA 4R4LA 3P32A 4DHZA 1GL2A 2O1KA 1DD4A 3GMAA 5CCHA 3HE5B 2KS1A 4KJMA 5KAFE 1L4AB 1L0LE 3GG2A 1SQBG 3CCSP 2JP3A 2QA4P 2YKPA 1GK6A 1GU4A 2OYIA 5KAFH 2H7HA 1HBWA 2W27A 2O3JA 4MN4C 3H25A 5KLIC 2ZT9C 3AEFD 5APSA 1OFCX 3P4PD 5AVXB 2GA1A 1NH4A 4H44C 4PV1C 1FDOA 3GF7A 2IYPA 3QH9A 4WBAA 2GUSA 2VRSA 1LT1A 1FZFA 4I1LA 4HJGH 1H88A 1H0TB 3RL0g 1U7JA 3H1KE 2W83C 2D2CB 4BXLA 1LTJC 1CW5A 5CCHC 1AVOA 1MFTA 5KTBA 3AEGC 1A02F 3EWKA 3KQGA 1NWQA 3H1LG 4L75A 2OYIC 1S5LX 5DJUB 1NTKG 1BE3G 2YNYA 4YT0D 4I6MC 2HODA 4YSXD 2C0WA 5AVSB 1MZ9A 2FBWD 3BCCG 4GOFA 1K73Q 4NPDA 2E75C 1FZBA 2A06D 5BVZA 3FXEA 3AEBC 2I1KA 5CCGA 3L75G 1BGYE 4WWIA 3II6A 4EYYQ 1Q81Q 4OH8B 1LTIC 5KJ7A 4OWFA 1NENC 1ZP0C 2QEXP 1AV1A 4YXDC 1SQXJ 2Q6QA 1IFJA 1GZLA 1J1DC 3AE9C 1NTMK 4R4MA 4YTMD 1K8AQ 2LKMA 1T2KC 3RK2C 3CI9A 1L0LG 1OX3A 1YJ9P 1LTGC 4RESB 5AW5B 4B86A 3TDKA 1R8EA 2IFMA 2IFNA 4UB6E 1PP9D 1ZMEC 3LW5J 1FOSE 3TNUB 5CCGC 2A45H 1RF1A 2Y9ZA 2K3RA 1YHQP 3TK1A 3CPWO 2BS3C 5KJ7C 3P4SC 5EFWB 3VMAA 1OW7A 2GM4A 3IFMA 5KKZB 3B71A 4DCKA 3V5BA 1WT6A 1S4XA 2ACZD 3RK3B 4I2LC 3AEAC 3JCUH 2WU5D 2ZT9B 5AW1B 2BASA 4H44B 2KOGA 2B89A 3GHGA 1P84H 2IYOA 2KSEA 1H8AA 3AE7D 1YBKA 2M3BA 1ZOYC 4H13C 1URQD 1GL2B 3CCMP 1SFCC 1Q7YQ 2QJKC 2QM8A 1T3JA 2R44A 1FZAA 2YIUB 4YPCA 1DEBA 2QJYC 4CPGA 1K05A 2XKMA 1BGYG 1OVUA 3FXDA 3AE2C 1NTMD 1WRGA 3AE3D 3F5HA 1YYCA 3RK3E 3VRBC 2QRXA 1OWAA 1LTAC 2Q5UA 3EFGA 1LWUC 4TLFA 5H2FE 3PTZA 3JSVC 2KSJA 3C8VA 1FOSF 1SQVE 1M1JA 1YIJP 3CXHD 4N6JA 3GHGC 1S5LH 1PP9J 1SQPK 3EQ2A 1QL2A 2KK7A 3H1HE 2LXBA 1USDA 5AW6B 2A06E 3HD7D 1KB9D 2Y0DA 2AXTH 2JDIH 3KDPB 2IDBA 1NTZK 3MHVA 2P2UA 4OGQD 1KFMA 1N7SC 2FYUE 3MIWA 3VRAC 2YMKA 2Z5HA 1QGKB 2KLVA 1FDMA 4YSZC 3HE5A 1GW4A 1EDKA 2WQYC 1Q2NA 1AQ5A 2WDVD 5CJ4A 1K9MQ 1VQNP 4JBZA 2P1JA 2N1TA 1L2PA 2HYNA 1DIPA 1X8YA 4C7RA 3C9IA 1FDIA 4H0LD 4JF7A 2Q1KA 3H1ID 1E7PC 1SS1A 1AJYA 4O9BA 1PGJA 3CMAP 1VF5D 3O8ZA 3GF3A 1KFYD 1NTMJ 3A2AA 4YSYC 1T3UA 2J59M 3V2RA 1PGQA 1KTMA 2M0BA 2E43A 1L4AC 5AW7B 3M9QA 3Q5PA 1IK9A 5CBOA 3B5NA 4WB4A 3ABVC 3P7KA 3RBXA 1SQPD 5APQA 2OYHA 1TU3F 1KILA 1FU1A 1GD2E 3FGAD 1LNQA 3CIRC 3VMXA 4HKZH 3L36A 1RF1B 3HD7B 1N2DC 3BRVB 3MP7B 2W6BA 2K37A 1SQBE 3V4WA 3MGNA 2WP9D 3VP9A 4AYCA 1YI2P 2A06G 1NAYA 5C2TC 4JYBA 3KXDA 1EDJA 4HYTB 3SFDD 2D2CC 2L5GB 3P8MC 2QSIA 1SLQA 2Q9IA 4HH2A 3OJAB 2H89D 2OGUA 4AQRD 1SQXK 2N1TD 5B66E 2QJPC 2CPBA 1FC2C 1EXJA 3A5TA 1TFFA 3GLMA 3VR8C 3NFQA 1BSNA 3H1JD 3NMDA 3HUSA 3CCLP 2XDJA 3AEEC 4H0LB 1MV8A 2ZAEB 2XNDH 5KLVE 1RF0C 5APTA 2E76D 3P4QC 1VF5B 1SQQK 3L37A 2JEEA 2Y0CA 2ZJSE 3L70D 1HUCA 3H1LE 1NOHA 3M9BA 3L72D 4KX6D 1M8OB 3D6YA 3K5BA 1Q90D 2RH0A 3BCCE 2Y9YA 1YJNP 3TSIA 1M1JB 2Q3EA 2KUBA 2HFED 3MZWB 3A0BH 1IO4A 1SQPJ 4WY4D 1OXZA 1L0ND 2HPCB 1FZCA 4NPEA 1VL2A 4L74A 2NZ2A 3N4XA 3OW2O 5APVA 1VQLP 1MFZA 2AXCA 3BATA 2H8PD 1U57A 2E74D 4DDIA 3H1IE 2FFDA 2KIKA 1X22A 3CXHI 2BCCD 1RE3A 2MKVA 1G1JA 1EQ7A 1G2CA 1SQXD 4YTPD 5E79E 5KKZC 1KB9I 3RK3C 3G6EP 2N1TB 1IFIA 3WUTA 1P84D 3FWLA 1HGVA 4PD4D 1ZN5A 1QL1A 3H1JJ 3CCEP 3BASA 2WSCJ 3EFFK 4YSXC 2N9YB 3M06A 4L73A 3C1LA 2KLUA 2M5AA 2FBWC 1CSBA 3A0HE 