3AE3C

Crystal structure of porcine heart mitochondrial complex ii bound with 2-nitro-n-phenyl-benzamide
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with 2-Nitro-N-phenyl-benzamide
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 46
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3ae3C01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3ae3C02
3AEAD 2WDQD 3AEGD 3AEAC 2WDQC 3AEGC 3VR9D 4KX6C 3VR9C 2BS2C 2WU2D 3VR8D 2WU2C 5C3JD 3VR8C 3VRBD 2WQYC 1YQ3D 5C3JC 3VRBC 1YQ3C 2H89D 2H89C 2WS3D 1NEND 4YSYD 2WS3C 1NENC 3AECD 4YSYC 1NEKD 3AEED 4YTMD 1KFYD 3AECC 3AE5D 3AEEC 1NEKC 2ACZD 1KFYC 3AE5C 2ACZC 2BS4C 2WDRD 4YTND 2FBWD 2WDRC 4YTNC 1OW8A 2FBWC 1ZOYD 1ZOYC 1KTMA 3AE9D 3AE9C 3AE6D 3AE3D 1KF6D 3AE4D 3AE6C 3AE3C 3AE7D 1KF6C 3AE4C 3AE7C 3CIRD 3P4RD 3ABVD 3CIRC 3B71A 3P4RC 1QLBC 3ABVC 3P4PD 4YXDD 3P4PC 1OW7A 4YTPD 4YTMC 4YTPC 3SFDD 1K05A 3SFDC 4YSXD 1OW6A 4YSXC 1L0VD 2H88D 3AE8D 1L0VC 3AE8C 2H88C 2WP9D 2WP9C 3AE2D 4YSZD 3AE2C 3AE1D 3P4SD 4YSZC 3AE1C 3P4SC 5C2TD 3VRAD 5C2TC 2G3AA 3VRAC 2B76D 3AEDD 2BS3C 2B76C 3AEDC 4YXDC 4KX6D 1E7PC 2WQYD 1YQ4D 2WDVD 1YQ4C 2WDVC 4YT0D 1K04A 1ZP0D 3P4QD 3SFED 4YT0C 1ZP0C 3P4QC 3SFEC 3AEBD 3AEBC 3AEFD 1PV3A 2WU5D 3AEFC 3S9OA 2WU5C
chains in the Genus database with same CATH superfamily
1OWAA 5KAFE 1NTKE 1J1DB 2K9JB 2H8PD 1QX8A 2A45I 1KB9E 1U7MA 4HKZH 1NTKK 3OW2O 2HODB 3AECC 2AEJA 1HBWA 1U57A 1WRGA 2HFED 2V7QJ 1PGPA 1QL1A 4O9BA 3AE9D 3L37A 1DX7A 1UIIA 5APVA 1L4AB 1NH4A 2IPPA 2JP3A 5H2FH 1URQD 2Y0EA 3BCCD 3CIRD 2M0BA 1KQFB 3L71D 4YTPC 1FZAA 1T8ZA 1K9MQ 2OYIA 1NVOA 1SFCC 1R5LA 2WSFH 2RH0A 2WVRA 3AE1D 1N7SA 1IFDA 5CMZA 3VRAD 2P58A 1PP9G 2B76D 3PTZA 1U7JA 1H0TA 3L73E 3HE4B 4D6TJ 2YMKA 2IBZG 3EQ2A 5TISH 2JEEA 1KB9I 3BATA 2WDVD 1KILC 2PP6A 2QJKB 1PGJA 3SFED 3JCUE 1SQQD 4H44D 3WU2H 1YIJP 4RO0A 3G3ZA 1EZVG 2IFMA 2ZVOB 4PV1C 2JO1A 3MZWB 1BE3G 3H1ID 2OTLP 1FJPA 1OVVA 3Q5PA 2LKMA 1SLQA 3V2RA 2JR8A 3VMXA 5CCGD 2IX7C 3A5TA 2ACZD 1JMMA 3CMAP 3GHGC 2R5BA 3BCCE 2R3CA 2W6JH 3L71E 5E79E 1VQMP 1R5SA 3WUTA 1S5LX 2N9YB 1L4AA 3P4PD 1GDTA 5AVZB 1JEKA 1FDMA 3CCJP 1SQVG 2J59M 3O8ZA 5AVUB 4JBZA 5GTIE 2N9BA 1ZV8A 3FXDA 2FYUD 1EZVD 4GT1A 1IC2A 1BE3D 1SQQE 2YO2A 1VF5C 3HE4A 3MD0A 4MN4C 4L74A 1SFCB 1NHLA 2Y0CA 4UB8E 2RKLA 3HUSB 2DW3A 1VPCA 3P8CE 1YJWP 3H1LJ 3H1IE 1BSHA 4ASVA 3AEGD 1SQQK 2QM7A 4JYBA 2E74D 5L8RJ 3VR8D 5KLIC 3A7OA 2WU2C 1KILB 1SQBG 1EC5A 4U3FG 5KJ7A 1SQXK 3KHUA 1T2KD 1NENC 1RF1A 1VQ7P 1M57D 1GW3A 1RF0A 2FBWC 4NPFX 5KLVE 1KTMA 1YTZT 1N8RQ 1KYOD 2B87B 3AE3C 1HWTC 2W27A 3ABVC 4HH2A 3MUDC 1DD3A 5KLVK 1OW6A 3I56P 4CPGA 1EXJA 1LTAC 3BCCJ 2BCCD 3AE2D 2FYUE 1VQNP 1EZVE 1IFIA 2K37A 3L71J 5AVXB 2M3EA 2KS1A 2RN0A 3GF3A 2Q3EA 1JY3P 2Q1KA 2FYUK 4DT0A 2C9NY 1HH0A 1OIPA 3P8MC 4U3FD 1ZP0C 3P4QC 2H7HA 1NAFA 2CPSA 3SWYA 3FWNA 1SFCA 3WUUA 3C1LA 3O6QB 3HUSA 5AW5B 2GM4A 1MV8A 2KSJA 1SQQJ 1N73B 5AW6B 4DJGA 3P7KA 4D6TG 1HGVA 2A45G 1JCCA 1IFPA 4TLFA 1X9VA 1L0ND 1KILA 1S3JA 4YTMD 1DIPA 3H1IJ 1DEBA 1GW4A 3GG2A 1PL5A 1ZOYD 1EZVI 2QIWA 