3AE6C

Crystal structure of porcine heart mitochondrial complex ii bound with n-(3-isopropoxy-phenyl)-phthalamicacid
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of porcine heart mitochondrial complex II bound with N-(3-Isopropoxy-phenyl)-phthalamicacid
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
total genus 43
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3ae6C01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3ae6C02
2WS3C 3AE4C 3P4SD 3AEFD 3VR8C 5C3JC 3AEAC 1YQ4C 4YTMD 1QLBC 1L0VD 3ABVD 4YTND 3VR8D 1KF6C 5C2TC 1PV3A 2WDQD 4YXDD 3VRAC 2ACZD 3SFED 3AE3D 3CIRD 2WS3D 3AE6D 1YQ3D 3P4QC 3AE8D 2WDVD 2FBWD 2WU2C 2WP9D 3CIRC 3AE2C 1KTMA 2WDRC 3AE7C 3VR9C 2ACZC 3SFDC 2WU2D 3S9OA 3AECD 1OW6A 4YSXD 3SFDD 3ABVC 4YTNC 1K05A 1KFYC 3AE9D 3AEDD 4YT0D 2WU5C 2WDVC 2WDQC 4KX6D 1ZOYD 1NENC 1KF6D 3P4QD 4YSYD 4YSZC 3AE7D 2WQYC 3SFEC 3AE4D 3AE5C 1OW7A 4YTMC 3P4PD 2FBWC 1K04A 1NEKC 3AEED 3AEFC 3AEEC 4YTPD 2H88D 1E7PC 3AE3C 3AE5D 1YQ4D 4YXDC 2H88C 3P4SC 3P4PC 3B71A 2BS3C 3AEGD 4YT0C 1ZP0C 2WQYD 1KFYD 3AEAD 4YTPC 2G3AA 4YSXC 1NEND 1NEKD 1ZOYC 2WU5D 3AE1C 2H89D 3VR9D 3VRBD 4YSZD 4YSYC 3P4RD 3AECC 4KX6C 3P4RC 2B76D 2WDRD 3AEBD 1ZP0D 2BS2C 3AE2D 3AE9C 3AEDC 2H89C 3VRAD 1OW8A 3AE8C 1YQ3C 3VRBC 3AE6C 1L0VC 2BS4C 3AEGC 3AE1D 3AEBC 2WP9C 2B76C 5C3JD 5C2TD
chains in the Genus database with same CATH superfamily
1GMJA 2Y0CA 3W67A 2JR8A 4RO0A 3CCSP 1BGYG 1NTMG 2B87B 1L0NG 2R3CA 3PP5A 3VMAA 2WT7A 1VF5C 2WS3D 4KJMA 3AE6D 2P7JA 1JCCA 4U3FD 1EDIA 1UIIA 5APXA 3RK2B 1NTME 1L0NE 2JJLA 1JY3P 4W80A 1QL1A 3BCCJ 1LTJB 2ZYGA 3B5NA 4Z1MH 2ZXXA 1NU1E 2QVAA 1OW7A 3RK3C 3WU2E 1QLED 1EDLA 5CBNA 1BSHA 2H88C 4QMAA 3TNUB 1BE3D 1KILC 1GU4A 1J2JB 1KQFB 2BEQD 5APWA 3I56P 2IYOA 1NH4A 1XTGB 2ZYAA 1SFCA 4U3FG 1S1CX 2RMZA 2RH0A 5B5EH 2FYUD 3UIAA 4H44D 5H2FH 3AEGC 4U3FE 5C3JD 2E5YA 3A3YB 3RL0g 4I6MC 3FX0A 2PAJA 3P4SD 4H13B 1T8ZA 3L70J 4D6TD 2QM7A 2M8RA 2G8YA 3M0AA 1SQXD 2FYUE 1IJDB 1YQ3D 1CSBA 1HH0A 2NPSC 2P2UA 5C39A 1LTBC 2WDRC 1NKZB 3VN0A 1M1KQ 1NAYA 1CW5A 2KB7P 4YSXD 3TYYA 1SQXJ 5AVUB 4I1LA 2IZ0A 2K1AA 1Z56A 3D70A 3PHLA 4YSYD 1LTIC 4WY4A 1Q7YQ 1KYOE 1N7LA 4PD4I 3BRTB 2Q5UA 4DHZA 1NGMB 1G2CB 1ZRTD 1SQVG 3EWKA 2K9JA 1PIXA 1UIXA 4IL6E 4OGQB 1DH3A 2XKMA 2E75D 3AE1C 1JMBA 3I5CA 1FZEA 5E79E 2JP3A 1JUNA 2YO2A 3CCUP 2FYUJ 2VRSA 2AXTE 1EXJA 3Q5SA 1BCCD 2KXPB 3FXDA 3L71D 1LWUB 2GA1A 1R5LA 3M06A 5APQA 1RH5B 5C3JC 1LWUA 5KLVJ 3H1JD 4OGQD 2E75B 1RF0C 1SQVK 5GTHE 1NOHA 3SFED 1KB9E 3GHGB 3GF3A 1GL2D 1VQ4P 1RY3A 3WUTA 3AE7C 3V2RA 1U7MA 3CPWO 1NYHA 3A2AA 1KZUB 3W68A 1FZCC 3V6IA 1PGQA 3VOPA 5KKZC 2YXRB 2XV5A 4EOTA 4R4LA 1QVFO 1N73B 4M3LA 2WSFH 4WY4D 2P1JA 1ZLLA 2FYNC 1N7SB 3CWBJ 1VPCA 1VQMP 1GU5A 3RL0C 2NZ2A 3V4WA 2K88A 1NU1J 3WUUA 1M56D 1NKNA 2IFMA 4WY4B 1NTZJ 1SQPJ 3L73J 3G9RA 1S3JA 3USSA 3L73G 2G3AA 2N1TC 2NPSB 4DOJA 3VR9D 4PD4D 1NU1G 1FDIA 5M1BA 5KAFH 1YJNP 1RHZB 4XA4A 3AEBD 2IBZE 3JC22 1BCCE 1WT6A 3RK2D 1PP9G 2QJPB 2BS4C 1SQVE 1L4AB 3OAKA 3L74J 5GTIH 1USEA 1BCCG 1KB9D 5KLVK 4GIFA 1NTKJ 4BWNA 4WBAA 1DX7A 4ASWA 1EDJA 1X8YA 1NAFA 2KS1B 3TGUG 2ZFYA 3CCJP 3MTUE 2FXMA 5DJUB 3VP8A 4YTND 1VQKP 1SQXK 5KJ7C 1J1EB 2WPRA 3MUDA 3CIRD 1YJ9P 1ZR2A 4EDFA 2JWDA 3E7KA 4DCKA 4EI2A 3CI9A 5AW0B 5DJTB 3ABVC 3U1CA 1U7JA 2WSCJ 4JYBA 2WU5C 1URQD 1AJYA 1NTZG 4C46A 1BDDA 1GL2A 2E76D 2V7QJ 4IFDK 1Y8AA 1JB0J 2WPQA 2FYUG 2PGDA 2CPSA 1RE4A 2H88D 4H44B 1IO4A 1NU1D 3K5BA 4XE5B 2IDBA 4AQRD 2HG5D 3P4SC 3L75J 1YI2P 3RK3D 2IBZD 1YYCA 5KTBA 1WMKA 3M0DA 1RF0A 4N78E 3L37A 1H88A 2R5BA 4K35A 4DJGA 2SPZA 4N6JA 1N73A 2K3RA 3AEDC 1H0TB 1T2KD 4RKUJ 3Q3DA 4BRYB 1BGYE 3F89A 1ZV8A 1LP1B 2H8PD 4EIJA 1QLBC 5AVSB 3N7NA 4WY4C 5K5GB 2IBZG 2YMKA 1NTMK 3AE3D 1S5LE 5E79H 2KP8A 