3TGUE 1OW6A 1GMJA 1KYOE 2B76D 3D71A 3VOPA 1J2JB 1XTGB 1NTZE 1JCDA 5TISE 1GL2C 1SQQD 1NU1K 3L70J 2E76B 1VQ6P 3AE1D 3L72J 1EZVD 2YIUC 5KLVG 3CX5D 5TISH 2WS3D 1L0VC 2QJPB 3B5NB 4L76A 1N86A 1KC8Q 1NVOA 3F89A 2R32A 3E1IA 5GTIE 4DHIB 3U1AA 4DT0A 4D6TJ 5AVQB 1L0NJ 2BEQD 2OYHB 3V2QA 2WDRD 3Q5RA 1KILB 3VTPC 4WY4B 4DDGA 2E42A 4ASWA 2H43A 1NO4A 1KQFB 1OW8A 5GTIH 1VQPP 2XNXA 1LJ2A 2P58A 4Y99B 1D7MA 4PV1D 4NPFX 4U3FD 1JO5A 1URQA 5L8RJ 2K9JA 1RE4A 2H88D 2Z5IA 2M8RA 2E74B 1NAFA 3UIAA 2BCCJ 2RN0A 3BVHA 3D6ZA 2FXOA 1VQ5P 4W80A 1H89A 4ZMDA 3H1IG 3VMZA 1LTSC 1KYOI 3A3YB 1JM0A 1YITP 3KZIE 3IAOA 2ZYGA 4ZKUA 3MTUE 2WU5C 3QWOC 2WZ7A 1HWTC 2ZVOB 3WU2E 3HUSB 1KILE 1DD3A 3AE8C 3AE5C 4N78D 3KZIH 1FJKA 1X0TA 1NKZB 2W6AA 2WPRA 3AE4D 3Q1MA 2E75D 3V2PA 3AEBD 3S4RA 3WU2H 3KPEA 1GK4A 1SQQJ 1NU1D 4UB6H 1GU5A 3HD7A 2G8YA 3PP5A 2O01N 2YKQA 1ZXGA 4JYCA 3RL0D 2JWDA 3TGUG 1PZQA 2HR3A 2YO3A 1LGHB 1NEND 1ZP0D 2RKLA 1NTZG 4HB1A 2WPVB 3L74D 5AVVB 5CBNA 2R3CA 2FYNB 2QIWA 2P7JA 1SQXE 3PRJA 2WSFH 4IL6X 1CI6A 4GOEA 3JC22 1T2KD 1FZCB 2K88A 4AUWA 3TF5A 3L73J 1IFDA 2NRGA 1KMIZ 2BS2C 4KT0J 4U3FJ 3U1CA 3M0DA 1M56D 3MD0A 3CLQA 2W6JH 3AECC 1ZRTD 1VQ9P 1BCCJ 2FFDB 3G4SP 4BRYA 1EDLA 1RF1C 3HD7C 1EDIA 1DH3A 4UB8E 1S9KD 1G2CB 1RQUA 3AE6D 3P4SD 4K35A 1JY3P 5AW8B 3VP8A 2FXMA 1R5LA 3CX5E 2Z4EA 3AEAD 3PH0A 4UB8H 2A45I 1YQ3C 2V7QH 4W7YA 3CD6P 3L70G 2O1JA 2YMYA 2HPCA 2WDVC 2K9YA 3CWBD 2SPZA 2M5AB 5H2FH 3VONA 1VQMP 1ZOYD 4H13D 2IBZD 1W2BO 1VQ8P 1NU1J 4GODA 3M0DC 1MKMA 1SFCD 1T8ZA 1M7LA 1S2EA 4H0LC 2XV5A 5AVUB 4BWNA 2B9BA 4N3YB 1HF9A 4PD4I 5APUA 3OAKA 3L74J 2N9BA 3FWNA 1JMMA 5GTHE 3VMYA 1VF5C 3SFEC 2WSEH 5AVWB 2G3AA 2AEMA 1HJ0A 1KFYC 1BE3D 3A7OA 3P8CD 3CC2P 3VRBD 3L71D 4RJTA 2BCCG 3U59A 1M1JC 3AEDD 1SQXG 3SWKA 1EZVI 1JY2P 3L75D 1URQB 1ZV8A 2K9JB 2WT7A 1PP9E 1YTZI 2QM7A 3B4SA 3CX5I 5B5EE 3ITKA 2JJLA 2IX7C 2FY8A 2POHA 1KORA 2ZFCA 5TJHA 3HE4A 5AVRB 2C9NY 4JPZB 5B5EH 1S3JA 2R5DA 2FXPA 2OARA 1N7SD 4WVZA 2WP9C 2FKWB 3PJSK 3CCRP 4DOJA 4IL6E 4YTNC 1YJWP 1YQ4C 1SQQG 3S9OA 3SFDC 1DEEG 4OVNF 1RH5B 1EZVG 2H89C 3CWBJ 3HTKB 1R5SA 4IL6H 1KQGB 1L0NK 4WY4A 2N1TC 3H6PA 5KAIE 1HH0A 1MUUA 3SWFA 3B8EB 4OGQB 5C39A 5KAIH 4JQ0D 3H1KD 3V6IA 2E76C 2KYVA 3N7NA 2O01J
chains in the Genus database with same CATH topology
3AE3C 3AEEC 4H0LB 1ZMEC 3AEDD 3O6QA 3GF3A 5C3JC 1KFYD 3LW5J 2D2CB 1KF6C 2B76C 4YSYC 1ZRTE 3C8VA 3P4QD 1Y9BA 2WU2C 1EXIA 3AE2D 1PL5A 1UIXA 1KTMA 2WSCJ 3Q3DA 2E76D 3IAOA 4YSXC 3AE4C 3AE1C 1VF5B 3IN6A 1RQUA 3Q5PA 1NEKC 1QLBC 2WDQD 3ABVD 3AE6D 3P4SD 3AE8D 2J5UA 2WU5C 3AE5D 3AEGC 4PV1B 3AEED 2FBWC 1NGMB 1KORA 1OW6A 5C3JD 1YQ3D 1GMJA 3EWKA 2JO1A 1KF6D 2B76D 2BS3C 4YSYD 3ABVC 3D71A 1KILE 3P4SC 1DD3A 3AE8C 3VR9C 2FYNC 4KX6D 3AE5C 2WS3C 2WU2D 3AEAD 1OW7A 1YQ3C 3D6YA 1Q90D 1S5LX 2FXPA 3B71A 2IDBA 4YT0D 3CIRD 2E76B 4YSXD 1TU3F 3AE4D 3AE1D 1IK7A 2ACZD 4R4LA 3Q1MA 1NEKD 2WSFJ 2E75D 1WMKA 3AEAC 3D70A 1YQ4D 4KX6C 2WU5D 3FGAD 3AEBD 3AEGD 1L0VD 4OGQD 2FBWD 2ZT9B 2YIUC 4YT0C 1DD4A 5M1BA 3CIRC 2WDRC 3VRAC 2WSEJ 2ACZC 2YMKA 2OQQA 4YTNC 2E75C 1YQ4C 3GMAA 3VR9D 2WDVC 4H44B 2G8YA 2K9YA 