3AE6C

Crystal structure of porcine heart mitochondrial complex ii bound with n-(3-isopropoxy-phenyl)-phthalamicacid
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
138
structure length
138
Chain Sequence
b'TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
molecule tags Oxidoreductase/oxidoreductase inhibitor
publication title Crystal structure of porcine heart mitochondrial complex II bound with N-(3-Isopropoxy-phenyl)-phthalamicacid
rcsb
total genus 43
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3ae6C01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3ae6C02
1KF6C 3AE6D 1OW7A 3AE3C 1E7PC 1ZP0D 3AE9D 1ZOYD 3VR8C 4YTMD 1QLBC 2H89D 3AECC 3AEGD 3AEFD 3AEDC 3AEEC 4YTND 3P4QD 3AEGC 2WDRC 2B76C 2H89C 3SFDC 3AE5C 4YSZD 1K05A 3AE4D 5C2TC 4YT0D 1NEKC 2WDQD 3CIRC 1KFYD 3SFED 2H88D 3SFEC 4YTPD 3AEBC 2WU2C 4YT0C 2WS3D 3AE1D 5C2TD 3AE8D 2G3AA 4YTMC 4YSXD 1ZOYC 3VR8D 3S9OA 5C3JD 3P4PD 3AECD 4KX6C 3ABVD 1NEND 3VRAC 2WDVD 2WP9D 3AE4C 3AE5D 4YSZC 2WDVC 3P4SD 2BS2C 3VR9D 3VRBD 3AE2C 2WDRD 2H88C 4YTNC 2WP9C 4YXDD 4KX6D 3P4PC 2ACZD 2BS4C 2WQYD 4YSYD 3AEAD 3SFDD 1NENC 1ZP0C 3AE6C 2WQYC 4YSYC 3AE8C 2BS3C 2FBWD 3P4QC 4YXDC 3AE7D 4YSXC 3AEDD 3AE1C 1L0VD 2WU5D 3VR9C 3AE9C 3AE3D 1YQ4D 1KF6D 2WDQC 2WS3C 3AE7C 3CIRD 3VRAD 1KTMA 2WU5C 1KFYC 1NEKD 3AEAC 3ABVC 2B76D 2FBWC 3P4RC 5C3JC 1OW6A 1OW8A 3B71A 2ACZC 1PV3A 3AEED 3AEFC 1YQ4C 3P4RD 3AE2D 4YTPC 3VRBC 2WU2D 1YQ3C 3AEBD 3P4SC 1L0VC 1YQ3D 1K04A
chains in the Genus database with same CATH superfamily
2KLUA 4N3YB 3L75E 1ZP0D 2FYUJ 3CWBD 3H1IJ 5KLIB 5GTHE 4YTND 3AEGC 1NTZD 3OA7A 1SQPJ 1NO4A 3SFDC 4U3FE 1K05A 5CJ4A 5AW9B 2P7JA 4DT0A 3P7KA 1BGYD 1M1KQ 4I1LA 4IFMA 3U1AA 3H1IG 1L0LE 1HJ0A 2YKOA 3ABVD 3IN6A 4L74A 4WWIA 4W7ZA 1JTHB 3C8VA 1GL2B 3H32B 3CCJP 2Q3IA 1H88A 1FDOA 4YXDD 5K5GB 5TISH 2YIUB 2OTLP 2XU6A 3CXHE 3S4RA 3IAOA 3HD7A 1J2JB 2Z5IA 5TJHA 1EZVD 2ZYAA 1RE4A 1YJWP 3L71E 1LTBC 3CIRD 2NPSC 1SFCD 3KQGA 1A02J 1IK7A 4DJGA 1EC5A 1OW6A 1M1JB 4ZMDA 2N1TC 2MKVA 1LT9A 2PFXA 2RN0A 5DJUB 3BCCD 5KKZC 4WY4B 2WU2D 1BGYE 4IL6H 2E5TA 2A45G 1T2KD 4YPCA 1RY3A 1PGJA 4ZNCA 1PP9D 1VQ7P 1LP1B 5KLVD 1A02F 1Q2NA 2DW3A 1NWQA 1L4AD 2FXPA 1RF1A 2YKQA 3SFEC 3L73E 4YT0C 1IZNB 4DHJA 1X79B 2ZXEB 5AVZB 4WY4C 1ZRTD 2IZ0A 5APYA 3VP9A 1GMJA 1ZOYC 1FZEA 3P4PD 2RH0A 2B88A 3HE4A 1JMBA 2KI7B 1H89A 3VRAC 5AVXB 3AE4C 1S5LX 2BCCG 1NVOA 3P4SD 1VF5C 1NYHA 1FAVA 1URQD 1QEXA 2D2CB 3O6QB 3D6YA 4PV1C 4ASVA 2JEEA 1LTJB 3NFQA 2IYPA 1HGVA 3V2RA 2WSFJ 3U59A 3PJSK 4GKGA 5APWA 1YQ4D 1JEKA 4W7YA 3O8ZA 3H1IE 2WSSH 2YO3A 3BCCE 1N2DC 1LTIC 1P84D 3S1KA 2QJKB 3HUSA 3V6IA 3H6PA 2IBZD 1IFJA 3E1IA 3EFFK 3H32A 2ZJSE 1GZLA 3V2NA 2BEQD 1VQ8P 1E7PC 5AVRB 1YJ9P 2ZVOB 1NTZJ 3KXDA 3GMAA 4D6TD 1HWTC 3BCCJ 2JO1A 1WMKA 3JCUH 5TISE 1H0TB 2K9JA 3H1ID 4DHZA 1GW3A 3W67A 1H8AA 3IF4A 4U3FJ 3TNUB 1M8OB 3CL3D 3AE1D 3B8EB 3H1KD 2AEJA 1NGMB 1P84E 1G1IA 1SQQD 3L37A 2RKLA 3KZIH 1KB9I 1T3UA 4LGDE 1BE3J 3Q5PA 3E7KA 5APQA 3L74J 1KILD 2J59M 2XV5A 2CPSA 2WSCH 2O01N 1LT9C 5AVWB 1PP9G 1VQ6P 1KILA 1KYOE 1L0LK 2BCCJ 1S1CX 3NTNA 2PAJA 1JY2O 2OARA 1NOHA 3P32A 2E75C 1EXIA 3L75D 1YI2P 4BRYA 1BSNA 3BATA 1NJIQ 5KAIH 1EDJA 4H44B 2W83C 1CI6A 2H8PD 1L2PA 2IYOA 4AQRD 1MFZA 1ZR4A 4PD4D 5CCGA 2P58A 2WTYA 3PTZA 3VMAA 2W6JH 4GT1A 2ACZC 1YTZI 1S9KE 2Y9ZA 2KIKA 2NRGA 2XDJA 2O3JA 4PJ0H 3CCQP 2W27A 1JB0J 2N1TA 1ZV8A 1L4AC 1SQBK 3HUSB 2JR8A 4L76A 1OVRA 2W6AA 3AEFD 3L70E 3T97B 1SFCC 5C2TC 2WWWA 2JWDA 2HFED 3A7OA 1PFIA 1KN7A 4NPDA 2KUBA 3BRTB 1G2CA 1KV4A 1EZVE 2L5GB 3L71G 2E75D 1KD1Q 3P8MC 3S9OA 2AXTH 1K73Q 1R8EA 2WDVD 1RH5B 4YSZC 1HJBA 3H1JE 1SQBJ 2BCCD 2YMYA 4LC1A 3CC4P 3EWKA 3SSUA 5H2FE 1RQVA 1YTZT 2FBWD 2RMZA 3RK2C 5AW8B 4NPFX 1NU1E 2QSIA 2OTJP 1T3JA 2OGUA 4IOIH 