3V4QA 4UB6H 3A0BE 1MUUA 3H25A 2R3SA 2XDJA 4Y99B 1URQC 2N1TD 3MHVA 5AW1B 3CC4P 4GOFA 1IK9A 3H1KD 4YSZC 2OARA 2WQYC 4K3AA 1JO5A 1FDOA 1PGJA 1NEKC 5TISH 3AEEC 2I1JA 1BGYD 5APUA 1K9MQ 1YJWP 3H1IJ 1KD1Q 3B71A 2MKVA 1YHQP 4KHXA 4YTPC 1EXIA 3CMAP 1L0LD 3P8CE 2R5DA 2BCCE 3CCRP 3H1LG 3LIEA 3NXSA 1QVGO 1M8OB 3VRAD 1KILD 2YXQB 2HODB 1U57A 3CLQA 3CCQP 1FZAA 3AEBC 3AE1D 2A45G 3N4XA 3HE4B 3GW6A 3HE5A 3PLNA 3GF7A 1P84D 1KFMA 4OH8B 3ITKA 3KZIE 3KZIH 3AEAC 2Q3IA 1Q81Q 2O01H 1SQVD 2OYOA 1S9KD 2N9BA 3TNUA 4I7ZB 2B88A 1KILA 2K9YA 3IR9A 1G1JA 3B5ND 1FZFA 1FU1A 1H89A 1W2EA 3SFDC 3T97A 4EYYQ 2KZJA 2CK3H 3L72G 1T3JA 2XNXA 1IZNB 2NPSD 4JPZB 2ZT9D 1VDFA 3AE7D 1SFCB 2A06G 2M3EA 4PD4H 3RBZA 5CHXA 3CCLP 2WPVB 3H1ID 2YKQA 5AVQB 2WT7B 1YQ4D 2HFED 3SSUA 4CPGA 2Q1KA 2YO3A 1A02J 3BCCG 1GW4A 1NTZE 1VQLP 3CL3D 1P84E 2N9YB 4LDTA 3MGNA 3SWKA 2WDRD 4FJVA 3ZDMA 3CX5H 3NTNA 2O1KA 4NPFX 1M57D 1VQ6P 1PGPA 1YQ3C 3HRNA 1BGYJ 2IFNA 4L75A 2W90A 2QJKB 3JCUH 1LT1A 2IPPA 1H8AA 4WB4A 4DDGA 3AE4C 1IFJA 2J58A 1LP1A 3C1LA 4D6TJ 1L4AA 2B89A 1EDKA 3G6EP 3A7OA 2B87A 1S9KE 2RN0A 2O3JA 1L0ND 1NVOA 1NTMD 3HE4A 3NMDA 1OX3A 1KV4A 2PFXA 1YIJP 2WU2C 3MD0A 2OYIC 5CJ4A 1ZR4A 4IL6X 4UB8H 1L0LJ 1KFYC 3RK3E 4YT0D 3B4SA 1ZOYD 1JNMA 2W6JH 1Y9BA 5CCGC 4WWIA 1HTLC 1TU3F 1W5CE 2FBWC 1SQPD 3E1IA 3MIWA 4W7ZA 2YKPA 2E76B 3VONA 2J59M 1NTKG 1GDTA 1ZP0C 3CWBD 2H89D 1HUCA 3P4RD 1NWQA 2A06E 2B76D 1NTKE 3L75D 1ZP0D 1ZW0A 3CCVP 2GM4A 2OYHA 2E75C 3TGUE 3L74E 3LW5H 4RESB 3VRBC 3T97B 3S4RA 3PJSK 4O9BA 3QWOC 1N73C 1SLQA 1QL2A 1LT9A 5AVZB 4DHIB 1RE3A 2R32A 1MKMA 3TDKA 5AW7B 3CMEP 5APTA 1YQ4C 4A7PA 3M0DC 1FJPA 3H1LE 2O1JA 1W2BO 1L0NK 1S5LH 5APYA 2C0WA 1SS1A 3P4QC 2CPBA 2QEXP 3L70E 1H0TA 1KYOD 1IFPA 3S9OA 3AECD 1OW6A 3CWBE 3SWYA 2YIUC 2QJPC 3L71G 5B66H 3AE4D 4HB1A 2NRGA 4N78D 1NTZD 2Y0EA 2IZ1A 4YXDC 3MUDC 3L72E 1FZCB 1FBMA 3H1KJ 1FZBA 2HPCA 3O6QA 3AEGD 3A5TA 2WQYD 2KNCA 5KKZB 1NEKD 5AVTB 2C9LY 1PGOA 3CCEP 1SQXG 2A45I 1QEXA 5KLVE 3AECC 1VQ5P 1N7SC 1Q82Q 3O6QB 5APSA 3AE2D 2H89C 2D2CB 2WMMA 1J1EC 3GHGA 1Q90D 1SQBK 1L0VC 3KDPB 3A0HH 3WUVA 3V5BA 4ZKUA 1FOSE 3LW5J 1K8AQ 4OWFA 1L2PA 3EFGA 4GOEA 2FYUK 2O01N 3JSVC 2H7HA 2PP6A 3Q1MA 3ABVD 1FZCA 4C7RA 2QJYB 5C2TC 2ACZD 2WZ7A 1DIPA 3H1KG 2JEEA 4TT3H 4ASVA 2OGUA 3B8EB 1RE3C 3AEDD 3CX5I 2IYPA 3I55P 1KF6D 2W6AA 3L71J 3O8ZA 5AVWB 4PD4E 3C8VA 2M0BA 4LLHA 3M9QA 1BCCJ 1E7PC 1CZQA 1YTZT 2BCCG 1NHLA 1LTJA 2HLOA 4H0LB 4LGDE 1M1JC 2QG4A 3MP7B 2KOGA 3HTKB 2AEFA 1N8RQ 2KI7B 1SQPE 1KQSO 3II6A 4YSYC 1CI6B 2Y9ZA 2HR3A 3Q2YA 5AVRB 4U3FJ 2Q3EA 1R8EA 3GG2A 2B76C 4YPCA 3D6YA 4DHJA 4BXLA 3HD7D 3H1JJ 2QIWA 5KLVD 2E74C 3L35A 2AEJA 1URQB 5KLIC 2OYIA 1FS0E 1HJBA 3P7KA 1KB9I 2B9BA 4IFFA 3L74G 3H1HE 2M3BA 2HPCB 1ZXGA 1OIPA 4AUWA 1NO4A 1PP9J 4PV1C 3AE8D 2WDVD 1KORA 1OXZA 1G2CA 3WMM0 1N7SD 1HWTC 3MZWB 2D2CC 4GODA 3SFDD 3KXDA 4R4MA 1PL5A 2E5TA 3F5HA 2JO1A 2IX7C 1KYOH 3BCCE 5AVVB 3AE5C 2FFDC 4YTMC 1KN7A 3VMYA 1HJ0A 1HGVA 1NTMJ 3AE5D 2WSSH 2OTLP 3VP9A 4GKGA 4ZMDA 3CWBG 4AYCA 2QJYC 1S72P 1JY2N 3BASA 4IL6H 3B5NB 4YSXC 2C9NY 3P8CD 5CCHD 3BCCD 5BU8B 1DD3A 3BVHA 3P4RC 2YNYA 2ZVNB 2FKWB 4D6TG 1PPJE 2RKLA 1RF1C 1G1IA 3H32A 2KLUA 5AVXB 2Q7CA 1KFNA 1LT9C 3L72J 1SQVJ 1SFCC 2WS3C 1VF5D 4HYTB 2E42A 3H1HD 1A02F 3CD6P 1SQXE 1X79B 4H0LD 3HUSB 1SQPG 5TISE 5KLVG 4H0LC 4DZOA 3H6PA 1SFCD 1SQBE 1FE6A 5BVZA 2WDQD 4YXDD 1FAVA 3L4FA 4PV1D 2Q6QA 3GMAA 2W6BA 3CIRC 2OYHB 1XTCC 4PJ0E 1SQBG 2WU2D 5KJ7D 3EFFK 2ZXEB 4YTNC 3TGUD 1KILE 1OVVA 3NFQA 1X0TA 1FDMA 1SP4A 4HH2A 1DEEG 3FXEA 1J1DB 1VQ7P 1NTZK 2I1KA 1BE3J 1M90Q 3P4PD 1K04A 5KAIE 3HD7C 1SQQJ 3H1HG 3FGAD 4TLFA 3G3ZA 1LNQA 1JCDA 1OMIA 2POHA 2HODA 1PZQA 2ZYDA 1KFYD 5CCGD 3AEAD 3H1JE 1USDA 2FY8A 1ZMEC 1HVVA 2UWJE 2Q9IA 5B5EE 2BEZF 4W7YA 