3AEBC 2WS3D 1L0VC 4OGQC 4YSZC 3S9OA 4Z1MH 3SFDC 2E74C 1PV3A 1VL2A 1ZOYD 2WP9D 4H13D 5C2TD 4H44D 3G9RA 3AE7D 2H89C 1NEND 2NZ2A 2WQYC 4I7ZC 1ZP0D 2BEQD 2JP3A 3P4RC 1KQGB 2WDRD 2BEZF 1MKMA 2D2CD 1ZOYC 3Q5RA 4H13C 3VRAD 5C2TC 2WPVB 4GDOA 2WDVD 4TT3H 3P4QC 3AE7C 4U7JA 1NENC 1ZP0C 2H88C 4YSZD 4H0LC 1U57A 3T97B 2QIWA 4XFJA 3Q2YA 3SFDD 2D2CC 2E74D 1KQFB 1OW8A 1HF9A 2WP9C 4YXDC 2QSIA 1OMIA 4Y28J 3SFED 3Q5SA 3R4YA 1DIPA 2QJKC 3H25A 1JB0J 5KLIC 4PV1D 4RKUJ 2H89D 2WQYD 4IL6X 2ZT9C 3AEFD 3VRBC 2QJYC 3P4RD 3P4PD 1RQVA 1VF5C 1K05A 3AE9C 3SFEC 5L8RJ 4R4MA 2E75B 1FDIA 4H44C 4PV1C 2MKVA 2H88D 2QJPC 1FDOA 4H0LD 2G3AA 4OGQB 3VR8D 3AEFC 1HJ0A 3AEDC 3GF7A 4YTMD 1KFYC 3P4PC 2E74B 1PIXA 4YTND 4YXDD 1EXJA 1KMIZ 1S1CX 1E7PC 2BS2C 3AECD 4YTPD 4KT0J 2V7QJ 1AJYA 1NYHA 3GLMA 3VRBD 3AE2C 2BS4C 3VR8C 3AE3D 5KKZC 4YTMC 2ZT9D 4I7ZB 1R8EA 1K04A 2E76C 3AE9D 1VF5D 3RL0g 3D6ZA 4H13B 3AECC 4YTPC 3AE6C 3RK3E 2WDQC 2P10A 2O01J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AE3 C;  3AEE C;  5C3J C;  3AED D;  1KFY D;  1KF6 C;  2B76 C;  4YSY C;  3P4Q D;  2WU2 C;  3AE2 D;  1KTM A;  4YSX C;  3AE4 C;  3AE1 C;  1QLB C;  3ABV D;  3P4Q C;  1NEK C;  3AE6 D;  2WDQ D;  3P4S D;  3AE8 D;  2WU5 C;  3AE5 D;  3AEG C;  3AEE D;  2FBW C;  1OW6 A;  5C3J D;  1YQ3 D;  1KF6 D;  2B76 D;  2BS3 C;  4YSY D;  3ABV C;  3P4S C;  3AE8 C;  3VR9 C;  4KX6 D;  3AE5 C;  2WS3 C;  2WU2 D;  3AEA D;  1OW7 A;  1YQ3 C;  3B71 A;  4YT0 D;  3CIR D;  4YSX D;  3AE4 D;  3AE1 D;  2ACZ D;  2WP9 C;  4YTN D;  1NEK D;  4KX6 C;  3AEA C;  1YQ4 D;  2WU5 D;  3AEB D;  3AEG D;  1L0V D;  2FBW D;  4YT0 C;  3CIR C;  2WDR C;  3VRA C;  2ACZ C;  4YTN C;  1YQ4 C;  3VR9 D;  2WDV C;  3AEB C;  2WS3 D;  1L0V C;  4YSZ C;  3S9O A;  3SFD C;  1PV3 A;  1ZOY D;  2WP9 D;  5C2T D;  3AE7 D;  2H89 C;  1NEN D;  1ZP0 D;  2WQY C;  3P4R C;  2WDR D;  3VRA D;  1ZOY C;  5C2T C;  2WDV D;  3AE7 C;  1NEN C;  1ZP0 C;  2H88 C;  4YSZ D;  3SFD D;  1OW8 A;  4YXD C;  3SFE D;  2H89 D;  2WQY D;  3AEF D;  3P4R D;  3P4P D;  3AE9 C;  3SFE C;  1K05 A;  2H88 D;  2G3A A;  3VR8 D;  3AEF C;  3AED C;  4YTM D;  1KFY C;  3P4P C;  4YXD D;  2BS2 C;  1E7P C;  3AEC D;  4YTP D;  3VRB D;  3AE2 C;  2BS4 C;  3VR8 C;  3AE3 D;  4YTM C;  1K04 A;  3AE9 D;  3AEC C;  4YTP C;  3AE6 C;  2WDQ C;  3VRB C; 
#chains in the Genus database with same CATH topology
 1NTM E;  1LT9 B;  3VN0 A;  1NTK J;  1BE3 J;  4QMA A;  1CI6 B;  3O6Q B;  3CL3 D;  1HGZ A;  3L71 J;  3H32 B;  4EIJ A;  3B5N C;  1J1E B;  2NPS D;  3ABV D;  3L75 J;  2WPS A;  2YXR B;  1NGM B;  1PPJ D;  5DJT B;  5C3J D;  3CXH E;  2OYH C;  4W7Z A;  1A02 J;  2CPS A;  1M57 D;  1IFN A;  5B66 H;  1KIL C;  4WY4 C;  5AVY B;  3CIR D;  2C9L Y;  4BRY B;  1NEK D;  2IBZ E;  4Y99 C;  1KB9 E;  1UII A;  1N73 A;  1OIP A;  3CXH H;  5AW0 B;  3S1K A;  1EC5 A;  1BGY D;  1YTZ T;  1JY3 O;  1ZW0 A;  1FZG A;  1PP9 G;  3VR9 D;  1FE6 A;  4K3A A;  4Z1M H;  4XA4 A;  2E74 C;  3V4Q A;  1KB9 H;  5C2T D;  1HVV A;  3W67 A;  2QG4 A;  2KI7 B;  2D2C D;  1L0L J;  4GDO A;  4XFJ A;  4D6T D;  2PGD A;  2QE7 H;  1X79 B;  3L74 G;  3P4R D;  3G71 