3AE9C 2ZYGA 1GU4A 2KI7B 1G1IA 1NJIQ 1ZXGA 2K1AA 1URQC 2B87A 3VP8A 3CIRC 1FJKA 4R4LA 4BXLA 1JM0A 1OW7A 2LR2A 4IL6E 3A0HH 1HTLC 1AQ5A 2BCCE 1ZR4A 1YBKA 1R8EA 1DD4A 4RESB 3IR9A 1BCCG 1NTKG 1Q82Q 1JUNA 3AE1C 1RY3A 3VRAC 2B76C 3F5HA 2QSIA 2D2CD 3HTKB 1VQLP 3QH9A 4H13B 2XV5A 2WDVC 2GA1A 2FYUJ 3SFEC 2XNXA 1NTMD 1KYOI 4H44C 2NRGA 2E5YA 1GK6A 3A0BH 2AEMA 2H43A 2P67A 3VR9D 1S9KD 1J1DC 3USSA 1L0NE 2ZT9D 2QG4A 2WQYC 2QM8A 3KPEA 1N73A 1NYHA 5AVYB 3H32B 3CX5E 3VN0A 5CCGC 2WSEJ 4YPCA 2Q6QA 2ITAA 5APQA 2Q3IA 2E42A 2ACZC 1L0NK 2WDRD 1HJ0A 3RBZA 2YIUC 2YNYA 5K5GB 1EDJA 1BCCD 2QEXP 3L73G 3BRVB 3CLQA 1NTKD 3CCVP 2WSSH 3MP7B 2MKVA 3SSUA 3P4PC 1W2EA 5AVTB 3PLNA 3AE8D 3NMDA 1HUCA 3SWKA 1AFOA 3A3YB 4PD4H 4I6LA 1URQB 2G3AA 2XNDH 2BS3C 2KIKA 1IK9A 2YKOA 1UIXA 1X8YA 2FXPA 2BCCJ 3JSVC 3HTKA 1NTME 2E76D 1ZN5A 1LT9C 3G9RA 1KN7A 1NKNA 2ZXEB 1AJYA 3W67A 3BCCG 1E79H 2UWJE 4ZMDA 1L0LD 1MUUA 3D71A 1M8OB 2C0WA 3D70A 3C9IA 2FFDC 3L71G 1NTMK 3AEGC 2E74C 5APWA 2Z5HA 1KYOH 1GZLA 1M7LA 2P2UA 2ZFCA 2ZYDA 3H25A 3VR8C 1OZHA 1VQ6P 3L73D 3M06A 3V2QA 1IZNB 1RF1C 3BVHA 4H44B 2FKWB 1VQ5P 4L76A 4LDTA 1T2KC 1NEKD 3CWBD 1RF0C 1BCCE 1YHQP 3WMM0 1LNQA 1OW8A 2KLUA 3I5CA 1L0NJ 1H88A 1RH5B 5B5EE 2WPRA 3AE6D 3BASA 1OXZA 1KF6D 1PIXA 1NTZD 1SQQG 5GTHH 1BDCA 3D6YA 3II6A 1QL2A 2OGUA 3CXHD 2JWAA 2FY8A 4XE5B 3BRTB 2YIUB 2KXPB 2WSCH 1SQXG 1P84D 3H1IG 2H88D 2W6AA 1KD1Q 3AE2C 3L35A 5C2TD 3FWLA 3EWKA 4B86A 2AXCA 1XTCC 5DJTB 3AEDD 2WMMA 3P32A 1URQA 4OWFA 4C7NB 2IFNA 3G6EP 2YKPA 5AW2B 1LJ2A 4C7RA 3JC22 5CBNA 3CCQP 5AVVB 1RHZB 1VQPP 1L0LE 3CCLP 3AEBD 2JWDA 5KLVG 1HVVA 3HUSC 4NPDA 4DHZA 2W8ZA 1OVUA 1N7LA 1GTWA 1BDDA 3AEAD 1ZMEC 2OYOA 1S72P 4YXWH 4KX6C 2JKVA 3CCUP 1NGMB 3RGUA 3CL3D 4GIFA 2R3SA 1NTMJ 3VRBD 1OMIA 1L0LK 2KLVA 2KOGA 2V7QH 1K73Q 1LT9B 3CWBE 2KUBA 1ZW0A 2H89D 5M1BA 1FZFA 5KAIE 3AE5D 2FYUG 2WPSA 2FFDB 1LTJC 2BS4C 4A7PA 3CC2P 1LTIC 2E74B 3P8CD 2AXTH 1IJDB 1SQXD 1RE4C 1NTZE 3VYIA 1GD2E 1ZOYC 4WBAA 5CBOA 2YXQB 1RF1B 3CXHE 3K5BA 3GLMA 2LXCB 1IFNA 3P4RD 3RL0g 4YXDD 1P84E 1BCCJ 1BGYD 5CCGA 1NTZK 5APXA 3SFDD 1NTKJ 1W2BO 1OVRA 2P7JA 3NXSA 2XKMA 3M0DA 1L0VD 2A45H 2CPBA 3L72D 5KLVD 2Z4EA 4FJVA 2PAJA 1PGQA 1FZEA 3V2PA 2D2CC 3RK2B 1S1CX 2JJLA 4DDIA 4N78D 3KZIE 2E75B 1FE6A 4C7NA 1FBMA 2KS1B 2L91A 1CZQA 3SWFA 2Y9YA 1RQVA 1OFCX 4PJ0H 2WPVB 1HF9A 1JNMA 2XZRA 1YI2P 3VONA 5KAFH 3VR9C 3HE5B 1Y8AA 4NPEA 3HD7D 2ZT9C 3MIWA 1N73C 1YQ3D 3RL0D 2B9BA 2BCCG 1RQUA 4Y28J 1IFJA 1P84I 1AA0A 1L0LJ 3IF4A 2KB7P 1NAYA 3VTPC 2WS3D 4YSYD 1LT9A 1SQXE 1NOHA 4ASWA 1KB9H 2XU6A 3L73J 2WDRC 2BEQD 2FFDA 5CCHD 4N3YB 1AVOA 2KNCB 5CCHA 3CWBJ 1BGYE 3AE7D 4DHJA 1EDKA 1N2DC 3RK3D 1LTJB 5AW7B 3L4FA 4DDGA 3L72E 1VQ9P 1BSNA 1NTZJ 1JMBA 1LTBC 2I1KA 1JY2N 4C46A 2N1TD 3AE8C 4YSZD 1EDIA 1L0NG 1QGKB 4KHXA 5KTBA 2J5UA 4N78E 5KKZC 3IN6A 3RK2D 5DJUB 1KV4A 3VMAA 4DZOA 2E75D 3L70D 4JYCA 4H13C 2E76C 1Y9BA 3JCUH 1QLED 1EDLA 2D2CB 5AW4B 1TFFA 3Q3DA 3IFMA 5C3JD 3W68A 4WB4A 1S5LE 3HE5A 4Y99C 2POHA 4I7ZC 2GUSA 2KYVA 4L75A 2KZIA 3AEED 1KFYD 1NEKC 3Q5SA 3L75D 