2AEMA 2LR2A 3IFMA 1VQ9P 1IFNA 4JBZA 1AV1A 4XFJA 2QSIA 1YITP 2OQQA 2J5UA 1PPJD 5AW6B 1Q86Q 1M7LA 2QE7H 5GTIE 2OYIB 1GK6A 2W8ZA 1URQA 2YMYA 5KAIH 3H1LJ 3AEFD 3FWLA 3V2QA 3L70G 3P8MC 3L73D 1L0VD 3L74D 2E76C 2JWAA 1JM0A 5AW5B 1P84I 3TSIA 3L71E 2L91A 2QJKC 2FBWD 2ZT9B 2P58A 1OVUA 2R44A 1LTTC 2HYNA 1LJ2A 5AW8B 3CXHI 4MN4C 2WVRA 3HD7A 3FWNA 1MV8A 2WDVC 5KAFE 2W83C 3HTKA 3U59A 2Z5IA 2ITAA 4H13D 4HJGH 3WU2H 1YTZI 5AVYB 1SQQG 2OTKE 1SQQK 5CMZA 3TF5A 3L72D 1JTHB 4N3YB 1T6AA 2E74D 3CXHH 1M1JA 1EZVD 1VF5B 1LTJC 2WSCH 4NPEA 4ZNCA 3HUSA 1MZ9A 3RK2C 1P84H 3GLMA 2ZJSE 3TK1A 1VQNP 1RE4C 5CBOA 2K37A 1OW8A 3KHUA 2JKVA 1HF9A 3H32B 1KC8Q 4YXWH 1EZVI 1E5WA 3AE6C 1KILB 4IOIH 5L8RJ 3RK3B 1BDCA 2KUBA 3LIDA 2LXCB 5AW4B 5EFWB 3D71A 2L5GB 1RF1A 3H1KE 1GL2B 3JCUE 1RQUA 3H1LD 3KYQA 4D6TE 2LXBA 2GUSA 2C0XA 2O01J 3HE5B 1PV3A 3KQGA 2DW3A 4I6LA 3VRAC 3CXHE 1GK4A 1K73Q 3AE2C 3A0BH 1DEBA 2GUVA 2V7QH 5B66E 2FFDA 2WSEH 3S1KA 1VQPP 3RBXA 5BU5A 3SFEC 5TJHA 4JQ0D 1SQPK 1D7MA 1N7SA 2QA4P 5KJ7A 1S2EA 1L0NJ 1L0LK 3R2PA 5AW3B 3CXHD 1VL2A 4LC1A 3P4PC 1JY3O 1SQQD 2JDIH 4YT0C 2YIUB 1NEND 1JOCA 1GW3A 2KZIA 3L70D 3QH9A 2FXPA 2ZT9C 3CCMP 4PJ0H 2BCCJ 4KX6C 3TGUJ 2AXCA 4UB6E 3G4SP 3AE8C 4HKZH 5CCHC 1PP9D 2N1TA 2XNDH 3H1JG 1CI6A 1JMMA 4OGQC 3C9IA 1WRGA 3RGUA 3VTPC 3VR8C 4ZKPA 4YTMD 1SVFA 2E43A 3H1IG 3VR8D 2WITA 1NJIQ 1BSNA 2M5AB 2MJZA 2FYNB 1GTWA 2KSJA 4BRYA 3VYIA 1AVOA 1L4AD 1S4XA 2WP9D 4JYCA 4C7NB 5CJ0A 2ACZC 1L0LE 1LWUC 3VMZA 1M1JB 1K05A 1IFMA 3P4QD 4L73A 4GT1A 1FZGA 1GL2C 2AXTH 1KQLA 3AEFC 1KYOI 1MFZA 3CX5D 1EZVE 3AE3C 5CCHA 4C7NA 1JY2P 2P10A 5KLIB 1PPJG 2KSEA 3IAOA 1LTSC 5APVA 1OWAA 1NTKK 3GHGC 4UB8E 1R5SA 1ZOYC 1OFCX 2WU5D 2WTYA 1QGKB 5AW9B 2KK7A 2ZAEB 2D2CD 4B86A 2W27A 1OZHA 1KQGB 1SQQE 1KB9H 1T3UA 3AE9C 3CC7P 3RL0B 2XZRA 1SQBD 1BE3E 3IN6A 3L36A 3Q5RA 1JY2O 3KPEA 1JY3N 3L75E 1HGZA 5C2TD 1Q2NA 1HBWA 2ZFCA 1TFFA 2M5AA 2BCCD 1IFDA 2FFDB 3RL0D 1ZN5A 3U1AA 2FYZA 3G71P 1JEKA 2KS1A 1GD2E 3M91A 2KNCB 4U7JA 3L75G 1AQ5A 2WSFJ 1KF6C 1SQBJ 2N1TB 4NPDA 1Y47A 1KMIZ 1L4AC 2ZVOB 2V4HA 4H44C 2BASA 1X9VA 3VR9C 2E74B 4WVZA 2QM8A 3AE9D 4L76A 4RJTA 2WDQC 2XU6A 2NPSA 2PRRA 3E1RA 3H1IE 1VQOP 3CX5E 2P67A 1E79H 3P32A 3AEED 1FJKA 4I2LC 4PV1B 5GTHH 2WPSA 3PRJA 1DD4A 2Y9YA 3EQ2A 1LTAC 1AQTA 1LGHB 2LKMA 3D6ZA 3OA7A 1OVRA 3HUSC 2FXOA 1JTHA 3PTZA 3OW2O 2Z5HA 4DDIA 1EZVG 2OTJP 3L73E 1MFTA 4KT0J 4OVNF 2WP9C 2WWWA 4GDOA 1FC2C 4JF7A 1S5LX 3B5NC 5H2FE 3SWFA 2OYHC 3BRVB 4DT0A 3R4YA 2KLVA 2KIKA 1PP9E 5AW2B 1N2DC 1RF1B 1J1DC 3H1HJ 1T2KC 1AVYA 3CC2P 1BE3G 2A06D 1RQVA 1LT9B 2A45H 2K9JB 1EQ7A 3A0HE 1KTMA 3OJAB 2WSEJ 4L74A 3M9BA 1FOSF 3V2NA 1IFIA 1LTGC 4Y28J 4KX6D 5CCGA 1NENC 3M9HA 2YKOA 2QRXA 1N86A 1PFIA 3VMXA 1VQ8P 2Y0DA 1YBKA 4YTPD 1IK7A 4H13C 1L0LG 3BATA 2I8DA 4Y99C 2Z4EA 2BS3C 1NTKD 1ZRTE 1AA0A 1QX8A 1NU1K 1AFOA 3IF4A 1EC5A 3PH0A 3VRBD 4YSZD 1GZLA 2IBZI 3HD7B 2BS2C 3Q5PA 1X22A 4I7ZC 2H43A 4IFMA 1IC2A 2KYVA 3V2PA
chains in the Genus database with same CATH topology
4OGQC 2QIWA 1GMJA 3RL0g 3D71A 1VF5D 2WS3C 3AE4C 1MKMA 2E74C 3GF7A 3P4SD 4H0LD 4H13B 3R4YA 3AEFD 3VR8C 5C3JC 3AEAC 4H0LC 5KLIC 1YQ4C 4YTMD 1QLBC 4U7JA 1RQUA 1L0VD 4OGQD 3Q1MA 2WSFJ 3ABVD 4YTND 2E76C 2G8YA 3VR8D 2E75B 1KF6C 2O01J 5C2TC 2YMKA 1PV3A 4I7ZB 2WDQD 4YXDD 3VRAC 2ACZD 3SFED 3AE3D 3CIRD 1VF5C 3D6YA 3GF3A 2WS3D 3AE6D 1YQ3D 2K9YA 1KMIZ 4PV1D 3P4QC 1RQVA 1DIPA 4H44C 2QJKC 4PV1C 3AE8D 2WDVD 4TT3H 2FBWD 2WU2C 2ZT9B 3GMAA 2WP9D 1KORA 3AE2C 1KTMA 2WDRC 3AE7C 3CIRC 2ACZC 3VR9C 3SFDC 1NYHA 4IL6X 2WU2D 2E74B 2WSEJ 3S9OA 2D2CC 3H25A 3AECD 1OW6A 4YSXD 3SFDD 3ABVC 4YTNC 5C2TD 1K05A 1KILE 1KFYC 3AE9D 3RK3E 3AEDD 2WSCJ 5KKZC 4R4MA 4YT0D 2WU5C 2YIUC 1AJYA 4Y28J 2WDVC 2WDQC 1PL5A 4KX6D 1ZOYD 3D70A 2QJPC 1NENC 1KF6D 