P;  3LIE A;  2HLO A;  3VR8 D;  3AEF C;  4IFF A;  3P4P C;  3HUS C;  1SQV K;  5CJ0 A;  1LTB C;  1KFN A;  1VQO P;  3E7K A;  3GW6 A;  2IPP A;  3I55 P;  3CME P;  2Q7C A;  3H1K J;  2B76 C;  3BRT B;  3SWY A;  1LTT C;  3M0A A;  3P4Q D;  1SVF A;  2YKO A;  1Q82 Q;  3AE1 C;  3IN6 A;  2YXQ B;  2WDQ D;  2FYU K;  1LTJ A;  2IBZ I;  5AW3 B;  1KF6 D;  1AA0 A;  1S72 P;  2FYN C;  2WU2 D;  2WS3 C;  1JY2 O;  2LXC B;  2KB7 P;  2NPS B;  4IOI H;  1NTM G;  3CCU P;  5APX A;  5E79 H;  2WT7 B;  1IC2 A;  1SQP E;  3T97 A;  4YT0 C;  1VQK P;  1X9V A;  2WDR C;  1FZC C;  3CCV P;  4EOT A;  1JTH A;  4DHJ A;  3HE4 B;  2AEJ A;  1SP4 A;  2CK3 H;  1BGY J;  1BDC A;  5AW9 B;  1GW3 A;  5AW4 B;  3CWB G;  2Y0E A;  3A0H H;  1KYO H;  2H88 C;  2FFD C;  2IBZ G;  1XTC C;  3R2P A;  1RE3 C;  2R5B A;  4RKU J;  3OA7 A;  3I56 P;  3L35 A;  1BSH A;  2OTJ P;  2WIT A;  4GKG A;  3RK3 D;  2HG5 D;  2YO2 A;  4YTM C;  2ZT9 D;  1RHZ B;  2PRR A;  4I7Z B;  3WMM 0;  4H44 D;  1SQV D;  4ASV A;  3L73 D;  1PPJ E;  3H1J E;  3E1R A;  2WWW A;  1Y9B A;  3L71 G;  3H1H D;  1PL5 A;  1BCC D;  3AE4 C;  2C0X A;  3IF4 A;  1GL2 D;  1AFO A;  2WSC H;  3L70 E;  2IZ0 A;  5CCH D;  1JMB A;  1SQB K;  1USE A;  5AVZ B;  2FYU D;  3L72 E;  3RL0 C;  2WSF J;  1FZE A;  3AEG D;  1L0V D;  2ACZ C;  2OQQ A;  1RY3 A;  3FX0 A;  2P67 A;  4D6T E;  1L0N E;  4LLH A;  1BDD A;  3HTK A;  2KNC A;  4EI2 A;  4IFD K;  2FYZ A;  4TT3 H;  3USS A;  3AE7 C;  1N73 B;  1Z56 A;  3WUU A;  5BU8 B;  1URQ C;  1SQP G;  1RE4 C;  1QEX A;  2GUV A;  1HTL C;  2JWA A;  4ZNC A;  2PFX A;  1SFC A;  3KYQ A;  2V4H A;  2XZR A;  4RO0 A;  1FS0 E;  1LP1 B;  1N7L A;  3G3Z A;  1PIX A;  5KLV K;  4YXD D;  2BCC E;  1GTW A;  1KD1 Q;  2V7Q J;  3PHL A;  3JCU E;  1QVG O;  3AE9 D;  3AE6 C;  2ZYA A;  1LT9 A;  3AE3 C;  1VDF A;  1NTK K;  3O6Q A;  3PLN A;  3H32 A;  3RK2 D;  3H1K G;  4C7N B;  1P84 E;  2XU6 A;  4PD4 E;  5KLI B;  1UIX A;  4DJG A;  1AVY A;  1SQV J;  1LWU A;  1ZR2 A;  2B87 A;  1T6A A;  3AE8 D;  3AE5 D;  4PV1 B;  2WMM A;  2JO1 A;  3H1H J;  3KHU A;  4DZO A;  4PD4 H;  3HRN A;  5CCG D;  4LC1 A;  3CCJ P;  4FJV A;  1W5C E;  1IK7 A;  1NHL A;  1PPJ G;  3H1J G;  1FAV A;  1SQQ E;  4LGD E;  5M1B A;  2WSE J;  1SQB D;  5KJ7 D;  1N8R Q;  2FYU J;  3LW5 H;  2IZ1 A;  4OGQ C;  1EZV E;  1LTJ B;  5CHX A;  1N7S A;  4ZKP A;  2KS1 B;  5APW A;  2PP6 A;  3G9R A;  2RMZ A;  4PJ0 E;  1L0L K;  2KZJ A;  3VYI A;  1LT9 C;  2OYI B;  3T97 B;  3L72 G;  3CX5 H;  3M91 A;  1S5L E;  5AW2 B;  3Q5S A;  2M3E A;  1J1E C;  1JTH B;  4PJ0 H;  2JKV A;  1GDT A;  2E75 B;  3LID A;  2OTL P;  3NXS A;  3L73 E;  3AED C;  4D6T G;  2AXT E;  3CC7 P;  4U3F E;  1L0N G;  1G1I A;  3AEC D;  1VQ4 P;  3RGU A;  1P84 I;  1K04 A;  1BCC E;  2K1A A;  3RL0 B;  2P10 A;  5KLV D;  4LDT A;  4GT1 A;  1CZQ A;  2A45 G;  4M3L A;  2OTK E;  1EXI A;  3AE2 D;  1OVV A;  2ZXE B;  2WPQ A;  2LR2 A;  3H1L D;  1J1D B;  1NTK D;  1QLE D;  2WVR A;  5GTH H;  1YQ3 D;  3BCC D;  3TYY A;  2QVA A;  1L4A A;  3RK2 B;  3L4F A;  1HJB A;  1KQL A;  2ZXX A;  1IZN B;  2NPS A;  2HOD B;  3D70 A;  4N78 E;  2I8D A;  2E5Y A;  2AEF A;  2ZFY