3AE3C

Crystal structure of porcine heart mitochondrial complex ii bound with 2-nitro-n-phenyl-benzamide
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with 2-Nitro-N-phenyl-benzamide
rcsb
total genus 46
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3ae3C01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3ae3C02
3P4SC 3AE7D 3SFEC 3AE3C 4YT0C 1KF6D 3AE8D 4YTMC 2H88C 3AE6D 3AECC 1ZP0D 1YQ4C 4YTPC 2ACZD 4KX6D 2WU2D 3AEBD 3P4PD 1NEKC 1OW8A 3AE2D 2WS3C 3AE5C 1OW6A 1ZP0C 5C3JD 1K04A 3SFDC 3P4QD 5C2TD 3AEBC 3P4PC 2WDVC 4YSXD 3AE2C 4YSZD 1KTMA 2B76D 3AEFD 2FBWC 3AEAD 2BS2C 3ABVD 1ZOYD 3P4QC 5C2TC 4YXDD 2BS3C 2WP9D 3AE4D 3AEFC 3AEAC 1KFYD 3AE7C 1ZOYC 4YXDC 3S9OA 1KF6C 3AE8C 2WP9C 3AE4C 3AE6C 3AE9D 2G3AA 1KFYC 2WDQD 1L0VD 2ACZC 3AE1D 4KX6C 3AEED 2WU2C 2H89D 3VRAD 2WDRD 5C3JC 3CIRD 1NEND 1L0VC 3AEEC 2WQYD 3VR8D 3P4RD 2H89C 4YSXC 3VRAC 4YSZC 2B76C 3CIRC 3ABVC 1OW7A 2WQYC 3P4RC 4YTND 3P4SD 3AEGD 1K05A 4YSYD 3AE3D 4YT0D 3B71A 3AECD 4YTNC 1YQ4D 4YTPD 3AEGC 3AE9C 3AEDD 4YSYC 1NEKD 1QLBC 2WDQC 2WS3D 3AE5D 3AE1C 1YQ3D 3VR9D 3AEDC 3VRBD 3SFDD 2WDRC 2WDVD 2BS4C 1NENC 2FBWD 3VR8C 2WU5D 1PV3A 1YQ3C 1E7PC 3VR9C 3VRBC 3SFED 4YTMD 2H88D 2WU5C
chains in the Genus database with same CATH superfamily
1R8EA 3L72D 5B5EH 2H7HA 3CCQP 2BCCD 5KJ7C 2LXBA 1IZNB 2NRGA 1KILC 1J2JB 4PV1C 1U7JA 1FZAA 3CCUP 1OVUA 3L71G 2R3CA 1ZOYD 2D2CB 1HBWA 2SPZA 2BS3C 2KS1A 1ZXGA 4IFMA 1NWQA 1ZLLA 2IBZE 1KB9H 2WP9C 2W6JH 3MGNA 1CZQA 2LR2A 3KDPB 1URQC 5AVQB 1BCCJ 3OA7A 1LTIC 1UIIA 3PH0A 2IYOA 3VR8D 3U59A 2B76C 3CD6P 1N86A 1KQFB 3Q2YA 1SQXJ 5GTHH 2FYUD 3H1IJ 2Y9YA 3JSVC 4ASVA 4IFFA 3D70A 3EWKA 3QWOC 4YTNC 1SQBD 4GOFA 5AVTB 2YXRB 3AEDC 2R44A 1PGQA 1SQXE 4LLHA 3H1IE 1FZFA 1FJKA 2ZT9D 2QM7A 2KYVA 3HE5A 2PGDA 4DHJA 3HTKA 1IO4A 1BSHA 3AE3C 2KXPB 1ZRTE 3VMZA 2WSFJ 3OAKA 4YTPC 2ZYGA 2E74D 4OGQD 2HODA 2FYUG 3W67A 3SFDC 3I5CA 2H43A 2YMKA 1TU3F 4YSZD 1KQGB 2POHA 2OARA 1RHZB 1SQVG 3RK2B 4HB1A 1KZUB 1KYOE 5AW2B 4JYBA 2YXQB 3G3ZA 2WDQD 3GHGA 1OX3A 4KX6C 1QL2A 1H8AA 1S1CX 1NEND 1L0NE 1VQNP 2JP3A 2XU6A 2K9JB 5AW9B 2WPRA 4XA4A 1Q2NA 1CI6B 2QEXP 1EZVG 2R5DA 5KLVK 1GK4A 3QH9A 1LNQA 4ZMDA 1MV8A 3L71J 1GU4A 2N9YB 1M57D 5CBOA 1G2CB 3IF4A 3CX5D 1JMBA 3TK1A 2Y0EA 1PL5A 2K37A 3VRBC 5KKZC 1DD4A 4IL6E 4C7RA 2ITAA 3I56P 2H88C 3JCUE 2OYIB 2KZIA 1S5LX 3BATA 3L72J 1W2BO 2OQQA 2BCCJ 3AE2D 2WS3C 1SFCA 4W7YA 4D6TD 5C3JD 3GHGC 4IL6X 4RO0A 1S5LH 3AEFD 5KAIE 1FOSF 1L0NK 2NPSB 1E5WA 3HD7D 2GM4A 1N7SC 1S4XA 3L72E 4NPDA 1RH5B 4H0LB 2CPBA 1RE4A 2BCCE 3CXHD 4BRYB 2BEQD 3S4RA 2ZVOB 3GF7A 2QJPC 3VP8A 2H89D 1EDKA 2OTKE 2WVRA 1Y8AA 4BXLA 1QLED 1QL1A 1VQ4P 5CCGA 1Q82Q 5DJTB 1VF5B 1X22A 2FYUJ 4KT0J 2CPSA 3PP5A 2JDIH 1M1JC 4L76A 1OMIA 4DJGA 2CK3H 1EZVI 3AE9C 2FYZA 4Y99C 3WU2H 1USEA 2PFXA 4WVZA 3B5NA 5CBNA 3RK2D 1SFCC 3FWLA 2LXCB 3EFFK 3BVHA 4OH8B 1QX8A 2O3JA 3VR9C 1LWUB 3L75D 1AA0A 2RMZA 3VMYA 2Z5HA 1JTHA 1SS1A 2W83C 1KB9D 1SQBE 2E75B 1ZP0D 4UB8E 1A02J 2FXOA 1BE3G 1RE4C 4L73A 1DH3A 3H1KG 5C39A 2C9LY 3II6A 5C2TD 4NPEA 4WY4A 1RQUA 2IFNA 1AVOA 3AEAD 2V4HA 1ZN5A 1KN7A 1DIPA 4YXWH 2AXCA 2W6BA 3CCVP 3CX5I 3EQ2A 1HVVA 2Z5IA 1ZR4A 3VRAC 5M1BA 3RL0g 3B5NC 2FFDA 4BWNA 3H32A 3U1CA 1SQQD 1FE6A 1N8RQ 1USDA 4RKUJ 3D6YA 1YJ9P 3EFGA 3CCJP 4GODA 3T97B 2GUVA 1SQBK 2HLOA 2A06G 2C0WA 1NTKD 2NPSD 4JQ0D 4H44C 1L2PA 1J1EB 5GTIH 1PV3A 4U3FD 5AVZB 4H0LD 1DEEG 5E79E 4WY4C 2Q5UA 3B8EB 2KK7A 1AV1A 4AUWA 3P4SC 1A02F 3M06A 3L4FA 1PP9G 3O6QA 1J1DB 5APVA 3G71P 1NEKC 2PAJA 4ZKPA 2XDJA 1SQQG 2M5AA 3P8CD 5CMZA 3Q5RA 3GW6A 1VF5D 2WDVC 1JY2P 1GL2A 2ZXEB 2J5UA 5K5GB 1JY3N 1NTMG 2QJKC 1IFPA 1EDIA 1PPJG 2O01H 3HE4A 3VMXA 3MZWB 1NTKG 1ZOYC 1JOCA 1KF6C 2QJYB 3AE6C 2E5YA 1Q81Q 1NU1K 1Y9BA 