4Z1MH 4R4LA 3P4QD 4YSYD 1Y9BA 2E76D 2V7QJ 2JO1A 1JB0J 2ZT9D 4YSZC 3AE7D 2WQYC 3SFEC 3AE4D 3AE5C 4H13D 1TU3F 1OW7A 2FYNC 3C8VA 1FDOA 2FBWC 3P4PD 4YTMC 1K04A 1NEKC 3AEED 1HJ0A 3AEFC 3AEEC 4YTPD 1NGMB 2H88D 4H44B 3FGAD 2WPVB 4PV1B 1IK7A 1E7PC 3AE3C 4H13C 3AE5D 1YQ4D 4YXDC 2H88C 2IDBA 1OMIA 2NZ2A 2P10A 4H0LB 1DD4A 3EWKA 1VL2A 2E76B 3P4SC 3P4PC 3B71A 2MKVA 2E74D 3IAOA 2QJYC 3O6QA 1KQFB 2BEQD 2BS3C 3AEGD 4YT0C 1WMKA 1ZP0C 2WQYD 1KFYD 1ZRTE 1PIXA 1UIXA 4YTPC 1EXIA 3AEAD 1VF5B 3G9RA 3D6ZA 4OGQB 2G3AA 4YSXC 1ZMEC 1NEKD 1NEND 1ZOYC 2E75D 2WU5D 3AE1C 2H89D 2BEZF 3VR9D 3VRBD 1FDIA 2FXPA 2ZT9C 4YSZD 5M1BA 4YSYC 3P4RD 2D2CD 3AECC 1DD3A 4KX6C 1S1CX 3P4RC 2B76D 2JP3A 3GLMA 1KQGB 2WDRD 3AEBD 1ZP0D 2BS2C 3Q2YA 3AE9C 3AEDC 3Q5PA 2H89C 3AE2D 2D2CB 3VRAD 1OW8A 2E75C 4H44D 3AE8C 1HF9A 3IN6A 3VRBC 4I7ZC 1Q90D 1YQ3C 4XFJA 4RKUJ 2QSIA 3Q5RA 1U57A 4KT0J 3Q3DA 3AE6C 3Q5SA 2OQQA 1EXJA 1L0VC 1R8EA 2BS4C 3AEGC 3AE1D 3AEBC 2J5UA 3T97B 4GDOA 2WP9C 5L8RJ 2B76C 5C3JD 1S5LX 3LW5J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WS3 C;  3AE4 C;  3P4S D;  3AEF D;  3VR8 C;  5C3J C;  3AEA C;  1YQ4 C;  4YTM D;  1QLB C;  1L0V D;  3ABV D;  4YTN D;  3VR8 D;  1KF6 C;  5C2T C;  1PV3 A;  2WDQ D;  4YXD D;  3VRA C;  2ACZ D;  3SFE D;  3AE3 D;  3CIR D;  2WS3 D;  3AE6 D;  1YQ3 D;  3P4Q C;  3AE8 D;  2WDV D;  2FBW D;  2WU2 C;  2WP9 D;  3CIR C;  3AE2 C;  1KTM A;  2WDR C;  3AE7 C;  3VR9 C;  2ACZ C;  3SFD C;  2WU2 D;  3S9O A;  3AEC D;  1OW6 A;  4YSX D;  3SFD D;  3ABV C;  4YTN C;  1K05 A;  1KFY C;  3AE9 D;  3AED D;  4YT0 D;  2WU5 C;  2WDV C;  2WDQ C;  4KX6 D;  1ZOY D;  1NEN C;  1KF6 D;  3P4Q D;  4YSY D;  4YSZ C;  3AE7 D;  2WQY C;  3SFE C;  3AE4 D;  3AE5 C;  1OW7 A;  4YTM C;  3P4P D;  2FBW C;  1K04 A;  1NEK C;  3AEE D;  3AEF C;  3AEE C;  4YTP D;  2H88 D;  1E7P C;  3AE3 C;  3AE5 D;  1YQ4 D;  4YXD C;  2H88 C;  3P4S C;  3P4P C;  3B71 A;  2BS3 C;  3AEG D;  4YT0 C;  1ZP0 C;  2WQY D;  1KFY D;  3AEA D;  4YTP C;  2G3A A;  4YSX C;  1NEN D;  1NEK D;  1ZOY C;  2WU5 D;  3AE1 C;  2H89 D;  3VR9 D;  3VRB D;  4YSZ D;  4YSY C;  3P4R D;  3AEC C;  4KX6 C;  3P4R C;  2B76 D;  2WDR D;  3AEB D;  1ZP0 D;  2BS2 C;  3AE2 D;  3AE9 C;  3AED C;  2H89 C;  3VRA D;  1OW8 A;  3AE8 C;  1YQ3 C;  3VRB C;  3AE6 C;  1L0V C;  2BS4 C;  3AEG C;  3AE1 D;  3AEB C;  2WP9 C;  2B76 C;  5C3J D;  5C2T D; 
#chains in the Genus database with same CATH topology
 1GMJ A;  2Y0C A;  3W67 A;  2JR8 A;  4RO0 A;  3CCS P;  1BGY G;  1NTM G;  2B87 B;  1L0N G;  2R3C A;  3PP5 A;  3VMA A;  2WT7 A;  1VF5 C;  2WS3 D;  4KJM A;  3AE6 D;  2P7J A;  1JCC A;  4U3F D;  1EDI A;  1UII A;  5APX A;  3RK2 B;  1NTM E;  1L0N E;  2JJL A;  1JY3 P;  4W80 A;  1QL1 A;  3BCC J;  1LTJ B;  2ZYG A;  3B5N A;  4Z1M H;  2ZXX A;  1NU1 E;  2QVA A;  1OW7 A;  3RK3 C;  3WU2 E;  1QLE D;  1EDL A;  5CBN A;  1BSH A;  2H88 C;  4QMA A;  3TNU B;  1BE3 D;  1KIL C;  1GU4 A;  1J2J B;  1KQF B;  2BEQ D;  5APW A;  3I56 P;  2IYO A;  1NH4 A;  1XTG B;  2ZYA A;  1SFC A;  4U3F G;  1S1C X;  2RMZ A;  2RH0 A;  5B5E H;  2FYU D;  3UIA A;  4H44 D;  5H2F H;  3AEG C;  4U3F E;  5C3J D;  2E5Y A;  3A3Y B;  3RL0 g;  4I6M C;  3FX0 A;  2PAJ A;  3P4S D;  4H13 B;  1T8Z A;  3L70 J;  4D6T D;  2QM7 A;  2M8R A;  2G8Y A;  3M0A A;  1SQX D;  2FYU E;  1IJD B;  1YQ3 D;  1CSB A;  1HH0 A;  2NPS C;  2P2U A;  5C39 A;  1LTB C;  2WDR C;  1NKZ B;  3VN0 A;  1M1K Q;  1NAY A;  1CW5 A;  2KB7 P;  4YSX D;  3TYY A;  1SQX J;  5AVU B;  4I1L A;  2IZ0 A;  2K1A A;  1Z56 A;  3D70 A;  3PHL A;  4YSY D;  1LTI C;  4WY4 A;  1Q7Y Q;  1KYO E;  1N7L A;  4PD4 I;  3BRT B;  2Q5U A;  4DHZ A;  1NGM B;  1G2C B;  1ZRT D;  1SQV G;  3EWK A;  2K9J A;  1PIX A;  1UIX A;  4IL6 E;  4OGQ B;  1DH3 A;  2XKM A;  