3A3YB 3WUUA 3CLQA 1PGPA 1FOSF 2UWJE 4PD4H 3CCVP 1KTMA 2W6BA 1NHLA 1NTKJ 2ITAA 3ABVC 2WVRA 2WPVB 5B66H 3H1KJ 2YXRB 5C3JC 1XTCC 2YIUC 2Q9IA 4K3AA 5AVVB 1PGQA 1M7LA 2K3RA 1FZBA 2K1AA 2Q5UA 1KMIZ 4OGQC 1PPJG 3B5ND 1K04A 3L71D 2OYIC 1FC2C 1SQVD 2Q7CA 2B76C 4DDIA 4KT0J 4C46A 3KYQA 3AE5C 1AVOA 1KYOH 3L72G 3AE4D 3M0DC 3L73J 2WPQA 3L72J 3Q1MA 1VQMP 1EDKA 1VQNP 2K9JB 1NTKK 2N9BA 4BXLA 3A0BE 4I7ZB 2D2CD 2G8YA 2ZYDA 1KFMA 3VMXA 2Q1KA 4GIFA 3VR8D 5KAFE 5CJ0A 1JTHA 3MIWA 1WRGA 2N9YB 2A45H 3K5BA 3CXHI 1W5CE 3L70G 2WP9C 5KLVK 3RK2D 4U3FG 4QMAA 1SQPG 1JOCA 3AE8C 2HYNA 1G1JA 4R4LA 1N7LA 3UIAA 3N4XA 2AEFA 3RGUA 1AVYA 1NEKD 1OZHA 1JY3O 1HBWA 2JDIH 1NTKG 3CI9A 1GU4A 1BSHA 3H1LE 1JCDA 1Y47A 3QH9A 1VL2A 1HH0A 2BASA 3D6ZA 2B87B 2P67A 2Y0EA 5KLVJ 1OW7A 1ZOYD 3H1HJ 3TGUJ 2WPSA 1AA0A 1BCCG 2M5AB 2OYIB 2PGDA 2QE7H 1HF9A 5KLIC 3VMZA 1G2CB 1SQQK 2CK3H 2WITA 1OX3A 5H2FH 1SFCB 1LTGC 2W90A 1FJPA 2WSEH 3RK3C 3AE8D 1MV8A 1PPJD 4YSXD 5AW6B 3GF7A 3O6QA 3BCCG 2WSFH 3L75J 2KNCB 3OW2O 3TSIA 2QM8A 3L75G 2Z5HA 3Q2YA 5CCHC 3RBXA 1LT9B 4DOJA 3M9HA 4GOEA 3L74D 1ZP0C 5APSA 4H13D 2HPCA 2WQYC 1LTAC 1HVVA 1BE3D 1EZVI 4WVZA 4LDTA 3AE1C 3FGAD 1IC2A 1JCCA 1SQQJ 3AE9C 5BU8B 3Q5SA 2KK7A 3TF5A 2Q6QA 4JYCA 1PL5A 3PH0A 4EOTA 4LLHA 3CCUP 1EZVG 5CBOA 1JO5A 4DDGA 3LW5H 3H1HD 1YQ3C 1DEBA 3M9QA 1RE3A 4I2LC 4U7JA 3NMDA 1FZCB 2M8RA 1S2EA 3AEDC 3AEEC 2LR2A 2QG4A 3H25A 3L72D 3PLNA 3L73D 2QJYC 1EXJA 3B5NC 2ZFCA 2IPPA 1L0NG 1NTKE 2E76C 3M9BA 2ZFYA 3GF3A 2B9BA 5KLVE 2ZT9B 4C7NA 2WSEJ 2FFDC 1NEND 1P84H 3EFGA 3CCEP 1MFTA 1KZUB 2ZXXA 1PGOA 2H7HA 1LNQA 4IL6X 3B5NA 1NAYA 1N7SA 1M90Q 3P4PC 3BASA 3AEAD 2KS1B 1OMIA 1HUCA 3TYYA 1KQFB 2KYVA 3RL0C 2D2CC 3M06A 2V4HA 3M91A 1LJ2A 3ZDMA 2GM4A 1N86A 2QM7A 5AVTB 3KPEA 1PV3A 3U1CA 1EDIA 4L75A 1GD2E 3G4SP 1M56D 4EDFA 4YTMD 5CCHA 3CC7P 2FYNB 3HUSC 1GW4A 4XE5B 4DHIB 4D6TE 2XNDH 3CX5D 3GHGB 2H89C 1W2EA 2A06G 3CX5H 2K9YA 1N73A 4TT3H 1LTTC 1KFYD 2WSCJ 1NTZK 1NU1K 1SQXG 4WB4A 5KTBA 3ITKA 2Y0DA 3L35A 4YTMC 1NTMD 1QVFO 1FZGA 1FU1A 2H43A 2ZYGA 3VOPA 2M3EA 4H44D 3GW6A 1GL2D 5CCGC 1NKZB 2R3SA 2KNCA 2L91A 2V7QJ 2H88C 2QVAA 2I8DA 2A06E 1UIXA 1S9KD 1NU1D 2FYUK 1ZN5A 1DEEG 3HTKA 1TFFA 1SQPK 1BCCE 1VQPP 1NU1J 2Z4EA 1CI6B 5CHXA 3AE7C 1IFIA 1RF1B 1SQVG 3FXEA 4JPZB 3L4FA 3T97A 3VONA 3C9IA 1FDMA 1CSBA 1GK4A 1KFYC 3AEAC 2B76D 1SQBE 1ZXGA 1SS1A 3H1LD 1LWUB 4W80A 2P2UA 3SWKA 2P1JA 2YXQB 1DD4A 4AUWA 1AJYA 1YQ4C 2V7QH 4OVNF 4I6MC 3VRBC 2O1KA 1OIPA 5E79E 4JYBA 4HH2A 1ZMEC 1ZW0A 3QWOC 4XA4A 1E79H 2LXBA 1OVUA 4OWFA 1KYOD 3WMM0 5AW1B 2R44A 3CMAP 3TDKA 1NEKC 4NPEA 1L4AB 5KJ7A 2H88D 1USEA 1L4AA 3HD7B 5APVA 3V2QA 3MTUE 3R4YA 1SQXD 2WPRA 3MGNA 3RK3E 4IFDK 1N7SB 4KX6C 3HRNA 4M3LA 2YO2A 3LIEA 1KILB 4PD4E 4ZKPA 3G3ZA 3RBZA 3A2AA 2NPSA 2KXPB 2WP9D 1RHZB 5B66E 1SP4A 2OQQA 2XNXA 1Y8AA 1FZFA 1JY3N 1BGYG 4K35A 4C7NB 3M0AA 3I55P 4YSYD 1NENC 3AE6C 1OFCX 2BS3C 1X9VA 2QIWA 3AE7D 1EQ7A 1K8AQ 1L0VD 5B5EE 1N7SC 1YITP 4U3FD 2E76B 2J5UA 2QA4P 1S5LH 3A5TA 2A45I 2HPCB 4C7RA 4D6TJ 3WU2E 3A0HE 3HE5A 3CPWO 3P4RD 3G6EP 1U57A 3AEBD 1L0VC 1FBMA 2GA1A 2HR3A 4I6LA 1KC8Q 2ZVNB 3FWNA 2IBZE 2R32A 1LWUA 1PP9E 3H1HG 2WDRC 2B89A 2LKMA 4UB6E 1SQBG 3AEBC 3HTKB 1FDIA 1N73B 3JCUE 1PP9J 1Z56A 3B4SA 1VQ9P 1LWUC 1KB9D 1JUNA 2C0XA 1Q7YQ 3FX0A 2JWAA 3TK1A 2IX7C 2KLVA 3KZIE 3GG2A 2KP8A 3I5CA 1SVFA 3AE5D 3FWLA 2BS2C 3VR9D 3CWBG 1RF1C 3AE2C 2KSEA 3MZWB 3Q3DA 1LGHB 1SQQE 1SFCA 3NXSA 4D6TG 1KB9H 3AE3D 1J1DC 1KF6D 1JM0A 2WS3C 3VYIA 3VRAD 1L0LG 4ASWA 2KZIA 1P84I 2FBWC 2FY8A 1L0NE 3PRJA 2CPBA 1M57D 4IL6E 1N73C 1FS0E 1YJNP 3CCRP 1ZRTE 2AEMA 1YQ3D 2E42A 1FZAA 3SWYA 4OH8B 1KF6C 3CXHD 3AE9D 1QLBC 3Q5RA 4FJVA 4PJ0E 2I1KA 3FXDA 3P4QD 1VQ5P 2PP6A 2QJYB 4YT0D 2WDQD 3JC22 3SFED 1SQPD 1LTSC 1U7MA 3H1JJ 3RK2B 4N6JA 2FYUD 