2G3AA 3L73D 2W8ZA 4D6TE 4U3FG 1LTTC 3C8VA 3BCCD 1KD1Q 3P4RD 3VN0A 1T3UA 1DEBA 1FS0E 5KLVG 2NZ2A 3CXHE 5APUA 3LIEA 1SVFA 3CMEP 2P58A 2FXMA 3FXDA 3AECD 1YTZI 1X9VA 1YQ4D 2B9BA 3H1HG 3M9HA 2XKMA 3AE1C 4OGQB 4PD4I 3P7KA 3VP9A 2Q3EA 2ZYAA 2BS4C 1HJBA 2QE7H 3L73G 4HKZH 3PRJA 1GL2C 5B5EE 2Y0DA 4C46A 2O1KA 3RK3C 3BCCG 3CL3D 3L71D 1P84E 3CCSP 5TISH 3AE8D 2I1KA 3BASA 3IFMA 3GLMA 1LT9B 2WU2D 4DHIB 1NH4A 3L36A 1OW6A 5BU8B 4WBAA 2E74C 2WT7A 2KP8A 1JUNA 3F89A 3L75E 1FU1A 1NTZD 1KB9E 1KILB 4PV1B 3TGUG 3SSUA 3GG2A 1N73A 3KYQA 4H13C 2L5GB 1T6AA 3AEED 3OJAB 4DDIA 3Q3DA 3A0BH 1Z56A 5CCHD 3B4SA 5GTHE 2WQYD 4LDTA 3K5BA 1E79H 4YSXC 1X0TA 2Q3IA 4HJGH 1FZCB 2W6AA 1OXZA 1SQQJ 5B66H 2B88A 2M3EA 2QSIA 1H0TA 1KQLA 2N1TD 4C7NB 5AVUB 3RGUA 2HFED 1NTZG 4B86A 2BASA 1NKNA 3MIWA 1NTKJ 1R5LA 2DW3A 3CMAP 4PD4H 4I6LA 1FJPA 1SQQE 3V4QA 3A0HH 1SLQA 1VDFA 4U3FJ 5AVSB 5AVRB 2D2CC 1MZ9A 3SFED 5AW4B 4YTMD 1KFMA 1SQPD 1X79B 1L0LD 3HD7B 1QVFO 1SQVD 1BCCE 3MP7B 1N73C 1L4AB 3H25A 2P1JA 1NTKE 5APTA 4ZNCA 1GU5A 4EIJA 4U3FE 1HWTC 1JMMA 3AE2C 1M56D 4EOTA 1KTMA 1HTLC 1OZHA 3WUUA 2QVAA 2YKQA 3TSIA 3AEFC 1JNMA 3AE7C 2YIUB 3FGAD 1EZVD 1TFFA 3L73J 3P8CE 1IJDB 4KJMA 2OGUA 3BCCJ 2K9JA 5BU5A 1SQPG 3L70D 3CIRD 1CI6A 1L0LG 2H89C 4JBZA 1S3JA 1N7LA 4QMAA 1DD3A 3FXEA 4YSYD 2M8RA 1G2CA 1PGPA 2E43A 1U57A 3BCCE 3BRVB 5APQA 1IFNA 1SP4A 3PJSK 3TGUJ 1FAVA 3CCMP 2WMMA 1MFTA 3LW5H 2ZFYA 4RJTA 2Y9ZA 2KLVA 4JYCA 2FXPA 3HTKB 1KILD 2WDRC 1N7SA 3E7KA 4PV1D 1FOSE 1SQXK 1IFIA 4N78E 5AVVB 2OYIA 3RK2C 1LJ2A 1QEXA 4AQRD 2HODB 3WUVA 1JO5A 3L70G 2YMYA 4NPFX 4YT0C 2YKOA 2ZVNB 1S5LE 2K1AA 5CHXA 1ZP0C 4Z1MH 2IDBA 1M1JA 2B76D 4K3AA 5AVXB 1NTZJ 3L71E 3KHUA 2R3SA 3UIAA 5DJUB 5C2TC 2KI7B 2B87A 1MFZA 2L91A 1NYHA 1RQVA 3AEAC 4LC1A 5APWA 1KV4A 1MKMA 2W27A 4I7ZB 2FYNC 1L0VD 4W80A 2ACZC 5APSA 3NMDA 1NTZE 2PP6A 2E76B 3CLQA 2O1JA 1PZQA 3MUDA 3ABVC 1VPCA 1FZEA 1L4AD 3AE3D 3M0AA 2OYIC 3WU2E 3M9QA 4YTPD 2M0BA 3Q5PA 3KXDA 5AW6B 1ZR2A 3WUTA 1HJ0A 3SFDD 1NOHA 5CJ0A 1LWUA 1BE3D 2WWWA 3H1KD 1RF0A 1E7PC 1HH0A 2NPSC 1Q86Q 3PLNA 1SFCB 1AQTA 1SQPJ 1VQ9P 1L0LJ 4H0LC 1SQVJ 4PJ0E 1LP1B 2C9NY 1S9KD 1NAFA 1CSBA 4KX6D 1VQLP 3P4PD 3RL0C 4IFDK 1YHQP 2K9YA 2OYHB 2FYUE 2H8PD 5AW0B 4U7JA 4HYTB 2FBWC 1X8YA 4TT3H 1L0LE 1VF5C 1SQVE 2E42A 3AE4D 2MJZA 2ZAEB 2I1JA 3NFQA 3MUDC 1M8OB 1FDOA 2AXTH 1VQMP 4EI2A 4JF7A 3E1RA 5EFWB 3H1JG 3H1LG 4PD4D 3L70J 2A06D 1YJNP 1U7MA 3MHVA 3CC4P 1R5SA 1EDLA 2VRSA 1KC8Q 2WPSA 1LWUC 1NKZB 1JY2N 2WSCH 2HYNA 1EZVE 3P4RC 1RF0C 3VONA 3TNUB 2E75C 1EQ7A 1W5CE 2ZXXA 3CCLP 1YIJP 2WS3D 1PP9D 1OIPA 1JTHB 1AQ5A 3N4XA 5L8RJ 3R4YA 2O01J 1QVGO 2FYUK 1G1IA 3L74G 2O01N 1D7MA 2Q1KA 1NTMD 4KHXA 1PPJD 5KLIC 4WY4B 1LTJB 4L74A 1H89A 1EC5A 2E76D 1KILE 1OW8A 3AE5C 1NVOA 4CPGA 3KZIH 3PTZA 5BVZA 3L35A 3RBXA 3VOPA 1AFOA 3ZDMA 2IPPA 3MD0A 4GKGA 2OYOA 1FC2C 1KFYD 3CX5E 1RY3A 2IBZG 5KLVD 2N1TB 3C1LA 3A7OA 3AE9D 4EDFA 2FFDB 3H32B 4UB6H 1GD2E 1T2KD 1JM0A 3U1AA 2YKPA 3M0DA 3H1HD 1SFCD 3AEEC 4LGDE 1IFMA 2KNCA 5KTBA 1T3JA 1IFJA 1OW7A 2WQYC 2Q6QA 4MN4C 1ZV8A 1NJIQ 5APYA 3B71A 1GK6A 1J1DC 2W90A 2HG5D 1YQ3D 1BE3J 1RF1B 1SQXG 3VR8C 3O6QB 2WU5D 3H1KJ 5TISE 4ASWA 5CCGD 3SFEC 3TGUD 4YTMC 2QJYC 3RK3B 3GMAA 5H2FH 3HE4B 3HUSB 3AEBD 1BE3E 1Y47A 1QGKB 3H1KE 1NHLA 1K04A 1OFCX 2FKWB 3M0DC 3B5ND 3V2NA 4GT1A 4YXDD 2ZT9C 3V2QA 1KORA 3A0BE 1MUUA 3L74J 1JCDA 2JKVA 4H13B 1LTAC 4OGQC 2IBZI 2R5BA 1FZCA 4H44D 1L0NG 4I2LC 1YI2P 5B66E 4YSZC 3WMM0 2JJLA 4C7NA 5AVYB 3CIRC 4WY4D 4OVNF 3P4SD 5KAFH 1YYCA 3TDKA 1YITP 3M9BA 4PD4E 4YSYC 1LT9C 1NEKD 2WDQC 2AEJA 2A06E 2HPCB 3A0HE 1PP9J 2J58A 2A45G 1P84H 4DCKA 1URQB 2WDVD 1NENC 3TF5A 2B89A 1GMJA 1VL2A 3HD7A 2MKVA 4DZOA 1ZW0A 1VQ6P 3V2PA 1L4AA 1NTMJ 2WT7B 1KF6D 1AJYA 2Y0CA 3M91A 