2E75 D;  3AE1 C;  1JMB A;  3I5C A;  1FZE A;  5E79 E;  2JP3 A;  1JUN A;  2YO2 A;  3CCU P;  2FYU J;  2VRS A;  2AXT E;  1EXJ A;  3Q5S A;  1BCC D;  2KXP B;  3FXD A;  3L71 D;  1LWU B;  2GA1 A;  1R5L A;  3M06 A;  5APQ A;  1RH5 B;  5C3J C;  1LWU A;  5KLV J;  3H1J D;  4OGQ D;  2E75 B;  1RF0 C;  1SQV K;  5GTH E;  1NOH A;  3SFE D;  1KB9 E;  3GHG B;  3GF3 A;  1GL2 D;  1VQ4 P;  1RY3 A;  3WUT A;  3AE7 C;  3V2R A;  1U7M A;  3CPW O;  1NYH A;  3A2A A;  1KZU B;  3W68 A;  1FZC C;  3V6I A;  1PGQ A;  3VOP A;  5KKZ C;  2YXR B;  2XV5 A;  4EOT A;  4R4L A;  1QVF O;  1N73 B;  4M3L A;  2WSF H;  4WY4 D;  2P1J A;  1ZLL A;  2FYN C;  1N7S B;  3CWB J;  1VPC A;  1VQM P;  1GU5 A;  3RL0 C;  2NZ2 A;  3V4W A;  2K88 A;  1NU1 J;  3WUU A;  1M56 D;  1NKN A;  2IFM A;  4WY4 B;  1NTZ J;  1SQP J;  3L73 J;  3G9R A;  1S3J A;  3USS A;  3L73 G;  2G3A A;  2N1T C;  2NPS B;  4DOJ A;  3VR9 D;  4PD4 D;  1NU1 G;  1FDI A;  5M1B A;  5KAF H;  1YJN P;  1RHZ B;  4XA4 A;  3AEB D;  2IBZ E;  3JC2 2;  1BCC E;  1WT6 A;  3RK2 D;  1PP9 G;  2QJP B;  2BS4 C;  1SQV E;  1L4A B;  3OAK A;  3L74 J;  5GTI H;  1USE A;  1BCC G;  1KB9 D;  5KLV K;  4GIF A;  1NTK J;  4BWN A;  4WBA A;  1DX7 A;  4ASW A;  1EDJ A;  1X8Y A;  1NAF A;  2KS1 B;  3TGU G;  2ZFY A;  3CCJ P;  3MTU E;  2FXM A;  5DJU B;  3VP8 A;  4YTN D;  1VQK P;  1SQX K;  5KJ7 C;  1J1E B;  2WPR A;  3MUD A;  3CIR D;  1YJ9 P;  1ZR2 A;  4EDF A;  2JWD A;  3E7K A;  4DCK A;  4EI2 A;  3CI9 A;  5AW0 B;  5DJT B;  3ABV C;  3U1C A;  1U7J A;  2WSC J;  4JYB A;  2WU5 C;  1URQ D;  1AJY A;  1NTZ G;  4C46 A;  1BDD A;  1GL2 A;  2E76 D;  2V7Q J;  4IFD K;  1Y8A A;  1JB0 J;  2WPQ A;  2FYU G;  2PGD A;  2CPS A;  1RE4 A;  2H88 D;  4H44 B;  1IO4 A;  1NU1 D;  3K5B A;  4XE5 B;  2IDB A;  4AQR D;  2HG5 D;  3P4S C;  3L75 J;  1YI2 P;  3RK3 D;  2IBZ D;  1YYC A;  5KTB A;  1WMK A;  3M0D A;  1RF0 A;  4N78 E;  3L37 A;  1H88 A;  2R5B A;  4K35 A;  4DJG A;  2SPZ A;  4N6J A;  1N73 A;  2K3R A;  3AED C;  1H0T B;  1T2K D;  4RKU J;  3Q3D A;  4BRY B;  1BGY E;  3F89 A;  1ZV8 A;  1LP1 B;  2H8P D;  4EIJ A;  1QLB C;  5AVS B;  3N7N A;  4WY4 C;  5K5G B;  2IBZ G;  2YMK A;  1NTM K;  3AE3 D;  1S5L E;  5E79 H;  2KP8 A;  3V4Q A;  4UB6 H;  3A0B E;  1MUU A;  3H25 A;  2R3S A;  2XDJ A;  4Y99 B;  1URQ C;  2N1T D;  3MHV A;  5AW1 B;  3CC4 P;  4GOF A;  1IK9 A;  3H1K D;  4YSZ C;  2OAR A;  2WQY C;  4K3A A;  1JO5 A;  1FDO A;  1PGJ A;  1NEK C;  5TIS H;  3AEE C;  2I1J A;  1BGY D;  5APU A;  1K9M Q;  1YJW P;  3H1I J;  1KD1 Q;  3B71 A;  2MKV A;  1YHQ P;  4KHX A;  4YTP C;  1EXI A;  3CMA P;  1L0L D;  3P8C E;  2R5D A;  2BCC E;  3CCR P;  3H1L G;  3LIE A;  3NXS A;  1QVG O;  1M8O B;  3VRA D;  1KIL D;  2YXQ B;  2HOD B;  1U57 A;  3CLQ A;  3CCQ P;  1FZA A;  3AEB C;  3AE1 D;  2A45 G;  3N4X A;  3HE4 B;  3GW6 A;  3HE5 A;  3PLN A;  3GF7 A;  1P84 D;  1KFM A;  4OH8 B;  3ITK A;  3KZI E;  3KZI H;  3AEA C;  2Q3I A;  1Q81 Q;  2O01 H;  1SQV D;  2OYO A;  1S9K D;  2N9B A;  3TNU A;  4I7Z B;  2B88 A;  1KIL A;  2K9Y A;  3IR9 A;  1G1J A;  3B5N D;  1FZF A;  1FU1 A;  1H89 A;  1W2E A;  3SFD C;  3T97 A;  4EYY Q;  2KZJ A;  2CK3 H;  3L72 G;  1T3J A;  2XNX A;  1IZN B;  2NPS D;  4JPZ B;  2ZT9 D;  1VDF A;  3AE7 D;  1SFC B;  2A06 G;  2M3E A;  4PD4 H;  3RBZ A;  5CHX A;  3CCL P;  2WPV B;  3H1I D;  2YKQ A;  5AVQ B;  2WT7 B;  1YQ4 D;  2HFE D;  3SSU A;  4CPG A;  2Q1K A;  2YO3 A;  1A02 J;  3BCC G;  1GW4 A;  1NTZ E;  1VQL P;  3CL3 D;  1P84 E;  2N9Y B;  4LDT A;  3MGN A;  3SWK A;  2WDR D;  4FJV A;  3ZDM A;  3CX5 H;  3NTN A;  2O1K A;  4NPF X;  1M57 D;  1VQ6 P;  1PGP A;  1YQ3 C;  3HRN A;  1BGY J;  2IFN A;  4L75 A;  2W90 A;  2QJK B;  3JCU H;  1LT1 A;  2IPP A;  1H8A A;  4WB4 A;  4DDG A;  3AE4 C;  1IFJ A;  2J58 A;  1LP1 A;  