3CWBJ 1FJKA 1R5SA 5CMZA 1K9MQ 3EQ2A 3SWFA 2KOGA 2P10A 3H1LJ 1BCCD 1MZ9A 2WDVC 2JP3A 3V4QA 4YXWH 2XKMA 2ACZD 1L0LD 5AVQB 2OYHA 3WUTA 2YKPA 3TNUA 1DH3A 1PIXA 2E74C 1ZR2A 3VR9C 2QRXA 1QX8A 2IDBA 5APTA 4RJTA 5KLVG 3L72E 4H0LC 3R2PA 1SQXJ 3P4RC 1LTJA 1DX7A 3B71A 3RK3D 3TGUE 1FZCA 1IK9A 5CCGD 3GHGC 3BRVB 2ZAEB 1NTMJ 5EFWB 2WZ7A 2Q3EA 1HGZA 3OJAB 3AE6D 4KHXA 2E5YA 2FFDA 1IJDB 2H89D 4UB8H 5AW3B 1OXZA 2JKVA 3H1JG 2FYZA 1NTME 4EYYQ 2IFMA 2C0WA 1S3JA 4H0LD 1N7SD 1ZLLA 3I56P 2NPSD 1FZCC 2O01H 1T2KC 3CIRC 5L8RJ 4YTPD 1NU1G 1SQXK 4A7PA 1KB9E 4H0LB 2QEXP 4GOFA 4JF7A 1NTMK 3D71A 2IBZI 4L73A 5GTHH 2N1TB 4H13B 4Y99B 1GU5A 1VPCA 2B87A 3H1LG 3MP7B 1KILE 4WY4A 5APXA 3HE4B 1GL2C 1SLQA 4MN4C 1M1JA 1R5LA 1J1EC 1SQXE 1VQKP 3AEDD 3E1RA 3MHVA 5CCHD 1NTZG 1URQB 1LTJC 3VMYA 1GDTA 3PP5A 2OYIA 3GHGA 3CX5E 2BEZF 2M5AA 2KS1A 1NH4A 2FFDB 2O01J 3CMEP 3P8CD 5GTIE 3AEFC 3II6A 3AE2D 2IFNA 4YTPC 1VF5D 2PRRA 1W2BO 3P4SC 3VTPC 2NZ2A 2M0BA 3HE5B 2J58A 3VR8C 5APUA 2OYHC 3AEGD 2AXCA 3CWBE 1CZQA 1RF0C 1MUUA 1Q86Q 3L36A 1L0NJ 5KKZB 4EI2A 1IFDA 2R5DA 4BRYB 3TGUG 4PD4I 5AW2B 2GUVA 1GK6A 1PZQA 1NKNA 5C3JD 4OGQB 2JJLA 1VDFA 1GL2A 3RL0B 1VQLP 1RF0A 2K88A 2MJZA 5DJTB 2XZRA 1RQUA 3M0DA 5KJ7D 2WDRD 3L74E 1T6AA 1S4XA 1USDA 4R4MA 2WT7B 1U7JA 2R3CA 4I7ZC 1L0NK 1VQOP 1H0TA 2GUSA 5AVSB 1FOSE 1AQ5A 4H13C 3L70J 5B5EH 3BVHA 4RESB 4O9BA 1OW8A 5AW7B 1N8RQ 2FXMA 3AEED 3KDPB 2VRSA 3WU2H 4HYTB 3USSA 1NAFA 1EDLA 1M1JC 4JBZA 1JMMA 1JNMA 2YMKA 4HJGH 1SQVE 3F5HA 2A06D 1BE3G 1URQA 1SQQG 2E74D 2WU2C 1RE4C 4N78E 2IZ1A 4GODA 3CC2P 5BVZA 1YYCA 2QJPB 1X22A 1HTLC 1PPJE 2KB7P 1L0LJ 5C39A 1URQC 3VRBD 4HKZH 1VF5B 3L70D 4YTNC 4RO0A 5GTIH 4PV1D 3MUDA 1BE3E 3SFDD 1AFOA 4YSXC 1DD3A 1NTMG 1SQVK 3H1JD 1J1DB 2HODB 1OWAA 2WU5C 3MD0A 1LP1A 2OYHB 4CPGA 4UB6H 1T8ZA 1KFNA 4DCKA 2YNYA 1KQLA 1AQTA 2Y0CA 3L74G 2FYNC 4N78D 1S72P 1D7MA 3AE3C 3TGUD 2FXOA 4Y28J 1JY2P 3VN0A 4YSZD 2KZJA 4KJMA 3CX5I 4DZOA 1SQVJ 1VQ4P 4WBAA 1QVGO 3L71J 4IFFA 1X0TA 5C2TD 2WT7A 3PHLA 1Q81Q 1YHQP 1XTGB 2KSJA 3G9RA 3AECD 1Q82Q 1FE6A 3V5BA 2IBZG 1AV1A 1Q90D 2NPSB 5AW5B 3V2PA 3VP8A 1KQSO 1NTKD 4H44C 1QL2A 3H1HE 2FYUG 1TU3F 2ZT9D 1IO4A 1KILC 1CW5A 4Z1MH 5AW0B 3CCSP 1DIPA 2BS4C 5KAIE 2WQYD 2E75B 1OVVA 1MKMA 4YXDC 3L73G 3V4WA 5AVYB 2HLOA 5AW4B 2E74B 1BDDA 2QJPC 4Y99C 2N1TD 2I1JA 3F89A 3HD7D 2FKWB 2Y9YA 1L0ND 1YIJP 1JY2N 3RK3B 4GDOA 1QL1A 2K37A 2BCCE 4WY4D 1QGKB 1IFNA 2C9NY 3KHUA 3WUVA 2FYUE 2ZT9C 4TLFA 1RE3C 3G71P 3CXHH 1KORA 1BGYJ 4BWNA 1LT1A 1UIIA 3P8CE 4HB1A 4EIJA 3AECC 1X8YA 5E79H 4B86A 2O1JA 3MUDC 4ZKUA 1KQGB 2WMMA 2W8ZA 3H1KE 4JQ0D 1KYOI 3N7NA 3HD7C 1IFMA 2HODA 3C1LA 2E76D 1SQPE 1E5WA 5KJ7C 3JSVC 3OAKA 3RL0D 5M1BA 1YBKA 2WS3D 2POHA 5CBNA 1NTZE 2AXTE 1WT6A 2G3AA 3D70A 2OTKE 2HG5D 1J1EB 1QLED 2E43A 2SPZA 5AVUB 3W68A 3IR9A 3H1KG 4KX6D 3CD6P 4RKUJ 2QJKC 1SQBD 2LXCB 4YSYC 3A0BH 2OYOA 3P4QC 2R5BA 4XFJA 4OGQD 1BDCA 3GLMA 2WU5D 3IFMA 4UB8E 5KAFH 1GTWA 2WDQC 2C9LY 2M3BA 1Y9BA 1IFPA 4PV1B 5BU5A 3CCLP 1BCCJ 1JY3P 3RL0g 1S5LE 3B5NB 4AYCA 3LIDA 3CCMP 3LW5J 3A0HH
chains in the Genus database with same CATH topology
1ZMEC 1KF6C 3AE6D 1JB0J 1OW7A 3AE3C 1E7PC 1ZP0D 3AE9D 1ZOYD 3VR8C 4YTMD 1QLBC 2H89D 3Q5RA 3AECC 3AEGD 3AEFD 3AEDC 3AEEC 4Y28J 4YTND 3P4QD 3AEGC 2WDRC 2B76C 4KT0J 1KQGB 3H25A 2H89C 3GMAA 2YMKA 1HF9A 3SFDC 3T97B 3AE5C 2FXPA 1K05A 2K9YA 4H0LD 3AE4D 4YSZD 5C2TC 2JO1A 4TT3H 2QJYC 1EXJA 2E76D 4YT0D 1WMKA 1NEKC 2WDQD 3CIRC 5KLIC 1KFYD 3Q1MA 3SFED 2WSCJ 2H88D 5M1BA 3SFEC 5L8RJ 4YTPD 3AEBC 2E74D 2WU2C 2E76C 4YT0C 2WS3D 3AE1D 4I7ZB 5C2TD 1FDIA 2D2CD 2G8YA 3GF3A 1NGMB 2E75D 3AE8D 3R4YA 2ZT9B 2G3AA 4YTMC 4YSXD 1GMJA 1ZOYC 3G9RA 3GF7A 3RK3E 3O6QA 3VR8D 4H0LB 3S9OA 5C3JD 1HJ0A 2WSEJ 4OGQB 3Q5PA 3AECD 3P4PD 4KX6C 3D70A 3D71A 3ABVD 