1KMIZ 3AE6D 3CCEP 1PP9E 3V2RA 3LIDA 1NAYA 3CC7P 1JCCA 2KSEA 1K8AQ 1N73B 1XTCC 4O9BA 3P4QD 2XNDH 1BDDA 3FWNA 4K35A 1NTME 3C9IA 1FZCC 2BS2C 1PPJE 2OTJP 3L72G 3D6ZA 5AW7B 3S9OA 2BCCG 5KLVJ 3CWBD 2KS1B 1JY3O 1KYOI 3LW5J 4DHZA 3AE1D 1VQOP 3OW2O 4GIFA 1PFIA 2WTYA 1H0TB 3H1HJ 5C3JC 4OWFA 1L0VC 4I1LA 2QRXA 2IX7C 3Q1MA 1GL2D 2XZRA 2YO3A 3L37A 3RK3D 5KLVE 1GTWA 3AEGD 3HD7C 5AW1B 1VQ7P 2P10A 2YNYA 3S1KA 1L4AC 2PRRA 1IC2A 3H1HE 2WITA 1QLBC 2OTLP 2P67A 4WWIA 4JPZB 1DX7A 1S2EA 3GF3A 2IZ1A 2UWJE 1SQQK 1AVYA 4TLFA 1GW3A 3CWBG 5AW8B 2A45I 5CJ4A 3L73E 1NTMK 1SQBG 1L0NJ 2YIUC 4H13D 3MTUE 5KJ7D 4WB4A 3HE5B 1Q7YQ 2KUBA 1NTKK 1LT1A 1WRGA 2C0XA 1NU1D 2IFMA 2N9BA 4N3YB 1Q90D 4N6JA 3P4PC 3F5HA 4YSXD 2AEMA 2ZYDA 3O8ZA 2BEZF 3P8MC 1S72P 2KIKA 2WP9D 3TGUE 2IZ0A 2KOGA 5KKZB 1CW5A 2JWAA 3PHLA 3NTNA 3AE4C 1URQD 1LTBC 2WSFH 1KYOH 2NPSA 4I6MC 2ZFCA 2WPQA 3SWFA 4ZKUA 2FYNB 3GHGB 2QA4P 1IK7A 2LKMA 3HRNA 4BRYA 1VQ8P 2QM8A 2D2CD 1HF9A 1K73Q 2KB7P 4YTND 1NU1G 3SWKA 1N7SB 3FX0A 1FBMA 3NXSA 3RBZA 3TYYA 3KQGA 1GDTA 3AEDD 4L75A 2QJPB 4Y28J 4DOJA 1IK9A 1PGJA 2RKLA 5TJHA 1FZBA 2ZJSE 2QIWA 2A45H 3KPEA 1LP1A 4M3LA 3AE7D 2J59M 1M1JB 2Q7CA 1XTGB 3USSA 4I7ZC 2OYHA 2KZJA 4IL6H 2B87B 4Y99B 1FDMA 3JCUH 1OWAA 4FJVA 3H1JD 1PIXA 1YJWP 2E76C 3H1LD 3H6PA 3RL0B 3W68A 1BGYD 4XFJA 1UIXA 1H88A 2WSCJ 2AXTE 1M1KQ 2KLUA 2HR3A 1EXIA 5KAIH 1BSNA 2AEFA 3CWBJ 4D6TG 1KFYC 2WSEJ 1HUCA 4DT0A 1W2EA 2JR8A 1P84D 2R32A 2P7JA 1SQBJ 1SQPE 1EXJA 1NGMB 2WDRD 1WT6A 1NTZK 5AW3B 1T2KC 4EYYQ 3TNUA 3V5BA 2IYPA 3G9RA 2KSJA 3L74D 1K05A 3CWBE 4YT0D 3VMAA 2XNXA 3D71A 2GUSA 4DDGA 2JO1A 1BGYG 3IN6A 1IFDA 1LTSC 2OYHC 4W7ZA 3VRBD 4A7PA 4AYCA 1JEKA 3IAOA 4PJ0H 3RK3E 3T97A 1KFNA 1YQ3C 1ZMEC 3B5NB 2H88D 1LTJA 4XE5B 2E5TA 2RH0A 2WU5C 2QG4A 3L70E 1YTZT 2WSEH 3AECC 5GTIE 5CCGC 2P2UA 1YQ4C 3KZIE 5CCHA 3A2AA 4GOEA 3JC22 2ACZD 2IBZD 5KLIB 2V7QJ 1T8ZA 3E1IA 1NU1J 4UB8H 1GZLA 2XV5A 3AEBC 3L75G 4H44B 1SQPK 1M90Q 1N7SD 3G6EP 1JB0J 3ABVD 1OVVA 1L0LK 2N1TA 3ITKA 1SQVK 2JWDA 4UB6E 4YXDC 3AE8C 1NU1E 3V4WA 1OVRA 1VQ5P 1LTGC 2WU2C 2RN0A 1BCCD 2K88A 3BRTB 3VYIA 1EDJA 2QJKB 5APXA 1SQXD 3H1ID 2Q9IA 1LGHB 1LTJC 4IOIH 1K9MQ 3CI9A 4RESB 2V7QH 3CXHI 3SWYA 1ZRTD 3RL0D 1RF1A 2G8YA 1VQPP 1J1EC 3P32A 5CCHC 3VR9D 1NO4A 5AVWB 1WMKA 4D6TJ 2FBWD 5AW5B 1N2DC 5H2FE 2WSSH 3HUSA 2GA1A 2N1TC 1BCCG 5E79H 1M7LA 1KYOD 1FDIA 2FFDC 1BDCA 1P84I 3I55P 3H1IG 3H1JJ 3CX5H 3H1LJ 1RE3A 2WZ7A 3CPWO 1BGYJ 3CCRP 2M5AB 1L0ND 2JEEA 3P4QC 1LT9A 1HGVA 1GL2B 4R4MA 2E75D 3N7NA 3VTPC 1FZGA 4YPCA 2I8DA 1KB9I 2ZT9B 3V6IA 3CC2P 2KNCB 5KJ7A 4N78D 4R4LA 4GDOA 3H1JE 3A3YB 3IR9A 1KILA 3H1LE 3VRAD 1BGYE 1GW4A 1PGOA 2E74B 1RF1C 3R2PA 5KAFE 1S9KE 4HH2A 3Q5SA 2M3BA 3L75J 2K3RA 2HPCA 3AEGC 3HUSC 1URQA 3CXHH 2WPVB 3AE5D 1JY2O 1KQSO 1JY3P 1G1JA 1YBKA 3G4SP 1HGZA 2YO2A 3A5TA 3L74E 2Z4EA 2FY8A 1RE3C 1VQKP
chains in the Genus database with same CATH topology
3P4SC 3AE7D 2YIUC 4H13D 3SFEC 3AE3C 2E75B 4YT0C 4H0LC 1KF6D 5KLIC 1AJYA 3AE8D 4YTMC 2H88C 1ZRTE 1KMIZ 3AE6D 2QJYC 3AECC 2WSFJ 1R8EA 1ZP0D 1S5LX 3GMAA 1FDIA 1YQ4C 3O6QA 4I7ZC 4YTPC 3H25A 2E74D 3GLMA 2ACZD 4KX6D 2OQQA 2E76D 1KILE 4OGQD 2WU2D 1NEKC 1OW8A 2V7QJ 3AEBD 3P4PD 3AE2D 2WS3C 3AE5C 1OW6A 1ZP0C 4Z1MH 2K9YA 2IDBA 5C3JD 1Q90D 1PIXA 2E74C 1K04A 3SFDC 3Q5RA 3P4QD 2E76C 3AEBC 2YMKA 1TU3F 1VF5D 4H44B 4IL6X 4PV1C 4U7JA 3AE2C 1KQGB 2WDVC 4YSXD 4YSZD 1KTMA 1RQUA 2J5UA 2B76D 4XFJA 2FBWC 3AEFD 2BEZF 2QJKC 1UIXA 1JB0J 2BS2C 2WSCJ 3AEAD 3ABVD 4TT3H 1ZOYD 3P4QC 5C2TC 2D2CB 4YXDD 1VF5C 4PV1B 2ZT9C 2BS3C 2WP9D 1DIPA 3AE4D 4R4MA 1NYHA 3AEFC 2E75D 1RQVA 3AEAC 1KFYD 3D6ZA 1EXIA 1KORA 3AE7C 3FGAD 1ZOYC 4H13C 4YXDC 1FDOA 4H0LB 2ZT9B 3S9OA 1KF6C 3P4PC 3AE8C 2WP9C 1MKMA 3AE4C 2BEQD 3AE6C 3AE9D 