2C9LY 3VP9A 2ZT9B 1LWUB 3RK3E 2QA4P 4UB6E 3AE4D 3AE6C 1KF6C 4GOEA 1NTMG 2KNCA 3TF5A 5E79H 1WT6A 1SQXJ 3Q1MA 3CX5D 3E7KA 2YO3A 1LTJA 4TT3H 2H88C 4EYYQ 3GW6A 1RE4A 3P4SD 1BGYJ 5GTIH 5C2TC 3AEDC 3L70E 2PRRA 4JQ0D 2IYOA 5B66E 3L72J 3QWOC 5KLVJ 1M1JC 4KT0J 3B5ND 3TGUD 4JPZB 2KSEA 1M56D 1KQGB 2W6BA 3UIAA 3AEBC 4UB8H 2ZJSE 5KKZB 2Q9IA 3AEAC 3L74D 4HYTB 3LW5J 3KYQA 1K8AQ 5APTA 3CC4P 1FS0E 2QJPB 1NU1D 3VRBC 2E76B 1GK4A 2W90A 4EDFA 3V2NA 2H89C 3L75E 3S1KA 4W80A 2A06D 3AE5C 4DCKA 2W83C 2O01J 5H2FE 2HPCB 2O1KA 4Y99B 1NO4A 1X22A 1FZCC 4I7ZB 1LWUA 5AW1B 3MTUE 3P4RC 1KFMA 2SPZA 1QVGO 1L0LG 3M0DC 1K05A 1VF5D 3SFDC 2RMZA 3CCEP 2HLOA 4JF7A 4EIJA 2WT7B 1L0VC 3TDKA 3KXDA 3V6IA 1GL2D 2ZVNB 4HB1A 3Q2YA 1FC2C 3CWBG 5TISE 1CI6B 4EOTA 3TGUE 1E7PC 3TK1A 4ZNCA 1VDFA 1FOSF 2O3JA 4WVZA 4I6MC 2ZXXA 4YT0D 3WU2E 1VQ8P 4OGQD 1S4XA 3L74E 1FU1A 1NTZG 3S9OA 4IFFA 1W5CE 2NPSD 1MKMA 1QEXA 1NU1E 2WSEH 3L70J 5AW3B 2WDQD 1FOSE 1M1JB 3V4QA 3CX5I 3HD7C 1YQ3C 3RL0C 1USEA 2A06E 3L36A 1EQ7A 2WS3C 3GF7A 1NU1K 4KJMA 3E1IA 4YSYC 2OTJP 3RBXA 3E1RA 4YTND 1JY2O 3H1JD 5APUA 1IFMA 5CCHC 4WY4B 3NFQA 2CK3H 3B8EB 3AE7C 2HPCA 1PFIA 3L75J 3RK3C 2AEFA 4OH8B 4GODA 4IL6H 1VQKP 5C39A 1SQPD 1JOCA 1VQ4P 2N1TC 4IFDK 4M3LA 2KZJA 2NZ2A 4YSZC 1SP4A 1J2JB 1YJ9P 1FZCB 2WT7A 5APYA 4LLHA 1X79B 2QVAA 2PGDA 1TU3F 3RK2C 1KFNA 2QJYC 2HYNA 3D6ZA 1KMIZ 2WSFJ 1CI6A 2OYHC 2E75C 3TSIA 2QE7H 3U1AA 3F89A 3IAOA 2C0XA 2WWWA 3B4SA 2VRSA 1Q86Q 3ZDMA 3NTNA 3R2PA 1BGYG 3CPWO 3TGUJ 1JO5A 3MHVA 5CJ0A 2BEZF 5AVWB 5C3JC 4ZKPA 3CD6P 2FYZA 1M1JA 2KK7A 3L72G 3L74J 4GOFA 2KP8A 3H1JE 3CX5H 1PPJD 3AEEC 1RE3A 1KFYC 1NU1J 2K9YA 2Y0DA 4W7YA 5BU5A 1N7SD 1QVFO 3HD7B 3H1KD 4WY4D 3RL0B 3TNUA 1J1EB 2L5GB 2K88A 3AE4C 4WY4A 3GMAA 3H1LE 1SQPE 4YTMC 4DOJA 1M90Q 4H0LD 3CCSP 2FYNC 5BVZA 3P4SC 2FXMA 1SQPK 2WTYA 1T3UA 3RK3B 1FZCA 1LTTC 2WQYD 2R5DA 1YQ4D 1DEEG 2N1TB 2K9JA 3B5NC 4K3AA 3KQGA 3VMYA 1MFTA 1MFZA 3PP5A 3AEFD 1PV3A 1EXIA 1X0TA 2HODA 1SVFA 2V4HA 2QJYB 1FDOA 5APSA 2YXRB 1FDIA 2OYHB 3G71P 3LIEA 3M0AA 1L4AD 1USDA 1PPJE 2E43A 1YITP 1LTGC 1PP9D 3EFGA 2IBZD 2QRXA 3H1KE 4DHIB 1LP1B 1KC8Q 2M8RA 3CXHI 3L70G 3PH0A 1YJNP 3R4YA 1LWUC 2Y9ZA 2M5AB 5B5EH 3CCMP 3HD7A 1Q81Q 3A0HE 2I8DA 3H1JJ 1A02F 5CHXA 2WPQA 3G4SP 1LTSC 1AQTA 4QMAA 3Q5RA 4YSXD 3KDPB 3H1HG 2ZFYA 2WP9D 1N86A 5AVRB 1JY3N 3TYYA 4BRYB 2Z5IA 2O1JA 1GL2C 4PD4D 2IZ1A 4XA4A 5AW0B 1SQPJ 1Q2NA 2WITA 3V5BA 3L75G 1Z56A 3HRNA 3OJAB 4IL6X 5KJ7D 4I2LC 2FYNB 2R44A 1G2CB 4YT0C 4OVNF 2N1TA 4OGQC 3A0BE 2WU5D 1GMJA 3C8VA 2YKQA 3M9BA 4AUWA 2NPSC 1DH3A 2O01N 1YYCA 4PV1B 2WDQC 1FAVA 1SQVD 1PP9E 1H8AA 2Q5UA 5AW9B 2QJPC 1MZ9A 3B5NB 5EFWB 2B89A 4XFJA 3VOPA 3OAKA 1JB0J 2IBZE 2OYHA 1AVYA 4LC1A 3AECD 3GHGB 4N6JA 5KAIH 4LGDE 2ZAEB 4YTNC 2P1JA 2IZ0A 4I1LA 3M9HA 3H1HD 3TGUG 1LP1A 1AV1A 4U7JA 1BE3E 3CXHH 2M5AA 3T97B 4YTPD 3CC7P 1ZRTD 2XDJA 3L74G 3H1KJ 1P84H 1H89A 5AVSB 2M3BA 4PD4E 1SQBD 1NU1G 4IFMA 1SFCD 3VMZA 3U59A 4GDOA 4BRYA 1E5WA 1T6AA 1Q7YQ 4RJTA 1NWQA 2A06G 4KX6D 1JY2P 1IK7A 3A2AA 1WMKA 3I55P 1VF5B 1OX3A 3EFFK 