1NEND 3IN6A 4H44D 4H13B 2P10A 3VRAC 1R8EA 2WDVD 2WP9D 3AE4C 1Q90D 1S5LX 4IL6X 3AE5D 4YSZC 2WDVC 2OQQA 3Q2YA 3P4SD 3C8VA 2BS2C 3VR9D 4H44C 2JP3A 1KILE 1VF5C 3VRBD 1RQUA 3AE2C 2V7QJ 1NYHA 1TU3F 1VF5B 2H88C 2ZT9D 2WDRD 4YTNC 2WP9C 1FDOA 4YXDD 2D2CB 4KX6D 1S1CX 4Z1MH 1UIXA 3P4PC 4RKUJ 1DIPA 2ACZD 2BS4C 4PV1D 2QJKC 2WQYD 4YSYD 3EWKA 4R4MA 3D6YA 3AEAD 1NENC 3SFDD 1ZP0C 2E75B 4H13D 4PV1C 3AE6C 1K04A 2WQYC 2E75C 1RQVA 3AE8C 1EXIA 2BS3C 1OMIA 2FBWD 4YSYC 1MKMA 3Q3DA 3P4QC 3IAOA 2QIWA 4YXDC 4XFJA 4R4LA 3AE7D 2QSIA 4OGQD 3AEDD 4YSXC 4I7ZC 2E74B 3AE1C 1PIXA 2WSFJ 3GLMA 1KQFB 1L0VD 2WU5D 2E74C 2QJPC 3FGAD 1DD3A 2D2CC 3VR9C 3AE9C 3AE3D 4H44B 2IDBA 3Q5SA 1KF6D 1YQ4D 2WDQC 2WS3C 3AE7C 3CIRD 3VRAD 4H0LC 1KTMA 2E76B 2J5UA 2WU5C 4H13C 1KFYC 1NEKD 3AEAC 1PL5A 3ABVC 1Y9BA 1IK7A 2BEZF 2WPVB 2B76D 2FBWC 3P4RC 5C3JC 1OW6A 4PV1B 2YIUC 4GDOA 2O01J 1OW8A 3B71A 1DD4A 2ACZC 1PV3A 1AJYA 3AEED 3AEFC 3RL0g 1YQ4C 1ZRTE 3P4RD 2MKVA 2ZT9C 3AE2D 1VL2A 4YTPC 1VF5D 3VRBC 5KKZC 3D6ZA 1U57A 1YQ3C 2WU2D 3AEBD 3P4SC 2FYNC 1L0VC 1KMIZ 4OGQC 1YQ3D 3LW5J 2NZ2A 4U7JA 1KORA 2BEQD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KF6 C;  3AE6 D;  1OW7 A;  3AE3 C;  1E7P C;  1ZP0 D;  3AE9 D;  1ZOY D;  3VR8 C;  4YTM D;  1QLB C;  2H89 D;  3AEC C;  3AEG D;  3AEF D;  3AED C;  3AEE C;  4YTN D;  3P4Q D;  3AEG C;  2WDR C;  2B76 C;  2H89 C;  3SFD C;  3AE5 C;  4YSZ D;  1K05 A;  3AE4 D;  5C2T C;  4YT0 D;  1NEK C;  2WDQ D;  3CIR C;  1KFY D;  3SFE D;  2H88 D;  3SFE C;  4YTP D;  3AEB C;  2WU2 C;  4YT0 C;  2WS3 D;  3AE1 D;  5C2T D;  3AE8 D;  2G3A A;  4YTM C;  4YSX D;  1ZOY C;  3VR8 D;  3S9O A;  5C3J D;  3P4P D;  3AEC D;  4KX6 C;  3ABV D;  1NEN D;  3VRA C;  2WDV D;  2WP9 D;  3AE4 C;  3AE5 D;  4YSZ C;  2WDV C;  3P4S D;  2BS2 C;  3VR9 D;  3VRB D;  3AE2 C;  2WDR D;  2H88 C;  4YTN C;  2WP9 C;  4YXD D;  4KX6 D;  3P4P C;  2ACZ D;  2BS4 C;  2WQY D;  4YSY D;  3AEA D;  3SFD D;  1NEN C;  1ZP0 C;  3AE6 C;  2WQY C;  4YSY C;  3AE8 C;  2BS3 C;  2FBW D;  3P4Q C;  4YXD C;  3AE7 D;  4YSX C;  3AED D;  3AE1 C;  1L0V D;  2WU5 D;  3VR9 C;  3AE9 C;  3AE3 D;  1YQ4 D;  1KF6 D;  2WDQ C;  2WS3 C;  3AE7 C;  3CIR D;  3VRA D;  1KTM A;  2WU5 C;  1KFY C;  1NEK D;  3AEA C;  3ABV C;  2B76 D;  2FBW C;  3P4R C;  5C3J C;  1OW6 A;  1OW8 A;  3B71 A;  2ACZ C;  1PV3 A;  3AEE D;  3AEF C;  1YQ4 C;  3P4R D;  3AE2 D;  4YTP C;  3VRB C;  2WU2 D;  1YQ3 C;  3AEB D;  3P4S C;  1L0V C;  1YQ3 D;  1K04 A; 
#chains in the Genus database with same CATH topology
 2KLU A;  4N3Y B;  3L75 E;  1ZP0 D;  2FYU J;  3CWB D;  3H1I J;  5KLI B;  5GTH E;  4YTN D;  3AEG C;  1NTZ D;  3OA7 A;  1SQP J;  1NO4 A;  3SFD C;  4U3F E;  1K05 A;  5CJ4 A;  5AW9 B;  2P7J A;  4DT0 A;  3P7K A;  1BGY D;  1M1K Q;  4I1L A;  4IFM A;  3U1A A;  3H1I G;  1L0L E;  1HJ0 A;  2YKO A;  3ABV D;  3IN6 A;  4L74 A;  4WWI A;  4W7Z A;  1JTH B;  3C8V A;  1GL2 B;  3H32 B;  3CCJ P;  2Q3I A;  1H88 A;  1FDO A;  4YXD D;  5K5G B;  5TIS H;  2YIU B;  2OTL P;  2XU6 A;  3CXH E;  3S4R A;  3IAO A;  3HD7 A;  1J2J B;  2Z5I A;  5TJH A;  1EZV D;  2ZYA A;  1RE4 A;  1YJW P;  3L71 E;  1LTB C;  3CIR D;  2NPS C;  1SFC D;  3KQG A;  1A02 J;  1IK7 A;  4DJG A;  1EC5 A;  1OW6 A;  1M1J B;  4ZMD A;  2N1T C;  2MKV A;  1LT9 A;  2PFX A;  2RN0 A;  5DJU B;  3BCC D;  5KKZ C;  4WY4 B;  2WU2 D;  1BGY E;  4IL6 H;  2E5T A;  2A45 G;  1T2K D;  4YPC A;  1RY3 A;  1PGJ A;  4ZNC A;  1PP9 D;  1VQ7 P;  1LP1 B;  5KLV D;  1A02 F;  1Q2N A;  2DW3 A;  1NWQ A;  1L4A D;  2FXP A;  1RF1 A;  2YKQ A;  3SFE C;  3L73 E;  4YT0 C;  1IZN B;  4DHJ A;  1X79 B;  2ZXE B;  5AVZ B;  4WY4 C;  1ZRT D;  2IZ0 A;  5APY A;  3VP9 A;  1GMJ A;  1ZOY C;  1FZE A;  3P4P D;  2RH0 A;  2B88 A;  3HE4 A;  1JMB A;  2KI7 B;  1H89 A;  3VRA C;  5AVX