1Y9BA 2G3AA 1KFYC 4I7ZB 4R4LA 2WSEJ 2WDQD 4GDOA 3GF7A 3LW5J 2FYNC 4H13B 1L0VD 2ACZC 3AE1D 4KX6C 3C8VA 2QJPC 2WU2C 4OGQC 3AEED 3Q3DA 2H89D 3VRAD 1S1CX 1EXJA 1NGMB 2WDRD 5C3JC 4H44D 3CIRD 1NEND 2E74B 2JP3A 1L0VC 1IK7A 2E76B 3AEEC 2WQYD 3VR8D 3P4RD 2H89C 4YSXC 3VRAC 4YSZC 5C2TD 2B76C 5M1BA 3RL0g 2D2CD 3Q1MA 3CIRC 1KQFB 3ABVC 3Q2YA 1OW7A 1DD3A 1HF9A 2WQYC 1VF5B 3P4RC 3Q5SA 4YTND 2NZ2A 3P4SD 4KT0J 3G9RA 3AEGD 1K05A 4YSYD 3AE3D 4YT0D 2E75C 2QSIA 4RKUJ 3D6YA 1OMIA 3B71A 3AECD 2P10A 3D70A 1U57A 3D71A 3EWKA 4YTNC 3T97B 1YQ4D 4YTPD 2JO1A 3AEGC 3AE9C 3AEDD 4YSYC 2WPVB 1NEKD 1QLBC 3IN6A 2WDQC 2WS3D 3Q5PA 3AE5D 2G8YA 3AE1C 4OGQB 1HJ0A 1YQ3D 2FXPA 3VR9D 3AEDC 3VRBD 3SFDD 4Y28J 2WDRC 4PV1D 4H44C 5L8RJ 2WDVD 1WMKA 3GF3A 3R4YA 1NENC 2BS4C 3IAOA 2FBWD 3VR8C 3RK3E 1GMJA 1PL5A 2WU5D 2O01J 1PV3A 1YQ3C 1E7PC 3VR9C 1VL2A 3VRBC 2QIWA 3SFED 2D2CC 1ZMEC 4H0LD 2ZT9D 4YTMD 2MKVA 2H88D 5KKZC 1DD4A 2WU5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P4S C;  3AE7 D;  3SFE C;  3AE3 C;  4YT0 C;  1KF6 D;  3AE8 D;  4YTM C;  2H88 C;  3AE6 D;  3AEC C;  1ZP0 D;  1YQ4 C;  4YTP C;  2ACZ D;  4KX6 D;  2WU2 D;  3AEB D;  3P4P D;  1NEK C;  1OW8 A;  3AE2 D;  2WS3 C;  3AE5 C;  1OW6 A;  1ZP0 C;  5C3J D;  1K04 A;  3SFD C;  3P4Q D;  5C2T D;  3AEB C;  3P4P C;  2WDV C;  4YSX D;  3AE2 C;  4YSZ D;  1KTM A;  2B76 D;  3AEF D;  2FBW C;  3AEA D;  2BS2 C;  3ABV D;  1ZOY D;  3P4Q C;  5C2T C;  4YXD D;  2BS3 C;  2WP9 D;  3AE4 D;  3AEF C;  3AEA C;  1KFY D;  3AE7 C;  1ZOY C;  4YXD C;  3S9O A;  1KF6 C;  3AE8 C;  2WP9 C;  3AE4 C;  3AE6 C;  3AE9 D;  2G3A A;  1KFY C;  2WDQ D;  1L0V D;  2ACZ C;  3AE1 D;  4KX6 C;  3AEE D;  2WU2 C;  2H89 D;  3VRA D;  2WDR D;  5C3J C;  3CIR D;  1NEN D;  1L0V C;  3AEE C;  2WQY D;  3VR8 D;  3P4R D;  2H89 C;  4YSX C;  3VRA C;  4YSZ C;  2B76 C;  3CIR C;  3ABV C;  1OW7 A;  2WQY C;  3P4R C;  4YTN D;  3P4S D;  3AEG D;  1K05 A;  4YSY D;  3AE3 D;  4YT0 D;  3B71 A;  3AEC D;  4YTN C;  1YQ4 D;  4YTP D;  3AEG C;  3AE9 C;  3AED D;  4YSY C;  1NEK D;  1QLB C;  2WDQ C;  2WS3 D;  3AE5 D;  3AE1 C;  1YQ3 D;  3VR9 D;  3AED C;  3VRB D;  3SFD D;  2WDR C;  2WDV D;  2BS4 C;  1NEN C;  2FBW D;  3VR8 C;  2WU5 D;  1PV3 A;  1YQ3 C;  1E7P C;  3VR9 C;  3VRB C;  3SFE D;  4YTM D;  2H88 D;  2WU5 C; 
#chains in the Genus database with same CATH topology
 1R8E A;  3L72 D;  5B5E H;  2H7H A;  3CCQ P;  2BCC D;  5KJ7 C;  2LXB A;  1IZN B;  2NRG A;  1KIL C;  1J2J B;  4PV1 C;  1U7J A;  1FZA A;  3CCU P;  1OVU A;  3L71 G;  2R3C A;  1ZOY D;  2D2C B;  1HBW A;  2SPZ A;  2BS3 C;  2KS1 A;  1ZXG A;  4IFM A;  1NWQ A;  1ZLL A;  2IBZ E;  1KB9 H;  2WP9 C;  2W6J H;  3MGN A;  1CZQ A;  2LR2 A;  3KDP B;  1URQ C;  5AVQ B;  1BCC J;  3OA7 A;  1LTI C;  1UII A;  3PH0 A;  2IYO A;  3VR8 D;  3U59 A;  2B76 C;  3CD6 P;  1N86 A;  1KQF B;  3Q2Y A;  1SQX J;  5GTH H;  2FYU D;  3H1I J;  2Y9Y A;  3JSV C;  4ASV A;  4IFF A;  3D70 A;  3EWK A;  3QWO C;  4YTN C;  1SQB D;  4GOF A;  5AVT B;  2YXR B;  3AED C;  2R44 A;  1PGQ A;  1SQX E;  4LLH A;  3H1I E;  1FZF A;  1FJK A;  2ZT9 D;  2QM7 A;  2KYV A;  3HE5 A;  2PGD A;  4DHJ A;  3HTK A;  1IO4 A;  1BSH A;  3AE3 C;  2KXP B;  1ZRT E;  3VMZ A;  2WSF J;  3OAK A;  4YTP C;  2ZYG A;  2E74 D;  4OGQ D;  2HOD A;  2FYU G;  3W67 A;  3SFD C;  3I5C A;  2H43 A;  2YMK A;  1TU3 F;  4YSZ D;  1KQG B;  2POH A;  2OAR A;  1RHZ B;  1SQV G;  3RK2 B;  4HB1 A;  1KZU B;  1KYO E;  5AW2 B;  4JYB A;  2YXQ B;  3G3Z A;  2WDQ D;  3GHG A;  1OX3 A;  4KX6 C;  1QL2 A;  1H8A A;  1S1C X;  1NEN D;  1L0N E;  1VQN P;  2JP3 A;  2XU6 A;  2K9J B;  5AW9 B;  2WPR A;  4XA4 A;  1Q2N A;  1CI6 B;  2QEX P;  1EZV G;  2R5D A;  5KLV K;  1GK4 A;  3QH9 A;  1LNQ A;  4ZMD A;  1MV8 A;  3L71 J;  