A;  3W68 A;  1NU1 E;  1FBM A;  2ZVN B;  1VPC A;  1SQB J;  2WTY A;  3VRA D;  4U7J A;  4YSZ D;  3Q2Y A;  3M9H A;  1H0T A;  3L74 E;  3SFE D;  3CC4 P;  3R4Y A;  2DW3 A;  1L0L D;  2WQY D;  1Y47 A;  2B88 A;  2PAJ A;  2KXP B;  3MUD A;  3ZDM A;  5BU5 A;  1Y8A A;  2KNC B;  4I6L A;  1M1K Q;  1S1C X;  1KQS O;  1NYH A;  2BS4 C;  1VQ7 P;  2NPS C;  4XE5 B;  1IJD B;  4H13 B;  1AQT A;  2I1J A;  5C3J C;  3CCQ P;  1SFC B;  1ZRT E;  1QX8 A;  2QJK B;  1W2E A;  2WSS H;  4KHX A;  5KLV J;  3TGU D;  3Q3D A;  1KYO D;  4A7P A;  2QJY B;  1SQV G;  4C46 A;  1NEK C;  3L73 G;  2J5U A;  2UWJ E;  4EDF A;  1NTZ D;  1RF0 A;  4U3F G;  1S9K E;  4YSY D;  3I5C A;  3H1L J;  1ZR4 A;  1KN7 A;  3H1H G;  3VR9 C;  1BCC G;  4IFM A;  1L4A D;  4YTN D;  4KX6 C;  3WUV A;  3BCC J;  1WMK A;  1YQ4 D;  2OYO A;  1LWU B;  1JY3 N;  2B87 B;  1NKN A;  3MUD C;  3NTN A;  2E5T A;  2FYU G;  3GHG B;  1PV3 A;  1JCC A;  3CWB E;  5CMZ A;  2J58 A;  4I7Z C;  2W90 A;  3P4R C;  2BEZ F;  2W8Z A;  1M90 Q;  1DX7 A;  1OMI A;  4Y28 J;  4GIF A;  1JB0 J;  1JNM A;  2KZI A;  1E79 H;  3H1I J;  1FJP A;  1N7S B;  3SSU A;  1RQV A;  1OZH A;  1NJI Q;  2ZYD A;  3TNU A;  1NU1 G;  1LP1 A;  1E5W A;  2KP8 A;  1OVR A;  2R3S A;  2JR8 A;  1IFM A;  2MJZ A;  1KV4 A;  1NTK E;  1BE3 E;  3A0B E;  4YTP C;  1U7M A;  2WDQ C;  3P8C E;  3IR9 A;  1ZLL A;  3B5N D;  3L71 E;  5APY A;  1JUN A;  1KF6 C;  4C7N A;  1Q86 Q;  2ITA A;  2WU2 C;  3RBZ A;  1JOC A;  2O01 H;  2Q3I A;  1KZU B;  1PGO A;  3L75 E;  1QLB C;  1KIL D;  3AEE D;  4YXW H;  1PGP A;  3TGU J;  2L91 A;  1QVF O;  1N73 C;  5K5G B;  5AVT B;  1JY2 N;  1NTZ J;  1PFI A;  1IFP A;  1JEK A;  3V2N A;  4R4L A;  3P32 A;  4DHZ A;  1GL2 A;  2O1K A;  1DD4 A;  3GMA A;  5CCH A;  3HE5 B;  2KS1 A;  4KJM A;  5KAF E;  1L4A B;  1L0L E;  3GG2 A;  1SQB G;  3CCS P;  2JP3 A;  2QA4 P;  2YKP A;  1GK6 A;  1GU4 A;  2OYI A;  5KAF H;  2H7H A;  1HBW A;  2W27 A;  2O3J A;  4MN4 C;  3H25 A;  5KLI C;  2ZT9 C;  3AEF D;  5APS A;  1OFC X;  3P4P D;  5AVX B;  2GA1 A;  1NH4 A;  4H44 C;  4PV1 C;  1FDO A;  3GF7 A;  2IYP A;  3QH9 A;  4WBA A;  2GUS A;  2VRS A;  1LT1 A;  1FZF A;  4I1L A;  4HJG H;  1H88 A;  1H0T B;  3RL0 g;  1U7J A;  3H1K E;  2W83 C;  2D2C B;  4BXL A;  1LTJ C;  1CW5 A;  5CCH C;  1AVO A;  1MFT A;  5KTB A;  3AEG C;  1A02 F;  3EWK A;  3KQG A;  1NWQ A;  3H1L G;  4L75 A;  2OYI C;  1S5L X;  5DJU B;  1NTK G;  1BE3 G;  2YNY A;  4YT0 D;  4I6M C;  2HOD A;  4YSX D;  2C0W A;  5AVS B;  1MZ9 A;  2FBW D;  3BCC G;  4GOF A;  1K73 Q;  4NPD A;  2E75 C;  1FZB A;  2A06 D;  5BVZ A;  3FXE A;  3AEB C;  2I1K A;  5CCG A;  3L75 G;  1BGY E;  4WWI A;  3II6 A;  4EYY Q;  1Q81 Q;  4OH8 B;  1LTI C;  5KJ7 A;  4OWF A;  1NEN C;  1ZP0 C;  2QEX P;  1AV1 A;  4YXD C;  1SQX J;  2Q6Q A;  1IFJ A;  1GZL A;  1J1D C;  3AE9 C;  1NTM K;  4R4M A;  4YTM D;  1K8A Q;  2LKM A;  1T2K C;  3RK2 C;  3CI9 A;  1L0L G;  1OX3 A;  1YJ9 P;  1LTG C;  4RES B;  5AW5 B;  4B86 A;  3TDK A;  1R8E A;  2IFM A;  2IFN A;  4UB6 E;  1PP9 D;  1ZME C;  3LW5 J;  1FOS E;  3TNU B;  5CCG C;  2A45 H;  1RF1 A;  2Y9Z A;  2K3R A;  1YHQ P;  3TK1 A;  