B;  3AE4 C;  1S5L X;  2BCC G;  1NVO A;  3P4S D;  1VF5 C;  1NYH A;  1FAV A;  1URQ D;  1QEX A;  2D2C B;  3O6Q B;  3D6Y A;  4PV1 C;  4ASV A;  2JEE A;  1LTJ B;  3NFQ A;  2IYP A;  1HGV A;  3V2R A;  2WSF J;  3U59 A;  3PJS K;  4GKG A;  5APW A;  1YQ4 D;  1JEK A;  4W7Y A;  3O8Z A;  3H1I E;  2WSS H;  2YO3 A;  3BCC E;  1N2D C;  1LTI C;  1P84 D;  3S1K A;  2QJK B;  3HUS A;  3V6I A;  3H6P A;  2IBZ D;  1IFJ A;  3E1I A;  3EFF K;  3H32 A;  2ZJS E;  1GZL A;  3V2N A;  2BEQ D;  1VQ8 P;  1E7P C;  5AVR B;  1YJ9 P;  2ZVO B;  1NTZ J;  3KXD A;  3GMA A;  4D6T D;  1HWT C;  3BCC J;  2JO1 A;  1WMK A;  3JCU H;  5TIS E;  1H0T B;  2K9J A;  3H1I D;  4DHZ A;  1GW3 A;  3W67 A;  1H8A A;  3IF4 A;  4U3F J;  3TNU B;  1M8O B;  3CL3 D;  3AE1 D;  3B8E B;  3H1K D;  2AEJ A;  1NGM B;  1P84 E;  1G1I A;  1SQQ D;  3L37 A;  2RKL A;  3KZI H;  1KB9 I;  1T3U A;  4LGD E;  1BE3 J;  3Q5P A;  3E7K A;  5APQ A;  3L74 J;  1KIL D;  2J59 M;  2XV5 A;  2CPS A;  2WSC H;  2O01 N;  1LT9 C;  5AVW B;  1PP9 G;  1VQ6 P;  1KIL A;  1KYO E;  1L0L K;  2BCC J;  1S1C X;  3NTN A;  2PAJ A;  1JY2 O;  2OAR A;  1NOH A;  3P32 A;  2E75 C;  1EXI A;  3L75 D;  1YI2 P;  4BRY A;  1BSN A;  3BAT A;  1NJI Q;  5KAI H;  1EDJ A;  4H44 B;  2W83 C;  1CI6 A;  2H8P D;  1L2P A;  2IYO A;  4AQR D;  1MFZ A;  1ZR4 A;  4PD4 D;  5CCG A;  2P58 A;  2WTY A;  3PTZ A;  3VMA A;  2W6J H;  4GT1 A;  2ACZ C;  1YTZ I;  1S9K E;  2Y9Z A;  2KIK A;  2NRG A;  2XDJ A;  2O3J A;  4PJ0 H;  3CCQ P;  2W27 A;  1JB0 J;  2N1T A;  1ZV8 A;  1L4A C;  1SQB K;  3HUS B;  2JR8 A;  4L76 A;  1OVR A;  2W6A A;  3AEF D;  3L70 E;  3T97 B;  1SFC C;  5C2T C;  2WWW A;  2JWD A;  2HFE D;  3A7O A;  1PFI A;  1KN7 A;  4NPD A;  2KUB A;  3BRT B;  1G2C A;  1KV4 A;  1EZV E;  2L5G B;  3L71 G;  2E75 D;  1KD1 Q;  3P8M C;  3S9O A;  2AXT H;  1K73 Q;  1R8E A;  2WDV D;  1RH5 B;  4YSZ C;  1HJB A;  3H1J E;  1SQB J;  2BCC D;  2YMY A;  4LC1 A;  3CC4 P;  3EWK A;  3SSU A;  5H2F E;  1RQV A;  1YTZ T;  2FBW D;  2RMZ A;  3RK2 C;  5AW8 B;  4NPF X;  1NU1 E;  2QSI A;  2OTJ P;  1T3J A;  2OGU A;  4IOI H;  3A3Y B;  3WUU A;  3CLQ A;  1PGP A;  1FOS F;  2UWJ E;  4PD4 H;  3CCV P;  1KTM A;  2W6B A;  1NHL A;  1NTK J;  2ITA A;  3ABV C;  2WVR A;  2WPV B;  5B66 H;  3H1K J;  2YXR B;  5C3J C;  1XTC C;  2YIU C;  2Q9I A;  4K3A A;  5AVV B;  1PGQ A;  1M7L A;  2K3R A;  1FZB A;  2K1A A;  2Q5U A;  1KMI Z;  4OGQ C;  1PPJ G;  3B5N D;  1K04 A;  3L71 D;  2OYI C;  1FC2 C;  1SQV D;  2Q7C A;  2B76 C;  4DDI A;  4KT0 J;  4C46 A;  3KYQ A;  3AE5 C;  1AVO A;  1KYO H;  3L72 G;  3AE4 D;  3M0D C;  3L73 J;  2WPQ A;  3L72 J;  3Q1M A;  1VQM P;  1EDK A;  1VQN P;  2K9J B;  1NTK K;  2N9B A;  4BXL A;  3A0B E;  4I7Z B;  2D2C D;  2G8Y A;  2ZYD A;  1KFM A;  3VMX A;  2Q1K A;  4GIF A;  3VR8 D;  5KAF E;  5CJ0 A;  1JTH A;  3MIW A;  1WRG A;  2N9Y B;  2A45 H;  3K5B A;  3CXH I;  1W5C E;  3L70 G;  2WP9 C;  5KLV K;  3RK2 D;  4U3F G;  4QMA A;  1SQP G;  1JOC A;  3AE8 C;  2HYN A;  1G1J A;  4R4L A;  1N7L A;  3UIA A;  3N4X A;  2AEF A;  3RGU A;  1AVY A;  1NEK D;  1OZH A;  1JY3 O;  1HBW A;  2JDI H;  1NTK G;  3CI9 A;  1GU4 A;  1BSH A;  3H1L E;  1JCD A;  1Y47 A;  3QH9 A;  1VL2 A;  1HH0 A;  2BAS A;  3D6Z A;  2B87 B;  2P67 A;  2Y0E A;  5KLV J;  1OW7 A;  1ZOY D;  3H1H J;  3TGU J;  2WPS A;  1AA0 A;  1BCC G;  2M5A B;  2OYI B;  2PGD A;  2QE7 H;  1HF9 A;  5KLI C;  3VMZ A;  1G2C B;  1SQQ K;  2CK3 H;  2WIT A;  1OX3 A;  5H2F H;  1SFC B;  1LTG C;  2W90 A;  1FJP A;  2WSE H;  3RK3 C;  3AE8 D;  1MV8 A;  1PPJ D;  4YSX D;  5AW6 B;  3GF7 A;  3O6Q A;  3BCC G;  2WSF H;  3L75 J;  2KNC B;  3OW2 O;  3TSI A;  2QM8 A;  3L75 G;  2Z5H A;  3Q2Y A;  5CCH C;  3RBX A;  1LT9 B;  4DOJ A;  3M9H A;  4GOE A;  3L74 D;  1ZP0 C;  5APS A;  4H13 D;  2HPC A;  2WQY C;  