2IBZI 1KILD 1T3JA 1IO4A 2I1JA 2E5TA 3KZIH 1GL2B 1HJBA 1A02J 1KORA 2K3RA 1G2CA 5AW8B 2Q7CA 1SQVE 3WUVA 3N7NA 3MGNA 2FXOA 1KYOE 3FX0A 4PV1D 5KLIB 1XTGB 2P10A 3CCRP 2BS2C 4K35A 1G1JA 4WWIA 3S4RA 1Y47A 1SQVK 2WZ7A 4OGQB 2MJZA 3B5NA 1RE3C 1VQOP 1S2EA 1FZBA 2NPSB 3H1HE 4PD4I 2IYPA 2OYIC 1CW5A 1FZGA 3GHGA 2OARA 5BU8B 1GU5A 1PP9J 1N7SC 4HJGH 5GTHE 1JTHB 4WY4C 1ZRTE 2OTKE 3B71A 2J58A 1L2PA 3U1CA 3M9QA 1SQBE 1SS1A 4U3FE 2BASA 1PZQA 3T97A 4H0LC 4D6TD 1ZR2A 4GKGA 4EI2A 3FXEA 2HG5D 1SQBK 1BE3J 2G8YA 1KILE 4RKUJ 4YXDC 5CJ4A 3O6QA 1M1KQ 1NKZB 4W7ZA 3H1JG 2JDIH 2ZYAA 2HR3A 3LW5H 2B88A 1YQ4C 4BWNA 3PJSK 1K04A 1JCDA 2R32A 5AVQB 4AYCA 2LXBA 3AEFC 1PGOA 1GL2A 3LIDA 1LGHB 3H1LG 2WU2D 2PFXA 1SQPG 4IOIH 4L73A 2O01H 1L4AC 2OQQA 1NEND 1S5LH 3V4WA 1SQVJ 2AXTE 2YMYA 5TJHA 1KB9D 3FGAD 2FBWD 1YTZI 2NPSA 1JY3O 1D7MA 3ITKA 1J1EC 1KQSO 3AE3D 1KQLA 1VL2A 1JTHA 4ZKUA 1LT1A 4Z1MH 3ABVD 4UB6H 1QLBC 2GUVA 4D6TE 1HGZA 2OYIB 3H1HJ 3MUDA 1KZUB 3TNUB 4H13D 4YSXC 1N7SB 3N4XA 2WP9C 1CSBA 2QJKC 3H6PA 1H0TB 3PRJA 1S9KE 1Q90D 1PPJG 2WSCJ 1SQBJ 3PHLA 4U3FJ 3H1LD 4R4MA 3M91A 4H0LB 3CMEP 3OA7A 5KJ7C 2IDBA 1ZP0D 3H1KG 5B66H 3P4QD 1ZLLA 3CI9A 4PJ0E 4AQRD 2WU5C 3H32A
chains in the Genus database with same CATH topology
1MKMA 1EXIA 2WPVB 3D71A 3D70A 1HF9A 3AEAD 2WDQD 3AEGD 2D2CB 4PV1B 3AEAC 1ZMEC 4PV1D 2WDQC 3AEGC 2E74D 5L8RJ 4PV1C 3LW5J 2JO1A 3VR9D 4KX6C 2E74C 2P10A 1FDOA 1NGMB 2BS2C 2WU2D 3VR8D 3VR9C 5KLIC 3H25A 2BEZF 2WU2C 2ZT9D 3Q3DA 5C3JD 3VR8C 3VRBD 1FDIA 1OMIA 2WQYC 2ZT9C 1YQ3D 5C3JC 2QJPC 3VRBC 2E76B 1YQ3C 1RQUA 4XFJA 4Y28J 3Q5PA 1NYHA 2H89D 1JB0J 2OQQA 4H44B 4OGQB 2H89C 2WS3D 5M1BA 1NEND 4YSYD 2WS3C 4I7ZC 3GF7A 2WSEJ 1NENC 3AECD 4YSYC 1NEKD 3AEED 4YTMD 1DIPA 3AECC 1KFYD 3AE5D 3AEEC 1NEKC 2ACZD 3Q5SA 1KFYC 1U57A 3AE5C 2ACZC 2BS4C 2K9YA 3FGAD 1HJ0A 2WDRD 4YTND 1PL5A 2E74B 2FBWD 2WDRC 2V7QJ 2BEQD 4YTNC 1OW8A 2FBWC 2YIUC 1ZOYD 1ZOYC 1KTMA 3AE9D 2ZT9B 2QIWA 2O01J 3AE9C 3RK3E 3R4YA 3AE6D 3AE3D 1KF6D 2JP3A 1ZRTE 1PIXA 3AE6C 3AE4D 3AE3C 4U7JA 3AE7D 1KF6C 3AE4C 3GLMA 1VL2A 3GMAA 4I7ZB 1S5LX 3AE7C 3CIRD 4Z1MH 3P4RD 3RL0g 3ABVD 3CIRC 3B71A 3P4RC 1QLBC 2MKVA 3ABVC 3P4PD 4YXDD 4R4LA 3D6YA 1DD3A 1OW7A 1KQFB 3T97B 3Q1MA 3P4PC 4YTPD 4YTMC 4YTPC 3SFDD 3Q5RA 1R8EA 1K05A 1DD4A 1VF5D 3SFDC 4YSXD 1OW6A 4H0LD 1EXJA 4H13D 4YSXC 1L0VD 4H0LC 2H88D 3AE8D 1L0VC 4TT3H 2H88C 3AE8C 2WP9D 2FYNC 2WP9C 3AE2D 4YSZD 2QJKC 2NZ2A 3AE2C 3AE1D 3P4SD 4YSZC 3AE1C 3P4SC 5C2TD 3EWKA 3VRAD 5C2TC 2G3AA 4GDOA 1Q90D 3VRAC 2J5UA 3Q2YA 2B76D 2G8YA 3GF3A 3AEDD 2BS3C 2B76C 3AEDC 1KILE 1UIXA 4RKUJ 2QSIA 2D2CD 2WSCJ 5KKZC 4YXDC 4KX6D 2YMKA 2D2CC 2FXPA 1E7PC 3IN6A 1IK7A 1S1CX 1TU3F 1WMKA 3O6QA 4R4MA 1VF5B 4IL6X 2QJYC 4H0LB 2WQYD 4H13B 1VF5C 2E75B 1YQ4D 1KMIZ 2E75D 3D6ZA 2WSFJ 2WDVD 4H13C 4KT0J 1YQ4C 2E76D 2E75C 2WDVC 2IDBA 4YT0D 1K04A 1ZP0D 2E76C 3P4QD 3SFED 4YT0C 1ZP0C 3IAOA 1KQGB 1Y9BA 3G9RA 3P4QC 3SFEC 3AEBD 4H44D 4OGQD 3AEBC 1AJYA 4H44C 4OGQC 1PV3A 1KORA 3AEFD 2WU5D 1RQVA 3AEFC 3S9OA 2WU5C 1GMJA 