3CPW O;  2BS3 C;  5KJ7 C;  3P4S C;  5EFW B;  3VMA A;  1OW7 A;  2GM4 A;  3IFM A;  5KKZ B;  3B71 A;  4DCK A;  3V5B A;  1WT6 A;  1S4X A;  2ACZ D;  3RK3 B;  4I2L C;  3AEA C;  3JCU H;  2WU5 D;  2ZT9 B;  5AW1 B;  2BAS A;  4H44 B;  2KOG A;  2B89 A;  3GHG A;  1P84 H;  2IYO A;  2KSE A;  1H8A A;  3AE7 D;  1YBK A;  2M3B A;  1ZOY C;  4H13 C;  1URQ D;  1GL2 B;  3CCM P;  1SFC C;  1Q7Y Q;  2QJK C;  2QM8 A;  1T3J A;  2R44 A;  1FZA A;  2YIU B;  4YPC A;  1DEB A;  2QJY C;  4CPG A;  1K05 A;  2XKM A;  1BGY G;  1OVU A;  3FXD A;  3AE2 C;  1NTM D;  1WRG A;  3AE3 D;  3F5H A;  1YYC A;  3RK3 E;  3VRB C;  2QRX A;  1OWA A;  1LTA C;  2Q5U A;  3EFG A;  1LWU C;  4TLF A;  5H2F E;  3PTZ A;  3JSV C;  2KSJ A;  3C8V A;  1FOS F;  1SQV E;  1M1J A;  1YIJ P;  3CXH D;  4N6J A;  3GHG C;  1S5L H;  1PP9 J;  1SQP K;  3EQ2 A;  1QL2 A;  2KK7 A;  3H1H E;  2LXB A;  1USD A;  5AW6 B;  2A06 E;  3HD7 D;  1KB9 D;  2Y0D A;  2AXT H;  2JDI H;  3KDP B;  2IDB A;  1NTZ K;  3MHV A;  2P2U A;  4OGQ D;  1KFM A;  1N7S C;  2FYU E;  3MIW A;  3VRA C;  2YMK A;  2Z5H A;  1QGK B;  2KLV A;  1FDM A;  4YSZ C;  3HE5 A;  1GW4 A;  1EDK A;  2WQY C;  1Q2N A;  1AQ5 A;  2WDV D;  5CJ4 A;  1K9M Q;  1VQN P;  4JBZ A;  2P1J A;  2N1T A;  1L2P A;  2HYN A;  1DIP A;  1X8Y A;  4C7R A;  3C9I A;  1FDI A;  4H0L D;  4JF7 A;  2Q1K A;  3H1I D;  1E7P C;  1SS1 A;  1AJY A;  4O9B A;  1PGJ A;  3CMA P;  1VF5 D;  3O8Z A;  3GF3 A;  1KFY D;  1NTM J;  3A2A A;  4YSY C;  1T3U A;  2J59 M;  3V2R A;  1PGQ A;  1KTM A;  2M0B A;  2E43 A;  1L4A C;  5AW7 B;  3M9Q A;  3Q5P A;  1IK9 A;  5CBO A;  3B5N A;  4WB4 A;  3ABV C;  3P7K A;  3RBX A;  1SQP D;  5APQ A;  2OYH A;  1TU3 F;  1KIL A;  1FU1 A;  1GD2 E;  3FGA D;  1LNQ A;  3CIR C;  3VMX A;  4HKZ H;  3L36 A;  1RF1 B;  3HD7 B;  1N2D C;  3BRV B;  3MP7 B;  2W6B A;  2K37 A;  1SQB E;  3V4W A;  3MGN A;  2WP9 D;  3VP9 A;  4AYC A;  1YI2 P;  2A06 G;  1NAY A;  5C2T C;  4JYB A;  3KXD A;  1EDJ A;  4HYT B;  3SFD D;  2D2C C;  2L5G B;  3P8M C;  2QSI A;  1SLQ A;  2Q9I A;  4HH2 A;  3OJA B;  2H89 D;  2OGU A;  4AQR D;  1SQX K;  2N1T D;  5B66 E;  2QJP C;  2CPB A;  1FC2 C;  1EXJ A;  3A5T A;  1TFF A;  3GLM A;  3VR8 C;  3NFQ A;  1BSN A;  3H1J D;  3NMD A;  3HUS A;  3CCL P;  2XDJ A;  3AEE C;  4H0L B;  1MV8 A;  2ZAE B;  2XND H;  5KLV E;  1RF0 C;  5APT A;  2E76 D;  3P4Q C;  1VF5 B;  1SQQ K;  3L37 A;  2JEE A;  2Y0C A;  2ZJS E;  3L70 D;  1HUC A;  3H1L E;  1NOH A;  3M9B A;  3L72 D;  4KX6 D;  1M8O B;  3D6Y A;  3K5B A;  1Q90 D;  2RH0 A;  3BCC E;  2Y9Y A;  1YJN P;  3TSI A;  1M1J B;  2Q3E A;  2KUB A;  2HFE D;  3MZW B;  3A0B H;  1IO4 A;  1SQP J;  4WY4 D;  1OXZ A;  1L0N D;  2HPC B;  1FZC A;  4NPE A;  1VL2 A;  4L74 A;  2NZ2 A;  3N4X A;  3OW2 O;  5APV A;  1VQL P;  1MFZ A;  2AXC A;  3BAT A;  2H8P D;  1U57 A;  2E74 D;  4DDI A;  3H1I E;  2FFD A;  2KIK A;  1X22 A;  3CXH I;  2BCC D;  1RE3 A;  2MKV A;  1G1J A;  1EQ7 A;  1G2C A;  1SQX D;  4YTP D;  5E79 E;  5KKZ C;  1KB9 I;  3RK3 C;  3G6E P;  2N1T B;  1IFI A;  3WUT A;  1P84 D;  3FWL A;  1HGV A;  4PD4 D;  1ZN5 A;  1QL1 A;  3H1J J;  3CCE P;  3BAS A;  2WSC J;  