1LTA C;  1HVV A;  1BE3 D;  1EZV I;  4WVZ A;  4LDT A;  3AE1 C;  3FGA D;  1IC2 A;  1JCC A;  1SQQ J;  3AE9 C;  5BU8 B;  3Q5S A;  2KK7 A;  3TF5 A;  2Q6Q A;  4JYC A;  1PL5 A;  3PH0 A;  4EOT A;  4LLH A;  3CCU P;  1EZV G;  5CBO A;  1JO5 A;  4DDG A;  3LW5 H;  3H1H D;  1YQ3 C;  1DEB A;  3M9Q A;  1RE3 A;  4I2L C;  4U7J A;  3NMD A;  1FZC B;  2M8R A;  1S2E A;  3AED C;  3AEE C;  2LR2 A;  2QG4 A;  3H25 A;  3L72 D;  3PLN A;  3L73 D;  2QJY C;  1EXJ A;  3B5N C;  2ZFC A;  2IPP A;  1L0N G;  1NTK E;  2E76 C;  3M9B A;  2ZFY A;  3GF3 A;  2B9B A;  5KLV E;  2ZT9 B;  4C7N A;  2WSE J;  2FFD C;  1NEN D;  1P84 H;  3EFG A;  3CCE P;  1MFT A;  1KZU B;  2ZXX A;  1PGO A;  2H7H A;  1LNQ A;  4IL6 X;  3B5N A;  1NAY A;  1N7S A;  1M90 Q;  3P4P C;  3BAS A;  3AEA D;  2KS1 B;  1OMI A;  1HUC A;  3TYY A;  1KQF B;  2KYV A;  3RL0 C;  2D2C C;  3M06 A;  2V4H A;  3M91 A;  1LJ2 A;  3ZDM A;  2GM4 A;  1N86 A;  2QM7 A;  5AVT B;  3KPE A;  1PV3 A;  3U1C A;  1EDI A;  4L75 A;  1GD2 E;  3G4S P;  1M56 D;  4EDF A;  4YTM D;  5CCH A;  3CC7 P;  2FYN B;  3HUS C;  1GW4 A;  4XE5 B;  4DHI B;  4D6T E;  2XND H;  3CX5 D;  3GHG B;  2H89 C;  1W2E A;  2A06 G;  3CX5 H;  2K9Y A;  1N73 A;  4TT3 H;  1LTT C;  1KFY D;  2WSC J;  1NTZ K;  1NU1 K;  1SQX G;  4WB4 A;  5KTB A;  3ITK A;  2Y0D A;  3L35 A;  4YTM C;  1NTM D;  1QVF O;  1FZG A;  1FU1 A;  2H43 A;  2ZYG A;  3VOP A;  2M3E A;  4H44 D;  3GW6 A;  1GL2 D;  5CCG C;  1NKZ B;  2R3S A;  2KNC A;  2L91 A;  2V7Q J;  2H88 C;  2QVA A;  2I8D A;  2A06 E;  1UIX A;  1S9K D;  1NU1 D;  2FYU K;  1ZN5 A;  1DEE G;  3HTK A;  1TFF A;  1SQP K;  1BCC E;  1VQP P;  1NU1 J;  2Z4E A;  1CI6 B;  5CHX A;  3AE7 C;  1IFI A;  1RF1 B;  1SQV G;  3FXE A;  4JPZ B;  3L4F A;  3T97 A;  3VON A;  3C9I A;  1FDM A;  1CSB A;  1GK4 A;  1KFY C;  3AEA C;  2B76 D;  1SQB E;  1ZXG A;  1SS1 A;  3H1L D;  1LWU B;  4W80 A;  2P2U A;  3SWK A;  2P1J A;  2YXQ B;  1DD4 A;  4AUW A;  1AJY A;  1YQ4 C;  2V7Q H;  4OVN F;  4I6M C;  3VRB C;  2O1K A;  1OIP A;  5E79 E;  4JYB A;  4HH2 A;  1ZME C;  1ZW0 A;  3QWO C;  4XA4 A;  1E79 H;  2LXB A;  1OVU A;  4OWF A;  1KYO D;  3WMM 0;  5AW1 B;  2R44 A;  3CMA P;  3TDK A;  1NEK C;  4NPE A;  1L4A B;  5KJ7 A;  2H88 D;  1USE A;  1L4A A;  3HD7 B;  5APV A;  3V2Q A;  3MTU E;  3R4Y A;  1SQX D;  2WPR A;  3MGN A;  3RK3 E;  4IFD K;  1N7S B;  4KX6 C;  3HRN A;  4M3L A;  2YO2 A;  3LIE A;  1KIL B;  4PD4 E;  4ZKP A;  3G3Z A;  3RBZ A;  3A2A A;  2NPS A;  2KXP B;  2WP9 D;  1RHZ B;  5B66 E;  1SP4 A;  2OQQ A;  2XNX A;  1Y8A A;  1FZF A;  1JY3 N;  1BGY G;  4K35 A;  4C7N B;  3M0A A;  3I55 P;  4YSY D;  1NEN C;  3AE6 C;  1OFC X;  2BS3 C;  1X9V A;  2QIW A;  3AE7 D;  1EQ7 A;  1K8A Q;  1L0V D;  5B5E E;  1N7S C;  1YIT P;  4U3F D;  2E76 B;  2J5U A;  2QA4 P;  1S5L H;  3A5T A;  2A45 I;  2HPC B;  4C7R A;  4D6T J;  3WU2 E;  3A0H E;  3HE5 A;  3CPW O;  3P4R D;  3G6E P;  1U57 A;  3AEB D;  1L0V C;  1FBM A;  2GA1 A;  2HR3 A;  4I6L A;  1KC8 Q;  2ZVN B;  3FWN A;  2IBZ E;  2R32 A;  1LWU A;  1PP9 E;  3H1H G;  2WDR C;  2B89 A;  2LKM A;  4UB6 E;  1SQB G;  3AEB C;  3HTK B;  1FDI A;  1N73 B;  3JCU E;  1PP9 J;  1Z56 A;  3B4S A;  1VQ9 P;  1LWU C;  1KB9 D;  1JUN A;  2C0X A;  1Q7Y Q;  3FX0 A;  2JWA A;  3TK1 A;  2IX7 C;  2KLV A;  3KZI E;  3GG2 A;  2KP8 A;  3I5C A;  1SVF A;  3AE5 D;  3FWL A;  2BS2 C;  3VR9 D;  3CWB G;  1RF1 C;  3AE2 C;  2KSE A;  3MZW B;  3Q3D A;  1LGH B;  1SQQ E;  1SFC A;  3NXS A;  4D6T G;  1KB9 H;  3AE3 D;  1J1D C;  1KF6 D;  1JM0 A;  2WS3 C;  3VYI A;  3VRA D;  1L0L G;  4ASW A;  2KZI A;  1P84 I;  2FBW C;  2FY8 A;  1L0N E;  3PRJ A;  2CPB A;  1M57 D;  4IL6 E;  1N73 C;  1FS0 E;  1YJN P;  3CCR P;  1ZRT E;  2AEM A;  1YQ3 D;  2E42 A;  1FZA A;  3SWY A;  4OH8 B;  1KF6 C;  3CXH D;  3AE9 D;  1QLB