3C8VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AEA D;  2WDQ D;  3AEG D;  3AEA C;  2WDQ C;  3AEG C;  3VR9 D;  4KX6 C;  3VR9 C;  2BS2 C;  2WU2 D;  3VR8 D;  2WU2 C;  5C3J D;  3VR8 C;  3VRB D;  2WQY C;  1YQ3 D;  5C3J C;  3VRB C;  1YQ3 C;  2H89 D;  2H89 C;  2WS3 D;  1NEN D;  4YSY D;  2WS3 C;  1NEN C;  3AEC D;  4YSY C;  1NEK D;  3AEE D;  4YTM D;  1KFY D;  3AEC C;  3AE5 D;  3AEE C;  1NEK C;  2ACZ D;  1KFY C;  3AE5 C;  2ACZ C;  2BS4 C;  2WDR D;  4YTN D;  2FBW D;  2WDR C;  4YTN C;  1OW8 A;  2FBW C;  1ZOY D;  1ZOY C;  1KTM A;  3AE9 D;  3AE9 C;  3AE6 D;  3AE3 D;  1KF6 D;  3AE4 D;  3AE6 C;  3AE3 C;  3AE7 D;  1KF6 C;  3AE4 C;  3AE7 C;  3CIR D;  3P4R D;  3ABV D;  3CIR C;  3B71 A;  3P4R C;  1QLB C;  3ABV C;  3P4P D;  4YXD D;  3P4P C;  1OW7 A;  4YTP D;  4YTM C;  4YTP C;  3SFD D;  1K05 A;  3SFD C;  4YSX D;  1OW6 A;  4YSX C;  1L0V D;  2H88 D;  3AE8 D;  1L0V C;  3AE8 C;  2H88 C;  2WP9 D;  2WP9 C;  3AE2 D;  4YSZ D;  3AE2 C;  3AE1 D;  3P4S D;  4YSZ C;  3AE1 C;  3P4S C;  5C2T D;  3VRA D;  5C2T C;  2G3A A;  3VRA C;  2B76 D;  3AED D;  2BS3 C;  2B76 C;  3AED C;  4YXD C;  4KX6 D;  1E7P C;  2WQY D;  1YQ4 D;  2WDV D;  1YQ4 C;  2WDV C;  4YT0 D;  1K04 A;  1ZP0 D;  3P4Q D;  3SFE D;  4YT0 C;  1ZP0 C;  3P4Q C;  3SFE C;  3AEB D;  3AEB C;  3AEF D;  1PV3 A;  2WU5 D;  3AEF C;  3S9O A;  2WU5 C; 
#chains in the Genus database with same CATH topology
 1OWA A;  5KAF E;  1NTK E;  1J1D B;  2K9J B;  2H8P D;  1QX8 A;  2A45 I;  1KB9 E;  1U7M A;  4HKZ H;  1NTK K;  3OW2 O;  2HOD B;  3AEC C;  2AEJ A;  1HBW A;  1U57 A;  1WRG A;  2HFE D;  2V7Q J;  1PGP A;  1QL1 A;  4O9B A;  3AE9 D;  3L37 A;  1DX7 A;  1UII A;  5APV A;  1L4A B;  1NH4 A;  2IPP A;  2JP3 A;  5H2F H;  1URQ D;  2Y0E A;  3BCC D;  3CIR D;  2M0B A;  1KQF B;  3L71 D;  4YTP C;  1FZA A;  1T8Z A;  1K9M Q;  2OYI A;  1NVO A;  1SFC C;  1R5L A;  2WSF H;  2RH0 A;  2WVR A;  3AE1 D;  1N7S A;  1IFD A;  5CMZ A;  3VRA D;  2P58 A;  1PP9 G;  2B76 D;  3PTZ A;  1U7J A;  1H0T A;  3L73 E;  3HE4 B;  4D6T J;  2YMK A;  2IBZ G;  3EQ2 A;  5TIS H;  2JEE A;  1KB9 I;  3BAT A;  2WDV D;  1KIL C;  2PP6 A;  2QJK B;  1PGJ A;  3SFE D;  3JCU E;  1SQQ D;  4H44 D;  3WU2 H;  1YIJ P;  4RO0 A;  3G3Z A;  1EZV G;  2IFM A;  2ZVO B;  4PV1 C;  2JO1 A;  3MZW B;  1BE3 G;  3H1I D;  2OTL P;  1FJP A;  1OVV A;  3Q5P A;  2LKM A;  1SLQ A;  3V2R A;  2JR8 A;  3VMX A;  5CCG D;  2IX7 C;  3A5T A;  2ACZ D;  1JMM A;  3CMA P;  3GHG C;  2R5B A;  3BCC E;  2R3C A;  2W6J H;  3L71 E;  5E79 E;  1VQM P;  1R5S A;  3WUT A;  1S5L X;  2N9Y B;  1L4A A;  3P4P D;  1GDT A;  5AVZ B;  1JEK A;  1FDM A;  3CCJ P;  1SQV G;  2J59 M;  3O8Z A;  5AVU B;  4JBZ A;  5GTI E;  2N9B A;  1ZV8 A;  3FXD A;  2FYU D;  1EZV D;  4GT1 A;  1IC2 A;  1BE3 D;  1SQQ E;  2YO2 A;  1VF5 C;  3HE4 A;  3MD0 A;  4MN4 C;  4L74 A;  1SFC B;  1NHL A;  2Y0C A;  4UB8 E;  2RKL A;  3HUS B;  2DW3 A;  1VPC A;  3P8C E;  1YJW P;  3H1L J;  3H1I E;  1BSH A;  4ASV A;  3AEG D;  1SQQ K;  2QM7 A;  4JYB A;  2E74 D;  5L8R J;  3VR8 D;  5KLI C;  3A7O A;  2WU2 C;  1KIL