3EFF K;  4YSX C;  2N9Y B;  3M06 A;  4L73 A;  3C1L A;  2KLU A;  2M5A A;  2FBW C;  1CSB A;  3A0H E;  3TGU E;  1OW6 A;  1GMJ A;  1KYO E;  2B76 D;  3D71 A;  3VOP A;  1J2J B;  1XTG B;  1NTZ E;  1JCD A;  5TIS E;  1GL2 C;  1SQQ D;  1NU1 K;  3L70 J;  2E76 B;  1VQ6 P;  3AE1 D;  3L72 J;  1EZV D;  2YIU C;  5KLV G;  3CX5 D;  5TIS H;  2WS3 D;  1L0V C;  2QJP B;  3B5N B;  4L76 A;  1N86 A;  1KC8 Q;  1NVO A;  3F89 A;  2R32 A;  3E1I A;  5GTI E;  4DHI B;  3U1A A;  4DT0 A;  4D6T J;  5AVQ B;  1L0N J;  2BEQ D;  2OYH B;  3V2Q A;  2WDR D;  3Q5R A;  1KIL B;  3VTP C;  4WY4 B;  4DDG A;  2E42 A;  4ASW A;  2H43 A;  1NO4 A;  1KQF B;  1OW8 A;  5GTI H;  1VQP P;  2XNX A;  1LJ2 A;  2P58 A;  4Y99 B;  1D7M A;  4PV1 D;  4NPF X;  4U3F D;  1JO5 A;  1URQ A;  5L8R J;  2K9J A;  1RE4 A;  2H88 D;  2Z5I A;  2M8R A;  2E74 B;  1NAF A;  3UIA A;  2BCC J;  2RN0 A;  3BVH A;  3D6Z A;  2FXO A;  1VQ5 P;  4W80 A;  1H89 A;  4ZMD A;  3H1I G;  3VMZ A;  1LTS C;  1KYO I;  3A3Y B;  1JM0 A;  1YIT P;  3KZI E;  3IAO A;  2ZYG A;  4ZKU A;  3MTU E;  2WU5 C;  3QWO C;  2WZ7 A;  1HWT C;  2ZVO B;  3WU2 E;  3HUS B;  1KIL E;  1DD3 A;  3AE8 C;  3AE5 C;  4N78 D;  3KZI H;  1FJK A;  1X0T A;  1NKZ B;  2W6A A;  2WPR A;  3AE4 D;  3Q1M A;  2E75 D;  3V2P A;  3AEB D;  3S4R A;  3WU2 H;  3KPE A;  1GK4 A;  1SQQ J;  1NU1 D;  4UB6 H;  1GU5 A;  3HD7 A;  2G8Y A;  3PP5 A;  2O01 N;  2YKQ A;  1ZXG A;  4JYC A;  3RL0 D;  2JWD A;  3TGU G;  1PZQ A;  2HR3 A;  2YO3 A;  1LGH B;  1NEN D;  1ZP0 D;  2RKL A;  1NTZ G;  4HB1 A;  2WPV B;  3L74 D;  5AVV B;  5CBN A;  2R3C A;  2FYN B;  2QIW A;  2P7J A;  1SQX E;  3PRJ A;  2WSF H;  4IL6 X;  1CI6 A;  4GOE A;  3JC2 2;  1T2K D;  1FZC B;  2K88 A;  4AUW A;  3TF5 A;  3L73 J;  1IFD A;  2NRG A;  1KMI Z;  2BS2 C;  4KT0 J;  4U3F J;  3U1C A;  3M0D A;  1M56 D;  3MD0 A;  3CLQ A;  2W6J H;  3AEC C;  1ZRT D;  1VQ9 P;  1BCC J;  2FFD B;  3G4S P;  4BRY A;  1EDL A;  1RF1 C;  3HD7 C;  1EDI A;  1DH3 A;  4UB8 E;  1S9K D;  1G2C B;  1RQU A;  3AE6 D;  3P4S D;  4K35 A;  1JY3 P;  5AW8 B;  3VP8 A;  2FXM A;  1R5L A;  3CX5 E;  2Z4E A;  3AEA D;  3PH0 A;  4UB8 H;  2A45 I;  1YQ3 C;  2V7Q H;  4W7Y A;  3CD6 P;  3L70 G;  2O1J A;  2YMY A;  2HPC A;  2WDV C;  2K9Y A;  3CWB D;  2SPZ A;  2M5A B;  5H2F H;  3VON A;  1VQM P;  1ZOY D;  4H13 D;  2IBZ D;  1W2B O;  1VQ8 P;  1NU1 J;  4GOD A;  3M0D C;  1MKM A;  1SFC D;  1T8Z A;  1M7L A;  1S2E A;  4H0L C;  2XV5 A;  5AVU B;  4BWN A;  2B9B A;  4N3Y B;  1HF9 A;  4PD4 I;  5APU A;  3OAK A;  3L74 J;  2N9B A;  3FWN A;  1JMM A;  5GTH E;  3VMY A;  1VF5 C;  3SFE C;  2WSE H;  5AVW B;  2G3A A;  2AEM A;  1HJ0 A;  1KFY C;  1BE3 D;  3A7O A;  3P8C D;  3CC2 P;  3VRB D;  3L71 D;  4RJT A;  2BCC G;  3U59 A;  1M1J C;  3AED D;  1SQX G;  3SWK A;  1EZV I;  1JY2 P;  3L75 D;  1URQ B;  1ZV8 A;  2K9J B;  2WT7 A;  1PP9 E;  1YTZ I;  2QM7 A;  3B4S A;  3CX5 I;  5B5E E;  3ITK A;  2JJL A;  2IX7 C;  2FY8 A;  2POH A;  1KOR A;  2ZFC A;  5TJH A;  3HE4 A;  5AVR B;  2C9N Y;  4JPZ B;  5B5E H;  1S3J A;  2R5D A;  2FXP A;  2OAR A;  1N7S D;  4WVZ A;  2WP9 C;  2FKW B;  3PJS K;  3CCR P;  4DOJ A;  4IL6 E;  4YTN C;  1YJW P;  1YQ4 C;  1SQQ G;  3S9O A;  3SFD C;  1DEE G;  4OVN F;  1RH5 B;  1EZV G;  2H89 C;  3CWB J;  3HTK B;  1R5S A;  4IL6 H;  1KQG B;  1L0N K;  4WY4 A;  2N1T C;  3H6P A;  5KAI E;  1HH0 A;  1MUU A;  3SWF A;  3B8E B;  4OGQ B;  5C39 A;  5KAI H;  4JQ0 D;  3H1K D;  3V6I A;  2E76 C;  2KYV A;  3N7N A;  2O01 J; 