3C1L A;  4D6T J;  1L4A A;  2B89 A;  1EDK A;  3G6E P;  3A7O A;  2B87 A;  1S9K E;  2RN0 A;  2O3J A;  1L0N D;  1NVO A;  1NTM D;  3HE4 A;  3NMD A;  1OX3 A;  1KV4 A;  2PFX A;  1YIJ P;  2WU2 C;  3MD0 A;  2OYI C;  5CJ4 A;  1ZR4 A;  4IL6 X;  4UB8 H;  1L0L J;  1KFY C;  3RK3 E;  4YT0 D;  3B4S A;  1ZOY D;  1JNM A;  2W6J H;  1Y9B A;  5CCG C;  4WWI A;  1HTL C;  1TU3 F;  1W5C E;  2FBW C;  1SQP D;  3E1I A;  3MIW A;  4W7Z A;  2YKP A;  2E76 B;  3VON A;  2J59 M;  1NTK G;  1GDT A;  1ZP0 C;  3CWB D;  2H89 D;  1HUC A;  3P4R D;  1NWQ A;  2A06 E;  2B76 D;  1NTK E;  3L75 D;  1ZP0 D;  1ZW0 A;  3CCV P;  2GM4 A;  2OYH A;  2E75 C;  3TGU E;  3L74 E;  3LW5 H;  4RES B;  3VRB C;  3T97 B;  3S4R A;  3PJS K;  4O9B A;  3QWO C;  1N73 C;  1SLQ A;  1QL2 A;  1LT9 A;  5AVZ B;  4DHI B;  1RE3 A;  2R32 A;  1MKM A;  3TDK A;  5AW7 B;  3CME P;  5APT A;  1YQ4 C;  4A7P A;  3M0D C;  1FJP A;  3H1L E;  2O1J A;  1W2B O;  1L0N K;  1S5L H;  5APY A;  2C0W A;  1SS1 A;  3P4Q C;  2CPB A;  2QEX P;  3L70 E;  1H0T A;  1KYO D;  1IFP A;  3S9O A;  3AEC D;  1OW6 A;  3CWB E;  3SWY A;  2YIU C;  2QJP C;  3L71 G;  5B66 H;  3AE4 D;  4HB1 A;  2NRG A;  4N78 D;  1NTZ D;  2Y0E A;  2IZ1 A;  4YXD C;  3MUD C;  3L72 E;  1FZC B;  1FBM A;  3H1K J;  1FZB A;  2HPC A;  3O6Q A;  3AEG D;  3A5T A;  2WQY D;  2KNC A;  5KKZ B;  1NEK D;  5AVT B;  2C9L Y;  1PGO A;  3CCE P;  1SQX G;  2A45 I;  1QEX A;  5KLV E;  3AEC C;  1VQ5 P;  1N7S C;  1Q82 Q;  3O6Q B;  5APS A;  3AE2 D;  2H89 C;  2D2C B;  2WMM A;  1J1E C;  3GHG A;  1Q90 D;  1SQB K;  1L0V C;  3KDP B;  3A0H H;  3WUV A;  3V5B A;  4ZKU A;  1FOS E;  3LW5 J;  1K8A Q;  4OWF A;  1L2P A;  3EFG A;  4GOE A;  2FYU K;  2O01 N;  3JSV C;  2H7H A;  2PP6 A;  3Q1M A;  3ABV D;  1FZC A;  4C7R A;  2QJY B;  5C2T C;  2ACZ D;  2WZ7 A;  1DIP A;  3H1K G;  2JEE A;  4TT3 H;  4ASV A;  2OGU A;  3B8E B;  1RE3 C;  3AED D;  3CX5 I;  2IYP A;  3I55 P;  1KF6 D;  2W6A A;  3L71 J;  3O8Z A;  5AVW B;  4PD4 E;  3C8V A;  2M0B A;  4LLH A;  3M9Q A;  1BCC J;  1E7P C;  1CZQ A;  1YTZ T;  2BCC G;  1NHL A;  1LTJ A;  2HLO A;  4H0L B;  4LGD E;  1M1J C;  2QG4 A;  3MP7 B;  2KOG A;  3HTK B;  2AEF A;  1N8R Q;  2KI7 B;  1SQP E;  1KQS O;  3II6 A;  4YSY C;  1CI6 B;  2Y9Z A;  2HR3 A;  3Q2Y A;  5AVR B;  4U3F J;  2Q3E A;  1R8E A;  3GG2 A;  2B76 C;  4YPC A;  3D6Y A;  4DHJ A;  4BXL A;  3HD7 D;  3H1J J;  2QIW A;  5KLV D;  2E74 C;  3L35 A;  2AEJ A;  1URQ B;  5KLI C;  2OYI A;  1FS0 E;  1HJB A;  3P7K A;  1KB9 I;  2B9B A;  4IFF A;  3L74 G;  3H1H E;  2M3B A;  2HPC B;  1ZXG A;  1OIP A;  4AUW A;  1NO4 A;  1PP9 J;  4PV1 C;  3AE8 D;  2WDV D;  1KOR A;  1OXZ A;  1G2C A;  3WMM 0;  1N7S D;  1HWT C;  3MZW B;  2D2C C;  4GOD A;  3SFD D;  3KXD A;  4R4M A;  1PL5 A;  2E5T A;  3F5H A;  2JO1 A;  2IX7 C;  1KYO H;  3BCC E;  5AVV B;  3AE5 C;  2FFD C;  4YTM C;  1KN7 A;  3VMY A;  1HJ0 A;  1HGV A;  1NTM J;  3AE5 D;  2WSS H;  2OTL P;  3VP9 A;  4GKG A;  4ZMD A;  3CWB G;  4AYC A;  2QJY C;  1S72 P;  1JY2 N;  3BAS A;  4IL6 H;  3B5N B;  4YSX C;  2C9N Y;  3P8C D;  5CCH D;  3BCC D;  5BU8 B;  1DD3 A;  3BVH A;  3P4R C;  2YNY A;  2ZVN B;  2FKW B;  4D6T G;  1PPJ E;  2RKL A;  1RF1 C;  1G1I A;  3H32 A;  2KLU A;  5AVX B;  2Q7C A;  1KFN A;  1LT9 C;  3L72 J;  1SQV J;  1SFC C;  2WS3 C;  1VF5 D;  4HYT B;  2E42 A;  3H1H D;  1A02 F;  3CD6 P;  1SQX E;  1X79 B;  4H0L D;  3HUS B;  1SQP G;  5TIS E;  5KLV G;  4H0L C;  4DZO A;  3H6P A;  1SFC D;  1SQB E;  1FE6 A;  5BVZ A;  2WDQ D;  4YXD D;  1FAV A;  3L4F A;  4PV1 D;  2Q6Q A;  3GMA A;  2W6B A;  3CIR C;  2OYH B;  1XTC C;  4PJ0 E;  1SQB G;  2WU2 D;  5KJ7 D;  3EFF K;  2ZXE B;  4YTN C;  3TGU D;  1KIL E;  1OVV A;  3NFQ A;  1X0T A;  1FDM A;  1SP4 A;  4HH2 A;  1DEE G;  3FXE A;  1J1D B;  1VQ7 