B;  1SQB G;  1EC5 A;  4U3F G;  5KJ7 A;  1SQX K;  3KHU A;  1T2K D;  1NEN C;  1RF1 A;  1VQ7 P;  1M57 D;  1GW3 A;  1RF0 A;  2FBW C;  4NPF X;  5KLV E;  1KTM A;  1YTZ T;  1N8R Q;  1KYO D;  2B87 B;  3AE3 C;  1HWT C;  2W27 A;  3ABV C;  4HH2 A;  3MUD C;  1DD3 A;  5KLV K;  1OW6 A;  3I56 P;  4CPG A;  1EXJ A;  1LTA C;  3BCC J;  2BCC D;  3AE2 D;  2FYU E;  1VQN P;  1EZV E;  1IFI A;  2K37 A;  3L71 J;  5AVX B;  2M3E A;  2KS1 A;  2RN0 A;  3GF3 A;  2Q3E A;  1JY3 P;  2Q1K A;  2FYU K;  4DT0 A;  2C9N Y;  1HH0 A;  1OIP A;  3P8M C;  4U3F D;  1ZP0 C;  3P4Q C;  2H7H A;  1NAF A;  2CPS A;  3SWY A;  3FWN A;  1SFC A;  3WUU A;  3C1L A;  3O6Q B;  3HUS A;  5AW5 B;  2GM4 A;  1MV8 A;  2KSJ A;  1SQQ J;  1N73 B;  5AW6 B;  4DJG A;  3P7K A;  4D6T G;  1HGV A;  2A45 G;  1JCC A;  1IFP A;  4TLF A;  1X9V A;  1L0N D;  1KIL A;  1S3J A;  4YTM D;  1DIP A;  3H1I J;  1DEB A;  1GW4 A;  3GG2 A;  1PL5 A;  1ZOY D;  1EZV I;  2QIW A;  3AE9 C;  2ZYG A;  1GU4 A;  2KI7 B;  1G1I A;  1NJI Q;  1ZXG A;  2K1A A;  1URQ C;  2B87 A;  3VP8 A;  3CIR C;  1FJK A;  4R4L A;  4BXL A;  1JM0 A;  1OW7 A;  2LR2 A;  4IL6 E;  3A0H H;  1HTL C;  1AQ5 A;  2BCC E;  1ZR4 A;  1YBK A;  1R8E A;  1DD4 A;  4RES B;  3IR9 A;  1BCC G;  1NTK G;  1Q82 Q;  1JUN A;  3AE1 C;  1RY3 A;  3VRA C;  2B76 C;  3F5H A;  2QSI A;  2D2C D;  3HTK B;  1VQL P;  3QH9 A;  4H13 B;  2XV5 A;  2WDV C;  2GA1 A;  2FYU J;  3SFE C;  2XNX A;  1NTM D;  1KYO I;  4H44 C;  2NRG A;  2E5Y A;  1GK6 A;  3A0B H;  2AEM A;  2H43 A;  2P67 A;  3VR9 D;  1S9K D;  1J1D C;  3USS A;  1L0N E;  2ZT9 D;  2QG4 A;  2WQY C;  2QM8 A;  3KPE A;  1N73 A;  1NYH A;  5AVY B;  3H32 B;  3CX5 E;  3VN0 A;  5CCG C;  2WSE J;  4YPC A;  2Q6Q A;  2ITA A;  5APQ A;  2Q3I A;  2E42 A;  2ACZ C;  1L0N K;  2WDR D;  1HJ0 A;  3RBZ A;  2YIU C;  2YNY A;  5K5G B;  1EDJ A;  1BCC D;  2QEX P;  3L73 G;  3BRV B;  3CLQ A;  1NTK D;  3CCV P;  2WSS H;  3MP7 B;  2MKV A;  3SSU A;  3P4P C;  1W2E A;  5AVT B;  3PLN A;  3AE8 D;  3NMD A;  1HUC A;  3SWK A;  1AFO A;  3A3Y B;  4PD4 H;  4I6L A;  1URQ B;  2G3A A;  2XND H;  2BS3 C;  2KIK A;  1IK9 A;  2YKO A;  1UIX A;  1X8Y A;  2FXP A;  2BCC J;  3JSV C;  3HTK A;  1NTM E;  2E76 D;  1ZN5 A;  1LT9 C;  3G9R A;  1KN7 A;  1NKN A;  2ZXE B;  1AJY A;  3W67 A;  3BCC G;  1E79 H;  2UWJ E;  4ZMD A;  1L0L D;  1MUU A;  3D71 A;  1M8O B;  2C0W A;  3D70 A;  3C9I A;  2FFD C;  3L71 G;  1NTM K;  3AEG C;  2E74 C;  5APW A;  2Z5H A;  1KYO H;  1GZL A;  1M7L A;  2P2U A;  2ZFC A;  2ZYD A;  3H25 A;  3VR8 C;  1OZH A;  1VQ6 P;  3L73 D;  3M06 A;  3V2Q A;  1IZN B;  1RF1 C;  3BVH A;  4H44 B;  2FKW B;  1VQ5 P;  4L76 A;  4LDT A;  1T2K C;  1NEK D;  3CWB D;  1RF0 C;  1BCC E;  1YHQ P;  3WMM 0;  1LNQ A;  1OW8 A;  2KLU A;  3I5C A;  1L0N J;  1H88 A;  1RH5 B;  5B5E E;  2WPR A;  3AE6 D;  3BAS A;  1OXZ A;  1KF6 D;  1PIX A;  1NTZ D;  1SQQ G;  5GTH H;  1BDC A;  3D6Y A;  3II6 A;  1QL2 A;  2OGU A;  3CXH D;  2JWA A;  2FY8 A;  4XE5 B;  3BRT B;  2YIU B;  2KXP B;  2WSC H;  1SQX G;  1P84 D;  3H1I G;  2H88 D;  2W6A A;  1KD1 Q;  