#chains in the Genus database with same CATH homology
 3AE3 C;  3AEE C;  4H0L B;  1ZME C;  3AED D;  3O6Q A;  3GF3 A;  5C3J C;  1KFY D;  3LW5 J;  2D2C B;  1KF6 C;  2B76 C;  4YSY C;  1ZRT E;  3C8V A;  3P4Q D;  1Y9B A;  2WU2 C;  1EXI A;  3AE2 D;  1PL5 A;  1UIX A;  1KTM A;  2WSC J;  3Q3D A;  2E76 D;  3IAO A;  4YSX C;  3AE4 C;  3AE1 C;  1VF5 B;  3IN6 A;  1RQU A;  3Q5P A;  1NEK C;  1QLB C;  2WDQ D;  3ABV D;  3AE6 D;  3P4S D;  3AE8 D;  2J5U A;  2WU5 C;  3AE5 D;  3AEG C;  4PV1 B;  3AEE D;  2FBW C;  1NGM B;  1KOR A;  1OW6 A;  5C3J D;  1YQ3 D;  1GMJ A;  3EWK A;  2JO1 A;  1KF6 D;  2B76 D;  2BS3 C;  4YSY D;  3ABV C;  3D71 A;  1KIL E;  3P4S C;  1DD3 A;  3AE8 C;  3VR9 C;  2FYN C;  4KX6 D;  3AE5 C;  2WS3 C;  2WU2 D;  3AEA D;  1OW7 A;  1YQ3 C;  3D6Y A;  1Q90 D;  1S5L X;  2FXP A;  3B71 A;  2IDB A;  4YT0 D;  3CIR D;  2E76 B;  4YSX D;  1TU3 F;  3AE4 D;  3AE1 D;  1IK7 A;  2ACZ D;  4R4L A;  3Q1M A;  1NEK D;  2WSF J;  2E75 D;  1WMK A;  3AEA C;  3D70 A;  1YQ4 D;  4KX6 C;  2WU5 D;  3FGA D;  3AEB D;  3AEG D;  1L0V D;  4OGQ D;  2FBW D;  2ZT9 B;  2YIU C;  4YT0 C;  1DD4 A;  5M1B A;  3CIR C;  2WDR C;  3VRA C;  2WSE J;  2ACZ C;  2YMK A;  2OQQ A;  4YTN C;  2E75 C;  1YQ4 C;  3GMA A;  3VR9 D;  2WDV C;  4H44 B;  2G8Y A;  2K9Y A;  3AEB C;  2WS3 D;  1L0V C;  4OGQ C;  4YSZ C;  3S9O A;  4Z1M H;  3SFD C;  2E74 C;  1PV3 A;  1VL2 A;  1ZOY D;  2WP9 D;  4H13 D;  5C2T D;  4H44 D;  3G9R A;  3AE7 D;  2H89 C;  1NEN D;  2NZ2 A;  2WQY C;  4I7Z C;  1ZP0 D;  2BEQ D;  2JP3 A;  3P4R C;  1KQG B;  2WDR D;  2BEZ F;  1MKM A;  2D2C D;  1ZOY C;  3Q5R A;  4H13 C;  3VRA D;  5C2T C;  2WPV B;  4GDO A;  2WDV D;  4TT3 H;  3P4Q C;  3AE7 C;  4U7J A;  1NEN C;  1ZP0 C;  2H88 C;  4YSZ D;  4H0L C;  1U57 A;  3T97 B;  2QIW A;  4XFJ A;  3Q2Y A;  3SFD D;  2D2C C;  2E74 D;  1KQF B;  1OW8 A;  1HF9 A;  2WP9 C;  4YXD C;  2QSI A;  1OMI A;  4Y28 J;  3SFE D;  3Q5S A;  3R4Y A;  1DIP A;  2QJK C;  3H25 A;  1JB0 J;  5KLI C;  4PV1 D;  4RKU J;  2H89 D;  2WQY D;  4IL6 X;  2ZT9 C;  3AEF D;  3VRB C;  2QJY C;  3P4R D;  3P4P D;  1RQV A;  1VF5 C;  1K05 A;  3AE9 C;  3SFE C;  5L8R J;  4R4M A;  2E75 B;  1FDI A;  4H44 C;  4PV1 C;  2MKV A;  2H88 D;  2QJP C;  1FDO A;  4H0L D;  2G3A A;  4OGQ B;  3VR8 D;  3AEF C;  1HJ0 A;  3AED C;  3GF7 A;  4YTM D;  1KFY C;  3P4P C;  2E74 B;  1PIX A;  4YTN D;  4YXD D;  1EXJ A;  1KMI Z;  1S1C X;  1E7P C;  2BS2 C;  3AEC D;  4YTP D;  4KT0 J;  2V7Q J;  1AJY A;  1NYH A;  3GLM A;  3VRB D;  3AE2 C;  2BS4 C;  3VR8 C;  3AE3 D;  5KKZ C;  4YTM C;  2ZT9 D;  4I7Z B;  1R8E A;  1K04 A;  2E76 C;  3AE9 D;  1VF5 D;  3RL0 g;  3D6Z A;  4H13 B;  3AEC C;  4YTP C;  3AE6 C;  3RK3 E;  2WDQ C;  2P10 A;  2O01 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...