1GU4 A;  2N9Y B;  1M57 D;  5CBO A;  1G2C B;  3IF4 A;  3CX5 D;  1JMB A;  3TK1 A;  2Y0E A;  1PL5 A;  2K37 A;  3VRB C;  5KKZ C;  1DD4 A;  4IL6 E;  4C7R A;  2ITA A;  3I56 P;  2H88 C;  3JCU E;  2OYI B;  2KZI A;  1S5L X;  3BAT A;  3L72 J;  1W2B O;  2OQQ A;  2BCC J;  3AE2 D;  2WS3 C;  1SFC A;  4W7Y A;  4D6T D;  5C3J D;  3GHG C;  4IL6 X;  4RO0 A;  1S5L H;  3AEF D;  5KAI E;  1FOS F;  1L0N K;  2NPS B;  1E5W A;  3HD7 D;  2GM4 A;  1N7S C;  1S4X A;  3L72 E;  4NPD A;  1RH5 B;  4H0L B;  2CPB A;  1RE4 A;  2BCC E;  3CXH D;  4BRY B;  2BEQ D;  3S4R A;  2ZVO B;  3GF7 A;  2QJP C;  3VP8 A;  2H89 D;  1EDK A;  2OTK E;  2WVR A;  1Y8A A;  4BXL A;  1QLE D;  1QL1 A;  1VQ4 P;  5CCG A;  1Q82 Q;  5DJT B;  1VF5 B;  1X22 A;  2FYU J;  4KT0 J;  2CPS A;  3PP5 A;  2JDI H;  1M1J C;  4L76 A;  1OMI A;  4DJG A;  2CK3 H;  1EZV I;  3AE9 C;  2FYZ A;  4Y99 C;  3WU2 H;  1USE A;  2PFX A;  4WVZ A;  3B5N A;  5CBN A;  3RK2 D;  1SFC C;  3FWL A;  2LXC B;  3EFF K;  3BVH A;  4OH8 B;  1QX8 A;  2O3J A;  3VR9 C;  1LWU B;  3L75 D;  1AA0 A;  2RMZ A;  3VMY A;  2Z5H A;  1JTH A;  1SS1 A;  2W83 C;  1KB9 D;  1SQB E;  2E75 B;  1ZP0 D;  4UB8 E;  1A02 J;  2FXO A;  1BE3 G;  1RE4 C;  4L73 A;  1DH3 A;  3H1K G;  5C39 A;  2C9L Y;  3II6 A;  5C2T D;  4NPE A;  4WY4 A;  1RQU A;  2IFN A;  1AVO A;  3AEA D;  2V4H A;  1ZN5 A;  1KN7 A;  1DIP A;  4YXW H;  2AXC A;  2W6B A;  3CCV P;  3CX5 I;  3EQ2 A;  1HVV A;  2Z5I A;  1ZR4 A;  3VRA C;  5M1B A;  3RL0 g;  3B5N C;  2FFD A;  4BWN A;  3H32 A;  3U1C A;  1SQQ D;  1FE6 A;  1N8R Q;  1USD A;  4RKU J;  3D6Y A;  1YJ9 P;  3EFG A;  3CCJ P;  4GOD A;  3T97 B;  2GUV A;  1SQB K;  2HLO A;  2A06 G;  2C0W A;  1NTK D;  2NPS D;  4JQ0 D;  4H44 C;  1L2P A;  1J1E B;  5GTI H;  1PV3 A;  4U3F D;  5AVZ B;  4H0L D;  1DEE G;  5E79 E;  4WY4 C;  2Q5U A;  3B8E B;  2KK7 A;  1AV1 A;  4AUW A;  3P4S C;  1A02 F;  3M06 A;  3L4F A;  1PP9 G;  3O6Q A;  1J1D B;  5APV A;  3G71 P;  1NEK C;  2PAJ A;  4ZKP A;  2XDJ A;  1SQQ G;  2M5A A;  3P8C D;  5CMZ A;  3Q5R A;  3GW6 A;  1VF5 D;  2WDV C;  1JY2 P;  1GL2 A;  2ZXE B;  2J5U A;  5K5G B;  1JY3 N;  1NTM G;  2QJK C;  1IFP A;  1EDI A;  1PPJ G;  2O01 H;  3HE4 A;  3VMX A;  3MZW B;  1NTK G;  1ZOY C;  1JOC A;  1KF6 C;  2QJY B;  3AE6 C;  2E5Y A;  1Q81 Q;  1NU1 K;  1Y9B A;  2G3A A;  3L73 D;  2W8Z A;  4D6T E;  4U3F G;  1LTT C;  3C8V A;  3BCC D;  1KD1 Q;  3P4R D;  3VN0 A;  1T3U A;  1DEB A;  1FS0 E;  5KLV G;  2NZ2 A;  3CXH E;  5APU A;  3LIE A;  1SVF A;  3CME P;  2P58 A;  2FXM A;  3FXD A;  3AEC D;  1YTZ I;  1X9V A;  1YQ4 D;  2B9B A;  3H1H G;  3M9H A;  2XKM A;  3AE1 C;  4OGQ B;  4PD4 I;  3P7K A;  3VP9 A;  2Q3E A;  2ZYA A;  2BS4 C;  1HJB A;  2QE7 H;  3L73 G;  4HKZ H;  3PRJ A;  1GL2 C;  5B5E E;  2Y0D A;  4C46 A;  2O1K A;  3RK3 C;  3BCC G;  3CL3 D;  3L71 D;  1P84 E;  3CCS P;  5TIS H;  3AE8 D;  2I1K A;  3BAS A;  3IFM A;  3GLM A;  1LT9 B;  2WU2 D;  4DHI B;  1NH4 A;  3L36 A;  1OW6 A;  5BU8 B;  4WBA A;  2E74 C;  2WT7 A;  2KP8 A;  1JUN A;  3F89 A;  3L75 E;  1FU1 A;  1NTZ D;  1KB9 E;  1KIL B;  4PV1 B;  3TGU G;  3SSU A;  3GG2 A;  1N73 A;  3KYQ A;  4H13 C;  2L5G B;  1T6A A;  3AEE D;  3OJA B;  4DDI A;  3Q3D A;  3A0B H;  1Z56 A;  5CCH D;  3B4S A;  5GTH E;  2WQY D;  4LDT A;  3K5B A;  1E79 H;  4YSX C;  1X0T A;  2Q3I A;  4HJG H;  1FZC B;  2W6A A;  1OXZ A;  1SQQ J;  5B66 H;  2B88 A;  2M3E A;  2QSI A;  1H0T A;  1KQL A;  2N1T D;  4C7N B;  5AVU B;  3RGU A;  2HFE D;  1NTZ G;  4B86 A;  2BAS A;  1NKN A;  3MIW A;  1NTK J;  1R5L A;  2DW3 A;  3CMA P;  4PD4 H;  4I6L A;  1FJP A;  1SQQ E;  3V4Q A;  3A0H H;  1SLQ A;  1VDF A;  4U3F J;  5AVS B;  5AVR B;  2D2C C;  1MZ9 A;  3SFE D;  5AW4 B;  4YTM D;  1KFM A;  1SQP D;  1X79 B;  1L0L D;  3HD7 B;  