3AE2 C;  3L35 A;  5C2T D;  3FWL A;  3EWK A;  4B86 A;  2AXC A;  1XTC C;  5DJT B;  3AED D;  2WMM A;  3P32 A;  1URQ A;  4OWF A;  4C7N B;  2IFN A;  3G6E P;  2YKP A;  5AW2 B;  1LJ2 A;  4C7R A;  3JC2 2;  5CBN A;  3CCQ P;  5AVV B;  1RHZ B;  1VQP P;  1L0L E;  3CCL P;  3AEB D;  2JWD A;  5KLV G;  1HVV A;  3HUS C;  4NPD A;  4DHZ A;  2W8Z A;  1OVU A;  1N7L A;  1GTW A;  1BDD A;  3AEA D;  1ZME C;  2OYO A;  1S72 P;  4YXW H;  4KX6 C;  2JKV A;  3CCU P;  1NGM B;  3RGU A;  3CL3 D;  4GIF A;  2R3S A;  1NTM J;  3VRB D;  1OMI A;  1L0L K;  2KLV A;  2KOG A;  2V7Q H;  1K73 Q;  1LT9 B;  3CWB E;  2KUB A;  1ZW0 A;  2H89 D;  5M1B A;  1FZF A;  5KAI E;  3AE5 D;  2FYU G;  2WPS A;  2FFD B;  1LTJ C;  2BS4 C;  4A7P A;  3CC2 P;  1LTI C;  2E74 B;  3P8C D;  2AXT H;  1IJD B;  1SQX D;  1RE4 C;  1NTZ E;  3VYI A;  1GD2 E;  1ZOY C;  4WBA A;  5CBO A;  2YXQ B;  1RF1 B;  3CXH E;  3K5B A;  3GLM A;  2LXC B;  1IFN A;  3P4R D;  3RL0 g;  4YXD D;  1P84 E;  1BCC J;  1BGY D;  5CCG A;  1NTZ K;  5APX A;  3SFD D;  1NTK J;  1W2B O;  1OVR A;  2P7J A;  3NXS A;  2XKM A;  3M0D A;  1L0V D;  2A45 H;  2CPB A;  3L72 D;  5KLV D;  2Z4E A;  4FJV A;  2PAJ A;  1PGQ A;  1FZE A;  3V2P A;  2D2C C;  3RK2 B;  1S1C X;  2JJL A;  4DDI A;  4N78 D;  3KZI E;  2E75 B;  1FE6 A;  4C7N A;  1FBM A;  2KS1 B;  2L91 A;  1CZQ A;  3SWF A;  2Y9Y A;  1RQV A;  1OFC X;  4PJ0 H;  2WPV B;  1HF9 A;  1JNM A;  2XZR A;  1YI2 P;  3VON A;  5KAF H;  3VR9 C;  3HE5 B;  1Y8A A;  4NPE A;  3HD7 D;  2ZT9 C;  3MIW A;  1N73 C;  1YQ3 D;  3RL0 D;  2B9B A;  2BCC G;  1RQU A;  4Y28 J;  1IFJ A;  1P84 I;  1AA0 A;  1L0L J;  3IF4 A;  2KB7 P;  1NAY A;  3VTP C;  2WS3 D;  4YSY D;  1LT9 A;  1SQX E;  1NOH A;  4ASW A;  1KB9 H;  2XU6 A;  3L73 J;  2WDR C;  2BEQ D;  2FFD A;  5CCH D;  4N3Y B;  1AVO A;  2KNC B;  5CCH A;  3CWB J;  1BGY E;  3AE7 D;  4DHJ A;  1EDK A;  1N2D C;  3RK3 D;  1LTJ B;  5AW7 B;  3L4F A;  4DDG A;  3L72 E;  1VQ9 P;  1BSN A;  1NTZ J;  1JMB A;  1LTB C;  2I1K A;  1JY2 N;  4C46 A;  2N1T D;  3AE8 C;  4YSZ D;  1EDI A;  1L0N G;  1QGK B;  4KHX A;  5KTB A;  2J5U A;  4N78 E;  5KKZ C;  3IN6 A;  3RK2 D;  5DJU B;  1KV4 A;  3VMA A;  4DZO A;  2E75 D;  3L70 D;  4JYC A;  4H13 C;  2E76 C;  1Y9B A;  3JCU H;  1QLE D;  1EDL A;  2D2C B;  5AW4 B;  1TFF A;  3Q3D A;  3IFM A;  5C3J D;  3W68 A;  4WB4 A;  1S5L E;  3HE5 A;  4Y99 C;  2POH A;  4I7Z C;  2GUS A;  2KYV A;  4L75 A;  2KZI A;  3AEE D;  1KFY D;  1NEK C;  3Q5S A;  3L75 D;  2C9L Y;  3VP9 A;  2ZT9 B;  1LWU B;  3RK3 E;  2QA4 P;  4UB6 E;  3AE4 D;  3AE6 C;  1KF6 C;  4GOE A;  1NTM G;  2KNC A;  3TF5 A;  5E79 H;  1WT6 A;  1SQX J;  3Q1M A;  3CX5 D;  3E7K A;  2YO3 A;  1LTJ A;  4TT3 H;  2H88 C;  4EYY Q;  3GW6 A;  1RE4 A;  3P4S D;  1BGY J;  5GTI H;  5C2T C;  3AED C;  3L70 E;  2PRR A;  4JQ0 D;  2IYO A;  5B66 E;  3L72 J;  3QWO C;  5KLV J;  1M1J C;  4KT0 J;  3B5N D;  3TGU D;  4JPZ B;  2KSE A;  1M56 D;  1KQG B;  2W6B A;  3UIA A;  3AEB C;  4UB8 H;  2ZJS E;  5KKZ B;  2Q9I A;  3AEA C;  3L74 D;  4HYT B;  3LW5 J;  3KYQ A;  1K8A Q;  