P;  1NTZ K;  2I1K A;  1BE3 J;  1M90 Q;  3P4P D;  1K04 A;  5KAI E;  3HD7 C;  1SQQ J;  3H1H G;  3FGA D;  4TLF A;  3G3Z A;  1LNQ A;  1JCD A;  1OMI A;  2POH A;  2HOD A;  1PZQ A;  2ZYD A;  1KFY D;  5CCG D;  3AEA D;  3H1J E;  1USD A;  2FY8 A;  1ZME C;  1HVV A;  2UWJ E;  2Q9I A;  5B5E E;  2BEZ F;  4W7Y A;  2AEM A;  2LR2 A;  3IFM A;  1VQ9 P;  1IFN A;  4JBZ A;  1AV1 A;  4XFJ A;  2QSI A;  1YIT P;  2OQQ A;  2J5U A;  1PPJ D;  5AW6 B;  1Q86 Q;  1M7L A;  2QE7 H;  5GTI E;  2OYI B;  1GK6 A;  2W8Z A;  1URQ A;  2YMY A;  5KAI H;  3H1L J;  3AEF D;  3FWL A;  3V2Q A;  3L70 G;  3P8M C;  3L73 D;  1L0V D;  3L74 D;  2E76 C;  2JWA A;  1JM0 A;  5AW5 B;  1P84 I;  3TSI A;  3L71 E;  2L91 A;  2QJK C;  2FBW D;  2ZT9 B;  2P58 A;  1OVU A;  2R44 A;  1LTT C;  2HYN A;  1LJ2 A;  5AW8 B;  3CXH I;  4MN4 C;  2WVR A;  3HD7 A;  3FWN A;  1MV8 A;  2WDV C;  5KAF E;  2W83 C;  3HTK A;  3U59 A;  2Z5I A;  2ITA A;  4H13 D;  4HJG H;  3WU2 H;  1YTZ I;  5AVY B;  1SQQ G;  2OTK E;  1SQQ K;  5CMZ A;  3TF5 A;  3L72 D;  1JTH B;  4N3Y B;  1T6A A;  2E74 D;  3CXH H;  1M1J A;  1EZV D;  1VF5 B;  1LTJ C;  2WSC H;  4NPE A;  4ZNC A;  3HUS A;  1MZ9 A;  3RK2 C;  1P84 H;  3GLM A;  2ZJS E;  3TK1 A;  1VQN P;  1RE4 C;  5CBO A;  2K37 A;  1OW8 A;  3KHU A;  2JKV A;  1HF9 A;  3H32 B;  1KC8 Q;  4YXW H;  1EZV I;  1E5W A;  3AE6 C;  1KIL B;  4IOI H;  5L8R J;  3RK3 B;  1BDC A;  2KUB A;  3LID A;  2LXC B;  5AW4 B;  5EFW B;  3D71 A;  2L5G B;  1RF1 A;  3H1K E;  1GL2 B;  3JCU E;  1RQU A;  3H1L D;  3KYQ A;  4D6T E;  2LXB A;  2GUS A;  2C0X A;  2O01 J;  3HE5 B;  1PV3 A;  3KQG A;  2DW3 A;  4I6L A;  3VRA C;  3CXH E;  1GK4 A;  1K73 Q;  3AE2 C;  3A0B H;  1DEB A;  2GUV A;  2V7Q H;  5B66 E;  2FFD A;  2WSE H;  3S1K A;  1VQP P;  3RBX A;  5BU5 A;  3SFE C;  5TJH A;  4JQ0 D;  1SQP K;  1D7M A;  1N7S A;  2QA4 P;  5KJ7 A;  1S2E A;  1L0N J;  1L0L K;  3R2P A;  5AW3 B;  3CXH D;  1VL2 A;  4LC1 A;  3P4P C;  1JY3 O;  1SQQ D;  2JDI H;  4YT0 C;  2YIU B;  1NEN D;  1JOC A;  1GW3 A;  2KZI A;  3L70 D;  3QH9 A;  2FXP A;  2ZT9 C;  3CCM P;  4PJ0 H;  2BCC J;  4KX6 C;  3TGU J;  2AXC A;  4UB6 E;  3G4S P;  3AE8 C;  4HKZ H;  5CCH C;  1PP9 D;  2N1T A;  2XND H;  3H1J G;  1CI6 A;  1JMM A;  4OGQ C;  3C9I A;  1WRG A;  3RGU A;  3VTP C;  3VR8 C;  4ZKP A;  4YTM D;  1SVF A;  2E43 A;  3H1I G;  3VR8 D;  2WIT A;  1NJI Q;  1BSN A;  2M5A B;  2MJZ A;  2FYN B;  1GTW A;  2KSJ A;  4BRY A;  3VYI A;  1AVO A;  1L4A D;  1S4X A;  2WP9 D;  4JYC A;  4C7N B;  5CJ0 A;  2ACZ C;  1L0L E;  1LWU C;  3VMZ A;  1M1J B;  1K05 A;  1IFM A;  3P4Q D;  4L73 A;  4GT1 A;  1FZG A;  1GL2 C;  2AXT H;  1KQL A;  3AEF C;  1KYO I;  1MFZ A;  3CX5 D;  1EZV E;  3AE3 C;  5CCH A;  4C7N A;  1JY2 P;  2P10 A;  5KLI B;  1PPJ G;  2KSE A;  3IAO A;  1LTS C;  5APV A;  1OWA A;  1NTK K;  3GHG C;  4UB8 E;  1R5S A;  1ZOY C;  1OFC X;  2WU5 D;  2WTY A;  1QGK B;  5AW9 B;  2KK7 A;  2ZAE B;  2D2C D;  4B86 A;  2W27 A;  1OZH A;  1KQG B;  1SQQ E;  1KB9 H;  1T3U A;  3AE9 C;  3CC7 P;  3RL0 B;  2XZR A;  1SQB D;  1BE3 E;  3IN6 A;  3L36 A;  3Q5R A;  1JY2 O;  3KPE A;  1JY3 N;  3L75 E;  1HGZ A;  5C2T D;  1Q2N A;  1HBW A;  2ZFC A;  1TFF A;  2M5A A;  2BCC D;  1IFD A;  2FFD B;  3RL0 D;  1ZN5 A;  3U1A A;  2FYZ A;  3G71 P;  1JEK A;  2KS1 A;  1GD2 E;  3M91 A;  2KNC B;  4U7J A;  3L75 G;  1AQ5 A;  2WSF J;  1KF6 C;  1SQB J;  2N1T B;  4NPD A;  1Y47 A;  1KMI Z;  1L4A C;  2ZVO B;  2V4H A;  4H44 C;  2BAS A;  1X9V A;  3VR9 C;  2E74 B;  4WVZ A;  2QM8 A;  3AE9 D;  4L76 A;  4RJT A;  2WDQ C;  2XU6 A;  2NPS A;  2PRR A;  3E1R A;  3H1I E;  1VQO P;  3CX5 E;  2P67 A;  1E79 H;  3P32 A;  3AEE D;  1FJK A;  4I2L C;  4PV1 B;  5GTH H;  2WPS A;  3PRJ A;  1DD4 A;  2Y9Y A;  3EQ2 A;  1LTA C;  1AQT A;  1LGH B;  