1QVF O;  1SQV D;  1BCC E;  3MP7 B;  1N73 C;  1L4A B;  3H25 A;  2P1J A;  1NTK E;  5APT A;  4ZNC A;  1GU5 A;  4EIJ A;  4U3F E;  1HWT C;  1JMM A;  3AE2 C;  1M56 D;  4EOT A;  1KTM A;  1HTL C;  1OZH A;  3WUU A;  2QVA A;  2YKQ A;  3TSI A;  3AEF C;  1JNM A;  3AE7 C;  2YIU B;  3FGA D;  1EZV D;  1TFF A;  3L73 J;  3P8C E;  1IJD B;  4KJM A;  2OGU A;  3BCC J;  2K9J A;  5BU5 A;  1SQP G;  3L70 D;  3CIR D;  1CI6 A;  1L0L G;  2H89 C;  4JBZ A;  1S3J A;  1N7L A;  4QMA A;  1DD3 A;  3FXE A;  4YSY D;  2M8R A;  1G2C A;  1PGP A;  2E43 A;  1U57 A;  3BCC E;  3BRV B;  5APQ A;  1IFN A;  1SP4 A;  3PJS K;  3TGU J;  1FAV A;  3CCM P;  2WMM A;  1MFT A;  3LW5 H;  2ZFY A;  4RJT A;  2Y9Z A;  2KLV A;  4JYC A;  2FXP A;  3HTK B;  1KIL D;  2WDR C;  1N7S A;  3E7K A;  4PV1 D;  1FOS E;  1SQX K;  1IFI A;  4N78 E;  5AVV B;  2OYI A;  3RK2 C;  1LJ2 A;  1QEX A;  4AQR D;  2HOD B;  3WUV A;  1JO5 A;  3L70 G;  2YMY A;  4NPF X;  4YT0 C;  2YKO A;  2ZVN B;  1S5L E;  2K1A A;  5CHX A;  1ZP0 C;  4Z1M H;  2IDB A;  1M1J A;  2B76 D;  4K3A A;  5AVX B;  1NTZ J;  3L71 E;  3KHU A;  2R3S A;  3UIA A;  5DJU B;  5C2T C;  2KI7 B;  2B87 A;  1MFZ A;  2L91 A;  1NYH A;  1RQV A;  3AEA C;  4LC1 A;  5APW A;  1KV4 A;  1MKM A;  2W27 A;  4I7Z B;  2FYN C;  1L0V D;  4W80 A;  2ACZ C;  5APS A;  3NMD A;  1NTZ E;  2PP6 A;  2E76 B;  3CLQ A;  2O1J A;  1PZQ A;  3MUD A;  3ABV C;  1VPC A;  1FZE A;  1L4A D;  3AE3 D;  3M0A A;  2OYI C;  3WU2 E;  3M9Q A;  4YTP D;  2M0B A;  3Q5P A;  3KXD A;  5AW6 B;  1ZR2 A;  3WUT A;  1HJ0 A;  3SFD D;  1NOH A;  5CJ0 A;  1LWU A;  1BE3 D;  2WWW A;  3H1K D;  1RF0 A;  1E7P C;  1HH0 A;  2NPS C;  1Q86 Q;  3PLN A;  1SFC B;  1AQT A;  1SQP J;  1VQ9 P;  1L0L J;  4H0L C;  1SQV J;  4PJ0 E;  1LP1 B;  2C9N Y;  1S9K D;  1NAF A;  1CSB A;  4KX6 D;  1VQL P;  3P4P D;  3RL0 C;  4IFD K;  1YHQ P;  2K9Y A;  2OYH B;  2FYU E;  2H8P D;  5AW0 B;  4U7J A;  4HYT B;  2FBW C;  1X8Y A;  4TT3 H;  1L0L E;  1VF5 C;  1SQV E;  2E42 A;  3AE4 D;  2MJZ A;  2ZAE B;  2I1J A;  3NFQ A;  3MUD C;  1M8O B;  1FDO A;  2AXT H;  1VQM P;  4EI2 A;  4JF7 A;  3E1R A;  5EFW B;  3H1J G;  3H1L G;  4PD4 D;  3L70 J;  2A06 D;  1YJN P;  1U7M A;  3MHV A;  3CC4 P;  1R5S A;  1EDL A;  2VRS A;  1KC8 Q;  2WPS A;  1LWU C;  1NKZ B;  1JY2 N;  2WSC H;  2HYN A;  1EZV E;  3P4R C;  1RF0 C;  3VON A;  3TNU B;  2E75 C;  1EQ7 A;  1W5C E;  2ZXX A;  3CCL P;  1YIJ P;  2WS3 D;  1PP9 D;  1OIP A;  1JTH B;  1AQ5 A;  3N4X A;  5L8R J;  3R4Y A;  2O01 J;  1QVG O;  2FYU K;  1G1I A;  3L74 G;  2O01 N;  1D7M A;  2Q1K A;  1NTM D;  4KHX A;  1PPJ D;  5KLI C;  4WY4 B;  1LTJ B;  4L74 A;  1H89 A;  1EC5 A;  2E76 D;  1KIL E;  1OW8 A;  3AE5 C;  1NVO A;  4CPG A;  3KZI H;  3PTZ A;  5BVZ A;  3L35 A;  3RBX A;  3VOP A;  1AFO A;  3ZDM A;  2IPP A;  3MD0 A;  4GKG A;  2OYO A;  1FC2 C;  1KFY D;  3CX5 E;  1RY3 A;  2IBZ G;  5KLV D;  2N1T B;  3C1L A;  3A7O A;  3AE9 D;  4EDF A;  2FFD B;  3H32 B;  4UB6 H;  1GD2 E;  1T2K D;  1JM0 A;  3U1A A;  2YKP A;  3M0D A;  3H1H D;  1SFC D;  3AEE C;  4LGD E;  1IFM A;  2KNC A;  5KTB A;  1T3J A;  1IFJ A;  1OW7 A;  2WQY C;  2Q6Q A;  4MN4 C;  1ZV8 A;  1NJI Q;  5APY A;  3B71 A;  1GK6 A;  1J1D C;  2W90 A;  2HG5 D;  1YQ3 D;  1BE3 J;  1RF1 B;  1SQX G;  3VR8 C;  3O6Q B;  2WU5 D;  3H1K J;  5TIS E;  4ASW A;  5CCG D;  3SFE C;  3TGU D;  4YTM C;  2QJY C;  3RK3 B;  3GMA A;  5H2F H;  3HE4 B;  3HUS B;  3AEB D;  1BE3 E;  1Y47 A;  1QGK B;  3H1K E;  1NHL A;  1K04 A;  1OFC X;  2FKW B;  3M0D C;  3B5N D;  3V2N A;  4GT1 A;  4YXD D;  2ZT9 C;  3V2Q A;  1KOR A;  3A0B E;  1MUU A;  3L74 J;  1JCD A;  2JKV A;  4H13 B;  1LTA C;  4OGQ C;  2IBZ I;  2R5B A;  1FZC A;  4H44 D;  1L0N G;  4I2L C;  1YI2 P;  5B66 E;  4YSZ C;  3WMM 0;  2JJL A;  