C;  3Q5R A;  4FJV A;  4PJ0 E;  2I1K A;  3FXD A;  3P4Q D;  1VQ5 P;  2PP6 A;  2QJY B;  4YT0 D;  2WDQ D;  3JC2 2;  3SFE D;  1SQP D;  1LTS C;  1U7M A;  3H1J J;  3RK2 B;  4N6J A;  2FYU D;  3CWB J;  1FJK A;  1R5S A;  5CMZ A;  1K9M Q;  3EQ2 A;  3SWF A;  2KOG A;  2P10 A;  3H1L J;  1BCC D;  1MZ9 A;  2WDV C;  2JP3 A;  3V4Q A;  4YXW H;  2XKM A;  2ACZ D;  1L0L D;  5AVQ B;  2OYH A;  3WUT A;  2YKP A;  3TNU A;  1DH3 A;  1PIX A;  2E74 C;  1ZR2 A;  3VR9 C;  2QRX A;  1QX8 A;  2IDB A;  5APT A;  4RJT A;  5KLV G;  3L72 E;  4H0L C;  3R2P A;  1SQX J;  3P4R C;  1LTJ A;  1DX7 A;  3B71 A;  3RK3 D;  3TGU E;  1FZC A;  1IK9 A;  5CCG D;  3GHG C;  3BRV B;  2ZAE B;  1NTM J;  5EFW B;  2WZ7 A;  2Q3E A;  1HGZ A;  3OJA B;  3AE6 D;  4KHX A;  2E5Y A;  2FFD A;  1IJD B;  2H89 D;  4UB8 H;  5AW3 B;  1OXZ A;  2JKV A;  3H1J G;  2FYZ A;  1NTM E;  4EYY Q;  2IFM A;  2C0W A;  1S3J A;  4H0L D;  1N7S D;  1ZLL A;  3I56 P;  2NPS D;  1FZC C;  2O01 H;  1T2K C;  3CIR C;  5L8R J;  4YTP D;  1NU1 G;  1SQX K;  4A7P A;  1KB9 E;  4H0L B;  2QEX P;  4GOF A;  4JF7 A;  1NTM K;  3D71 A;  2IBZ I;  4L73 A;  5GTH H;  2N1T B;  4H13 B;  4Y99 B;  1GU5 A;  1VPC A;  2B87 A;  3H1L G;  3MP7 B;  1KIL E;  4WY4 A;  5APX A;  3HE4 B;  1GL2 C;  1SLQ A;  4MN4 C;  1M1J A;  1R5L A;  1J1E C;  1SQX E;  1VQK P;  3AED D;  3E1R A;  3MHV A;  5CCH D;  1NTZ G;  1URQ B;  1LTJ C;  3VMY A;  1GDT A;  3PP5 A;  2OYI A;  3GHG A;  3CX5 E;  2BEZ F;  2M5A A;  2KS1 A;  1NH4 A;  2FFD B;  2O01 J;  3CME P;  3P8C D;  5GTI E;  3AEF C;  3II6 A;  3AE2 D;  2IFN A;  4YTP C;  1VF5 D;  2PRR A;  1W2B O;  3P4S C;  3VTP C;  2NZ2 A;  2M0B A;  3HE5 B;  2J58 A;  3VR8 C;  5APU A;  2OYH C;  3AEG D;  2AXC A;  3CWB E;  1CZQ A;  1RF0 C;  1MUU A;  1Q86 Q;  3L36 A;  1L0N J;  5KKZ B;  4EI2 A;  1IFD A;  2R5D A;  4BRY B;  3TGU G;  4PD4 I;  5AW2 B;  2GUV A;  1GK6 A;  1PZQ A;  1NKN A;  5C3J D;  4OGQ B;  2JJL A;  1VDF A;  1GL2 A;  3RL0 B;  1VQL P;  1RF0 A;  2K88 A;  2MJZ A;  5DJT B;  2XZR A;  1RQU A;  3M0D A;  5KJ7 D;  2WDR D;  3L74 E;  1T6A A;  1S4X A;  1USD A;  4R4M A;  2WT7 B;  1U7J A;  2R3C A;  4I7Z C;  1L0N K;  1VQO P;  1H0T A;  2GUS A;  5AVS B;  1FOS E;  1AQ5 A;  4H13 C;  3L70 J;  5B5E H;  3BVH A;  4RES B;  4O9B A;  1OW8 A;  5AW7 B;  1N8R Q;  2FXM A;  3AEE D;  3KDP B;  2VRS A;  3WU2 H;  4HYT B;  3USS A;  1NAF A;  1EDL A;  1M1J C;  4JBZ A;  1JMM A;  1JNM A;  2YMK A;  4HJG H;  1SQV E;  3F5H A;  2A06 D;  1BE3 G;  1URQ A;  1SQQ G;  2E74 D;  2WU2 C;  1RE4 C;  4N78 E;  2IZ1 A;  4GOD A;  3CC2 P;  5BVZ A;  1YYC A;  2QJP B;  1X22 A;  1HTL C;  1PPJ E;  2KB7 P;  1L0L J;  5C39 A;  1URQ C;  3VRB D;  4HKZ H;  1VF5 B;  3L70 D;  4YTN C;  4RO0 A;  5GTI H;  4PV1 D;  3MUD A;  1BE3 E;  3SFD D;  1AFO A;  4YSX C;  1DD3 A;  1NTM G;  1SQV K;  3H1J D;  1J1D B;  2HOD B;  1OWA A;  2WU5 C;  3MD0 A;  1LP1 A;  2OYH B;  4CPG A;  4UB6 H;  1T8Z A;  1KFN A;  4DCK A;  2YNY A;  1KQL A;  1AQT A;  2Y0C A;  3L74 G;  2FYN C;  4N78 D;  1S72 P;  1D7M A;  3AE3 C;  3TGU D;  2FXO A;  4Y28 J;  1JY2 P;  3VN0 A;  4YSZ D;  2KZJ A;  4KJM A;  3CX5 I;  4DZO A;  1SQV J;  1VQ4 P;  4WBA A;  1QVG O;  3L71 J;  4IFF A;  1X0T A;  5C2T D;  2WT7 A;  3PHL A;  1Q81 Q;  1YHQ P;  1XTG B;  2KSJ A;  3G9R A;  3AEC D;  1Q82 Q;  1FE6 A;  3V5B A;  2IBZ G;  1AV1 A;  1Q90 D;  2NPS B;  5AW5 B;  3V2P A;  3VP8 A;  1KQS O;  1NTK D;  4H44 C;  1QL2 A;  3H1H E;  2FYU G;  1TU3 F;  2ZT9 D;  1IO4 A;  1KIL C;  1CW5 A;  4Z1M H;  5AW0 B;  3CCS P;  1DIP A;  2BS4 C;  5KAI E;  2WQY D;  2E75 B;  1OVV A;  1MKM A;  4YXD C;  3L73 G;  3V4W A;  5AVY B;  2HLO A;  5AW4 B;  2E74 B;  1BDD A;  2QJP C;  4Y99 C;  2N1T D;  2I1J A;  3F89 A;  3HD7 D;  2FKW B;  2Y9Y A;  1L0N D;  1YIJ P;  1JY2 N;  3RK3 B;  4GDO A;  1QL1 A;  