2LKM A;  3D6Z A;  3OA7 A;  1OVR A;  3HUS C;  2FXO A;  1JTH A;  3PTZ A;  3OW2 O;  2Z5H A;  4DDI A;  1EZV G;  2OTJ P;  3L73 E;  1MFT A;  4KT0 J;  4OVN F;  2WP9 C;  2WWW A;  4GDO A;  1FC2 C;  4JF7 A;  1S5L X;  3B5N C;  5H2F E;  3SWF A;  2OYH C;  3BRV B;  4DT0 A;  3R4Y A;  2KLV A;  2KIK A;  1PP9 E;  5AW2 B;  1N2D C;  1RF1 B;  1J1D C;  3H1H J;  1T2K C;  1AVY A;  3CC2 P;  1BE3 G;  2A06 D;  1RQV A;  1LT9 B;  2A45 H;  2K9J B;  1EQ7 A;  3A0H E;  1KTM A;  3OJA B;  2WSE J;  4L74 A;  3M9B A;  1FOS F;  3V2N A;  1IFI A;  1LTG C;  4Y28 J;  4KX6 D;  5CCG A;  1NEN C;  3M9H A;  2YKO A;  2QRX A;  1N86 A;  1PFI A;  3VMX A;  1VQ8 P;  2Y0D A;  1YBK A;  4YTP D;  1IK7 A;  4H13 C;  1L0L G;  3BAT A;  2I8D A;  4Y99 C;  2Z4E A;  2BS3 C;  1NTK D;  1ZRT E;  1AA0 A;  1QX8 A;  1NU1 K;  1AFO A;  3IF4 A;  1EC5 A;  3PH0 A;  3VRB D;  4YSZ D;  1GZL A;  2IBZ I;  3HD7 B;  2BS2 C;  3Q5P A;  1X22 A;  4I7Z C;  2H43 A;  4IFM A;  1IC2 A;  2KYV A;  3V2P A; 
#chains in the Genus database with same CATH homology
 4OGQ C;  2QIW A;  1GMJ A;  3RL0 g;  3D71 A;  1VF5 D;  2WS3 C;  3AE4 C;  1MKM A;  2E74 C;  3GF7 A;  3P4S D;  4H0L D;  4H13 B;  3R4Y A;  3AEF D;  3VR8 C;  5C3J C;  3AEA C;  4H0L C;  5KLI C;  1YQ4 C;  4YTM D;  1QLB C;  4U7J A;  1RQU A;  1L0V D;  4OGQ D;  3Q1M A;  2WSF J;  3ABV D;  4YTN D;  2E76 C;  2G8Y A;  3VR8 D;  2E75 B;  1KF6 C;  2O01 J;  5C2T C;  2YMK A;  1PV3 A;  4I7Z B;  2WDQ D;  4YXD D;  3VRA C;  2ACZ D;  3SFE D;  3AE3 D;  3CIR D;  1VF5 C;  3D6Y A;  3GF3 A;  2WS3 D;  3AE6 D;  1YQ3 D;  2K9Y A;  1KMI Z;  4PV1 D;  3P4Q C;  1RQV A;  1DIP A;  4H44 C;  2QJK C;  4PV1 C;  3AE8 D;  2WDV D;  4TT3 H;  2FBW D;  2WU2 C;  2ZT9 B;  3GMA A;  2WP9 D;  1KOR A;  3AE2 C;  1KTM A;  2WDR C;  3AE7 C;  3CIR C;  2ACZ C;  3VR9 C;  3SFD C;  1NYH A;  4IL6 X;  2WU2 D;  2E74 B;  2WSE J;  3S9O A;  2D2C C;  3H25 A;  3AEC D;  1OW6 A;  4YSX D;  3SFD D;  3ABV C;  4YTN C;  5C2T D;  1K05 A;  1KIL E;  1KFY C;  3AE9 D;  3RK3 E;  3AED D;  2WSC J;  5KKZ C;  4R4M A;  4YT0 D;  2WU5 C;  2YIU C;  1AJY A;  4Y28 J;  2WDV C;  2WDQ C;  1PL5 A;  4KX6 D;  1ZOY D;  3D70 A;  2QJP C;  1NEN C;  1KF6 D;  4Z1M H;  4R4L A;  3P4Q D;  4YSY D;  1Y9B A;  2E76 D;  2V7Q J;  2JO1 A;  1JB0 J;  2ZT9 D;  4YSZ C;  3AE7 D;  2WQY C;  3SFE C;  3AE4 D;  3AE5 C;  4H13 D;  1TU3 F;  1OW7 A;  2FYN C;  3C8V A;  1FDO A;  2FBW C;  3P4P D;  4YTM C;  1K04 A;  1NEK C;  3AEE D;  1HJ0 A;  3AEF C;  3AEE C;  4YTP D;  1NGM B;  2H88 D;  4H44 B;  3FGA D;  2WPV B;  4PV1 B;  1IK7 A;  1E7P C;  3AE3 C;  4H13 C;  3AE5 D;  1YQ4 D;  4YXD C;  2H88 C;  2IDB A;  1OMI A;  2NZ2 A;  2P10 A;  4H0L B;  1DD4 A;  3EWK A;  1VL2 A;  2E76 B;  3P4S C;  3P4P C;  3B71 A;  2MKV A;  2E74 D;  3IAO A;  2QJY C;  3O6Q A;  1KQF B;  2BEQ D;  2BS3 C;  3AEG D;  4YT0 C;  1WMK A;  1ZP0 C;  2WQY D;  1KFY D;  1ZRT E;  1PIX A;  1UIX A;  4YTP C;  1EXI A;  3AEA D;  1VF5 B;  3G9R A;  3D6Z A;  4OGQ B;  2G3A A;  4YSX C;  1ZME C;  1NEK D;  1NEN D;  1ZOY C;  2E75 D;  2WU5 D;  3AE1 C;  2H89 D;  2BEZ F;  3VR9 D;  3VRB D;  1FDI A;  2FXP A;  2ZT9 C;  4YSZ D;  5M1B A;  4YSY C;  3P4R D;  2D2C D;  3AEC C;  1DD3 A;  4KX6 C;  1S1C X;  3P4R C;  2B76 D;  2JP3 A;  3GLM A;  1KQG B;  2WDR D;  3AEB D;  1ZP0 D;  2BS2 C;  3Q2Y A;  3AE9 C;  3AED C;  3Q5P A;  2H89 C;  3AE2 D;  2D2C B;  3VRA D;  1OW8 A;  2E75 C;  4H44 D;  3AE8 C;  1HF9 A;  3IN6 A;  3VRB C;  4I7Z C;  1Q90 D;  1YQ3 C;  4XFJ A;  4RKU J;  2QSI A;  3Q5R A;  1U57 A;  4KT0 J;  3Q3D A;  3AE6 C;  3Q5S A;  2OQQ A;  1EXJ A;  1L0V C;  1R8E A;  2BS4 C;  3AEG C;  3AE1 D;  3AEB C;  2J5U A;  3T97 B;  4GDO A;  2WP9 C;  5L8R J;  2B76 C;  5C3J D;  1S5L X;  3LW5 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...