4C7N A;  5AVY B;  3CIR C;  4WY4 D;  4OVN F;  3P4S D;  5KAF H;  1YYC A;  3TDK A;  1YIT P;  3M9B A;  4PD4 E;  4YSY C;  1LT9 C;  1NEK D;  2WDQ C;  2AEJ A;  2A06 E;  2HPC B;  3A0H E;  1PP9 J;  2J58 A;  2A45 G;  1P84 H;  4DCK A;  1URQ B;  2WDV D;  1NEN C;  3TF5 A;  2B89 A;  1GMJ A;  1VL2 A;  3HD7 A;  2MKV A;  4DZO A;  1ZW0 A;  1VQ6 P;  3V2P A;  1L4A A;  1NTM J;  2WT7 B;  1KF6 D;  1AJY A;  2Y0C A;  3M91 A;  1KMI Z;  3AE6 D;  3CCE P;  1PP9 E;  3V2R A;  3LID A;  1NAY A;  3CC7 P;  1JCC A;  2KSE A;  1K8A Q;  1N73 B;  1XTC C;  4O9B A;  3P4Q D;  2XND H;  1BDD A;  3FWN A;  4K35 A;  1NTM E;  3C9I A;  1FZC C;  2BS2 C;  1PPJ E;  2OTJ P;  3L72 G;  3D6Z A;  5AW7 B;  3S9O A;  2BCC G;  5KLV J;  3CWB D;  2KS1 B;  1JY3 O;  1KYO I;  3LW5 J;  4DHZ A;  3AE1 D;  1VQO P;  3OW2 O;  4GIF A;  1PFI A;  2WTY A;  1H0T B;  3H1H J;  5C3J C;  4OWF A;  1L0V C;  4I1L A;  2QRX A;  2IX7 C;  3Q1M A;  1GL2 D;  2XZR A;  2YO3 A;  3L37 A;  3RK3 D;  5KLV E;  1GTW A;  3AEG D;  3HD7 C;  5AW1 B;  1VQ7 P;  2P10 A;  2YNY A;  3S1K A;  1L4A C;  2PRR A;  1IC2 A;  3H1H E;  2WIT A;  1QLB C;  2OTL P;  2P67 A;  4WWI A;  4JPZ B;  1DX7 A;  1S2E A;  3GF3 A;  2IZ1 A;  2UWJ E;  1SQQ K;  1AVY A;  4TLF A;  1GW3 A;  3CWB G;  5AW8 B;  2A45 I;  5CJ4 A;  3L73 E;  1NTM K;  1SQB G;  1L0N J;  2YIU C;  4H13 D;  3MTU E;  5KJ7 D;  4WB4 A;  3HE5 B;  1Q7Y Q;  2KUB A;  1NTK K;  1LT1 A;  1WRG A;  2C0X A;  1NU1 D;  2IFM A;  2N9B A;  4N3Y B;  1Q90 D;  4N6J A;  3P4P C;  3F5H A;  4YSX D;  2AEM A;  2ZYD A;  3O8Z A;  2BEZ F;  3P8M C;  1S72 P;  2KIK A;  2WP9 D;  3TGU E;  2IZ0 A;  2KOG A;  5KKZ B;  1CW5 A;  2JWA A;  3PHL A;  3NTN A;  3AE4 C;  1URQ D;  1LTB C;  2WSF H;  1KYO H;  2NPS A;  4I6M C;  2ZFC A;  2WPQ A;  3SWF A;  4ZKU A;  2FYN B;  3GHG B;  2QA4 P;  1IK7 A;  2LKM A;  3HRN A;  4BRY A;  1VQ8 P;  2QM8 A;  2D2C D;  1HF9 A;  1K73 Q;  2KB7 P;  4YTN D;  1NU1 G;  3SWK A;  1N7S B;  3FX0 A;  1FBM A;  3NXS A;  3RBZ A;  3TYY A;  3KQG A;  1GDT A;  3AED D;  4L75 A;  2QJP B;  4Y28 J;  4DOJ A;  1IK9 A;  1PGJ A;  2RKL A;  5TJH A;  1FZB A;  2ZJS E;  2QIW A;  2A45 H;  3KPE A;  1LP1 A;  4M3L A;  3AE7 D;  2J59 M;  1M1J B;  2Q7C A;  1XTG B;  3USS A;  4I7Z C;  2OYH A;  2KZJ A;  4IL6 H;  2B87 B;  4Y99 B;  1FDM A;  3JCU H;  1OWA A;  4FJV A;  3H1J D;  1PIX A;  1YJW P;  2E76 C;  3H1L D;  3H6P A;  3RL0 B;  3W68 A;  1BGY D;  4XFJ A;  1UIX A;  1H88 A;  2WSC J;  2AXT E;  1M1K Q;  2KLU A;  2HR3 A;  1EXI A;  5KAI H;  1BSN A;  2AEF A;  3CWB J;  4D6T G;  1KFY C;  2WSE J;  1HUC A;  4DT0 A;  1W2E A;  2JR8 A;  1P84 D;  2R32 A;  2P7J A;  1SQB J;  1SQP E;  1EXJ A;  1NGM B;  2WDR D;  1WT6 A;  1NTZ K;  5AW3 B;  1T2K C;  4EYY Q;  3TNU A;  3V5B A;  2IYP A;  3G9R A;  2KSJ A;  3L74 D;  1K05 A;  3CWB E;  4YT0 D;  3VMA A;  2XNX A;  3D71 A;  2GUS A;  4DDG A;  2JO1 A;  1BGY G;  3IN6 A;  1IFD A;  1LTS C;  2OYH C;  4W7Z A;  3VRB D;  4A7P A;  4AYC A;  1JEK A;  3IAO A;  4PJ0 H;  3RK3 E;  3T97 A;  1KFN A;  1YQ3 C;  1ZME C;  3B5N B;  2H88 D;  1LTJ A;  4XE5 B;  2E5T A;  2RH0 A;  2WU5 C;  2QG4 A;  3L70 E;  1YTZ T;  2WSE H;  3AEC C;  5GTI E;  5CCG C;  2P2U A;  1YQ4 C;  3KZI E;  5CCH A;  3A2A A;  4GOE A;  3JC2 2;  2ACZ D;  2IBZ D;  5KLI B;  2V7Q J;  1T8Z A;  3E1I A;  1NU1 J;  4UB8 H;  1GZL A;  2XV5 A;  3AEB C;  3L75 G;  4H44 B;  1SQP K;  1M90 Q;  1N7S D;  3G6E P;  1JB0 J;  3ABV D;  1OVV A;  1L0L K;  2N1T A;  3ITK A;  1SQV K;  2JWD A;  4UB6 E;  4YXD C;  3AE8 C;  1NU1 E;  3V4W A;  1OVR A;  1VQ5 P;  1LTG C;  2WU2 C;  2RN0 A;  1BCC D;  2K88 A;  3BRT B;  3VYI A;  1EDJ A;  2QJK B;  5APX A;  1SQX D;  3H1I D;  2Q9I A;  1LGH B;  1LTJ C;  4IOI H;  1K9M Q;  3CI9 A;  4RES B;  2V7Q H;  3CXH I;  3SWY A;  1ZRT D;  