2K37 A;  2BCC E;  4WY4 D;  1QGK B;  1IFN A;  2C9N Y;  3KHU A;  3WUV A;  2FYU E;  2ZT9 C;  4TLF A;  1RE3 C;  3G71 P;  3CXH H;  1KOR A;  1BGY J;  4BWN A;  1LT1 A;  1UII A;  3P8C E;  4HB1 A;  4EIJ A;  3AEC C;  1X8Y A;  5E79 H;  4B86 A;  2O1J A;  3MUD C;  4ZKU A;  1KQG B;  2WMM A;  2W8Z A;  3H1K E;  4JQ0 D;  1KYO I;  3N7N A;  3HD7 C;  1IFM A;  2HOD A;  3C1L A;  2E76 D;  1SQP E;  1E5W A;  5KJ7 C;  3JSV C;  3OAK A;  3RL0 D;  5M1B A;  1YBK A;  2WS3 D;  2POH A;  5CBN A;  1NTZ E;  2AXT E;  1WT6 A;  2G3A A;  3D70 A;  2OTK E;  2HG5 D;  1J1E B;  1QLE D;  2E43 A;  2SPZ A;  5AVU B;  3W68 A;  3IR9 A;  3H1K G;  4KX6 D;  3CD6 P;  4RKU J;  2QJK C;  1SQB D;  2LXC B;  4YSY C;  3A0B H;  2OYO A;  3P4Q C;  2R5B A;  4XFJ A;  4OGQ D;  1BDC A;  3GLM A;  2WU5 D;  3IFM A;  4UB8 E;  5KAF H;  1GTW A;  2WDQ C;  2C9L Y;  2M3B A;  1Y9B A;  1IFP A;  4PV1 B;  5BU5 A;  3CCL P;  1BCC J;  1JY3 P;  3RL0 g;  1S5L E;  3B5N B;  4AYC A;  3LID A;  3CCM P;  3LW5 J;  3A0H H; 
#chains in the Genus database with same CATH homology
 1ZME C;  1KF6 C;  3AE6 D;  1JB0 J;  1OW7 A;  3AE3 C;  1E7P C;  1ZP0 D;  3AE9 D;  1ZOY D;  3VR8 C;  4YTM D;  1QLB C;  2H89 D;  3Q5R A;  3AEC C;  3AEG D;  3AEF D;  3AED C;  3AEE C;  4Y28 J;  4YTN D;  3P4Q D;  3AEG C;  2WDR C;  2B76 C;  4KT0 J;  1KQG B;  3H25 A;  2H89 C;  3GMA A;  2YMK A;  1HF9 A;  3SFD C;  3T97 B;  3AE5 C;  2FXP A;  1K05 A;  2K9Y A;  4H0L D;  3AE4 D;  4YSZ D;  5C2T C;  2JO1 A;  4TT3 H;  2QJY C;  1EXJ A;  2E76 D;  4YT0 D;  1WMK A;  1NEK C;  2WDQ D;  3CIR C;  5KLI C;  1KFY D;  3Q1M A;  3SFE D;  2WSC J;  2H88 D;  5M1B A;  3SFE C;  5L8R J;  4YTP D;  3AEB C;  2E74 D;  2WU2 C;  2E76 C;  4YT0 C;  2WS3 D;  3AE1 D;  4I7Z B;  5C2T D;  1FDI A;  2D2C D;  2G8Y A;  3GF3 A;  1NGM B;  2E75 D;  3AE8 D;  3R4Y A;  2ZT9 B;  2G3A A;  4YTM C;  4YSX D;  1GMJ A;  1ZOY C;  3G9R A;  3GF7 A;  3RK3 E;  3O6Q A;  3VR8 D;  4H0L B;  3S9O A;  5C3J D;  1HJ0 A;  2WSE J;  4OGQ B;  3Q5P A;  3AEC D;  3P4P D;  4KX6 C;  3D70 A;  3D71 A;  3ABV D;  1NEN D;  3IN6 A;  4H44 D;  4H13 B;  2P10 A;  3VRA C;  1R8E A;  2WDV D;  2WP9 D;  3AE4 C;  1Q90 D;  1S5L X;  4IL6 X;  3AE5 D;  4YSZ C;  2WDV C;  2OQQ A;  3Q2Y A;  3P4S D;  3C8V A;  2BS2 C;  3VR9 D;  4H44 C;  2JP3 A;  1KIL E;  1VF5 C;  3VRB D;  1RQU A;  3AE2 C;  2V7Q J;  1NYH A;  1TU3 F;  1VF5 B;  2H88 C;  2ZT9 D;  2WDR D;  4YTN C;  2WP9 C;  1FDO A;  4YXD D;  2D2C B;  4KX6 D;  1S1C X;  4Z1M H;  1UIX A;  3P4P C;  4RKU J;  1DIP A;  2ACZ D;  2BS4 C;  4PV1 D;  2QJK C;  2WQY D;  4YSY D;  3EWK A;  4R4M A;  3D6Y A;  3AEA D;  1NEN C;  3SFD D;  1ZP0 C;  2E75 B;  4H13 D;  4PV1 C;  3AE6 C;  1K04 A;  2WQY C;  2E75 C;  1RQV A;  3AE8 C;  1EXI A;  2BS3 C;  1OMI A;  2FBW D;  4YSY C;  1MKM A;  3Q3D A;  3P4Q C;  3IAO A;  2QIW A;  4YXD C;  4XFJ A;  4R4L A;  3AE7 D;  2QSI A;  4OGQ D;  3AED D;  4YSX C;  4I7Z C;  2E74 B;  3AE1 C;  1PIX A;  2WSF J;  3GLM A;  1KQF B;  1L0V D;  2WU5 D;  2E74 C;  2QJP C;  3FGA D;  1DD3 A;  2D2C C;  3VR9 C;  3AE9 C;  3AE3 D;  4H44 B;  2IDB A;  3Q5S A;  1KF6 D;  1YQ4 D;  2WDQ C;  2WS3 C;  3AE7 C;  3CIR D;  3VRA D;  4H0L C;  1KTM A;  2E76 B;  2J5U A;  2WU5 C;  4H13 C;  1KFY C;  1NEK D;  3AEA C;  1PL5 A;  3ABV C;  1Y9B A;  1IK7 A;  2BEZ F;  2WPV B;  2B76 D;  2FBW C;  3P4R C;  5C3J C;  1OW6 A;  4PV1 B;  2YIU C;  4GDO A;  2O01 J;  1OW8 A;  3B71 A;  1DD4 A;  2ACZ C;  1PV3 A;  1AJY A;  3AEE D;  3AEF C;  3RL0 g;  1YQ4 C;  1ZRT E;  3P4R D;  2MKV A;  2ZT9 C;  3AE2 D;  1VL2 A;  4YTP C;  1VF5 D;  3VRB C;  5KKZ C;  3D6Z A;  1U57 A;  1YQ3 C;  2WU2 D;  3AEB D;  3P4S C;  2FYN C;  1L0V C;  1KMI Z;  4OGQ C;  1YQ3 D;  3LW5 J;  2NZ2 A;  4U7J A;  1KOR A;  2BEQ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...