3RL0 D;  1RF1 A;  2G8Y A;  1VQP P;  1J1E C;  3P32 A;  5CCH C;  3VR9 D;  1NO4 A;  5AVW B;  1WMK A;  4D6T J;  2FBW D;  5AW5 B;  1N2D C;  5H2F E;  2WSS H;  3HUS A;  2GA1 A;  2N1T C;  1BCC G;  5E79 H;  1M7L A;  1KYO D;  1FDI A;  2FFD C;  1BDC A;  1P84 I;  3I55 P;  3H1I G;  3H1J J;  3CX5 H;  3H1L J;  1RE3 A;  2WZ7 A;  3CPW O;  1BGY J;  3CCR P;  2M5A B;  1L0N D;  2JEE A;  3P4Q C;  1LT9 A;  1HGV A;  1GL2 B;  4R4M A;  2E75 D;  3N7N A;  3VTP C;  1FZG A;  4YPC A;  2I8D A;  1KB9 I;  2ZT9 B;  3V6I A;  3CC2 P;  2KNC B;  5KJ7 A;  4N78 D;  4R4L A;  4GDO A;  3H1J E;  3A3Y B;  3IR9 A;  1KIL A;  3H1L E;  3VRA D;  1BGY E;  1GW4 A;  1PGO A;  2E74 B;  1RF1 C;  3R2P A;  5KAF E;  1S9K E;  4HH2 A;  3Q5S A;  2M3B A;  3L75 J;  2K3R A;  2HPC A;  3AEG C;  3HUS C;  1URQ A;  3CXH H;  2WPV B;  3AE5 D;  1JY2 O;  1KQS O;  1JY3 P;  1G1J A;  1YBK A;  3G4S P;  1HGZ A;  2YO2 A;  3A5T A;  3L74 E;  2Z4E A;  2FY8 A;  1RE3 C;  1VQK P; 
#chains in the Genus database with same CATH homology
 3P4S C;  3AE7 D;  2YIU C;  4H13 D;  3SFE C;  3AE3 C;  2E75 B;  4YT0 C;  4H0L C;  1KF6 D;  5KLI C;  1AJY A;  3AE8 D;  4YTM C;  2H88 C;  1ZRT E;  1KMI Z;  3AE6 D;  2QJY C;  3AEC C;  2WSF J;  1R8E A;  1ZP0 D;  1S5L X;  3GMA A;  1FDI A;  1YQ4 C;  3O6Q A;  4I7Z C;  4YTP C;  3H25 A;  2E74 D;  3GLM A;  2ACZ D;  4KX6 D;  2OQQ A;  2E76 D;  1KIL E;  4OGQ D;  2WU2 D;  1NEK C;  1OW8 A;  2V7Q J;  3AEB D;  3P4P D;  3AE2 D;  2WS3 C;  3AE5 C;  1OW6 A;  1ZP0 C;  4Z1M H;  2K9Y A;  2IDB A;  5C3J D;  1Q90 D;  1PIX A;  2E74 C;  1K04 A;  3SFD C;  3Q5R A;  3P4Q D;  2E76 C;  3AEB C;  2YMK A;  1TU3 F;  1VF5 D;  4H44 B;  4IL6 X;  4PV1 C;  4U7J A;  3AE2 C;  1KQG B;  2WDV C;  4YSX D;  4YSZ D;  1KTM A;  1RQU A;  2J5U A;  2B76 D;  4XFJ A;  2FBW C;  3AEF D;  2BEZ F;  2QJK C;  1UIX A;  1JB0 J;  2BS2 C;  2WSC J;  3AEA D;  3ABV D;  4TT3 H;  1ZOY D;  3P4Q C;  5C2T C;  2D2C B;  4YXD D;  1VF5 C;  4PV1 B;  2ZT9 C;  2BS3 C;  2WP9 D;  1DIP A;  3AE4 D;  4R4M A;  1NYH A;  3AEF C;  2E75 D;  1RQV A;  3AEA C;  1KFY D;  3D6Z A;  1EXI A;  1KOR A;  3AE7 C;  3FGA D;  1ZOY C;  4H13 C;  4YXD C;  1FDO A;  4H0L B;  2ZT9 B;  3S9O A;  1KF6 C;  3P4P C;  3AE8 C;  2WP9 C;  1MKM A;  3AE4 C;  2BEQ D;  3AE6 C;  3AE9 D;  1Y9B A;  2G3A A;  1KFY C;  4I7Z B;  4R4L A;  2WSE J;  2WDQ D;  4GDO A;  3GF7 A;  3LW5 J;  2FYN C;  4H13 B;  1L0V D;  2ACZ C;  3AE1 D;  4KX6 C;  3C8V A;  2QJP C;  2WU2 C;  4OGQ C;  3AEE D;  3Q3D A;  2H89 D;  3VRA D;  1S1C X;  1EXJ A;  1NGM B;  2WDR D;  5C3J C;  4H44 D;  3CIR D;  1NEN D;  2E74 B;  2JP3 A;  1L0V C;  1IK7 A;  2E76 B;  3AEE C;  2WQY D;  3VR8 D;  3P4R D;  2H89 C;  4YSX C;  3VRA C;  4YSZ C;  5C2T D;  2B76 C;  5M1B A;  3RL0 g;  2D2C D;  3Q1M A;  3CIR C;  1KQF B;  3ABV C;  3Q2Y A;  1OW7 A;  1DD3 A;  1HF9 A;  2WQY C;  1VF5 B;  3P4R C;  3Q5S A;  4YTN D;  2NZ2 A;  3P4S D;  4KT0 J;  3G9R A;  3AEG D;  1K05 A;  4YSY D;  3AE3 D;  4YT0 D;  2E75 C;  2QSI A;  4RKU J;  3D6Y A;  1OMI A;  3B71 A;  3AEC D;  2P10 A;  3D70 A;  1U57 A;  3D71 A;  3EWK A;  4YTN C;  3T97 B;  1YQ4 D;  4YTP D;  2JO1 A;  3AEG C;  3AE9 C;  3AED D;  4YSY C;  2WPV B;  1NEK D;  1QLB C;  3IN6 A;  2WDQ C;  2WS3 D;  3Q5P A;  3AE5 D;  2G8Y A;  3AE1 C;  4OGQ B;  1HJ0 A;  1YQ3 D;  2FXP A;  3VR9 D;  3AED C;  3VRB D;  3SFD D;  4Y28 J;  2WDR C;  4PV1 D;  4H44 C;  5L8R J;  2WDV D;  1WMK A;  3GF3 A;  3R4Y A;  1NEN C;  2BS4 C;  3IAO A;  2FBW D;  3VR8 C;  3RK3 E;  1GMJ A;  1PL5 A;  2WU5 D;  2O01 J;  1PV3 A;  1YQ3 C;  1E7P C;  3VR9 C;  1VL2 A;  3VRB C;  2QIW A;  3SFE D;  2D2C C;  1ZME C;  4H0L D;  2ZT9 D;  4YTM D;  2MKV A;  2H88 D;  5KKZ C;  1DD4 A;  2WU5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...