5APT A;  3CC4 P;  1FS0 E;  2QJP B;  1NU1 D;  3VRB C;  2E76 B;  1GK4 A;  2W90 A;  4EDF A;  3V2N A;  2H89 C;  3L75 E;  3S1K A;  4W80 A;  2A06 D;  3AE5 C;  4DCK A;  2W83 C;  2O01 J;  5H2F E;  2HPC B;  2O1K A;  4Y99 B;  1NO4 A;  1X22 A;  1FZC C;  4I7Z B;  1LWU A;  5AW1 B;  3MTU E;  3P4R C;  1KFM A;  2SPZ A;  1QVG O;  1L0L G;  3M0D C;  1K05 A;  1VF5 D;  3SFD C;  2RMZ A;  3CCE P;  2HLO A;  4JF7 A;  4EIJ A;  2WT7 B;  1L0V C;  3TDK A;  3KXD A;  3V6I A;  1GL2 D;  2ZVN B;  4HB1 A;  3Q2Y A;  1FC2 C;  3CWB G;  5TIS E;  1CI6 B;  4EOT A;  3TGU E;  1E7P C;  3TK1 A;  4ZNC A;  1VDF A;  1FOS F;  2O3J A;  4WVZ A;  4I6M C;  2ZXX A;  4YT0 D;  3WU2 E;  1VQ8 P;  4OGQ D;  1S4X A;  3L74 E;  1FU1 A;  1NTZ G;  3S9O A;  4IFF A;  1W5C E;  2NPS D;  1MKM A;  1QEX A;  1NU1 E;  2WSE H;  3L70 J;  5AW3 B;  2WDQ D;  1FOS E;  1M1J B;  3V4Q A;  3CX5 I;  3HD7 C;  1YQ3 C;  3RL0 C;  1USE A;  2A06 E;  3L36 A;  1EQ7 A;  2WS3 C;  3GF7 A;  1NU1 K;  4KJM A;  3E1I A;  4YSY C;  2OTJ P;  3RBX A;  3E1R A;  4YTN D;  1JY2 O;  3H1J D;  5APU A;  1IFM A;  5CCH C;  4WY4 B;  3NFQ A;  2CK3 H;  3B8E B;  3AE7 C;  2HPC A;  1PFI A;  3L75 J;  3RK3 C;  2AEF A;  4OH8 B;  4GOD A;  4IL6 H;  1VQK P;  5C39 A;  1SQP D;  1JOC A;  1VQ4 P;  2N1T C;  4IFD K;  4M3L A;  2KZJ A;  2NZ2 A;  4YSZ C;  1SP4 A;  1J2J B;  1YJ9 P;  1FZC B;  2WT7 A;  5APY A;  4LLH A;  1X79 B;  2QVA A;  2PGD A;  1TU3 F;  3RK2 C;  1KFN A;  2QJY C;  2HYN A;  3D6Z A;  1KMI Z;  2WSF J;  1CI6 A;  2OYH C;  2E75 C;  3TSI A;  2QE7 H;  3U1A A;  3F89 A;  3IAO A;  2C0X A;  2WWW A;  3B4S A;  2VRS A;  1Q86 Q;  3ZDM A;  3NTN A;  3R2P A;  1BGY G;  3CPW O;  3TGU J;  1JO5 A;  3MHV A;  5CJ0 A;  2BEZ F;  5AVW B;  5C3J C;  4ZKP A;  3CD6 P;  2FYZ A;  1M1J A;  2KK7 A;  3L72 G;  3L74 J;  4GOF A;  2KP8 A;  3H1J E;  3CX5 H;  1PPJ D;  3AEE C;  1RE3 A;  1KFY C;  1NU1 J;  2K9Y A;  2Y0D A;  4W7Y A;  5BU5 A;  1N7S D;  1QVF O;  3HD7 B;  3H1K D;  4WY4 D;  3RL0 B;  3TNU A;  1J1E B;  2L5G B;  2K88 A;  3AE4 C;  4WY4 A;  3GMA A;  3H1L E;  1SQP E;  4YTM C;  4DOJ A;  1M90 Q;  4H0L D;  3CCS P;  2FYN C;  5BVZ A;  3P4S C;  2FXM A;  1SQP K;  2WTY A;  1T3U A;  3RK3 B;  1FZC A;  1LTT C;  2WQY D;  2R5D A;  1YQ4 D;  1DEE G;  2N1T B;  2K9J A;  3B5N C;  4K3A A;  3KQG A;  3VMY A;  1MFT A;  1MFZ A;  3PP5 A;  3AEF D;  1PV3 A;  1EXI A;  1X0T A;  2HOD A;  1SVF A;  2V4H A;  2QJY B;  1FDO A;  5APS A;  2YXR B;  1FDI A;  2OYH B;  3G71 P;  3LIE A;  3M0A A;  1L4A D;  1USD A;  1PPJ E;  2E43 A;  1YIT P;  1LTG C;  1PP9 D;  3EFG A;  2IBZ D;  2QRX A;  3H1K E;  4DHI B;  1LP1 B;  1KC8 Q;  2M8R A;  3CXH I;  3L70 G;  3PH0 A;  1YJN P;  3R4Y A;  1LWU C;  2Y9Z A;  2M5A B;  5B5E H;  3CCM P;  3HD7 A;  1Q81 Q;  3A0H E;  2I8D A;  3H1J J;  1A02 F;  5CHX A;  2WPQ A;  3G4S P;  1LTS C;  1AQT A;  4QMA A;  3Q5R A;  4YSX D;  3KDP B;  3H1H G;  2ZFY A;  2WP9 D;  1N86 A;  5AVR B;  1JY3 N;  3TYY A;  4BRY B;  2Z5I A;  2O1J A;  1GL2 C;  4PD4 D;  2IZ1 A;  4XA4 A;  5AW0 B;  1SQP J;  1Q2N A;  2WIT A;  3V5B A;  3L75 G;  1Z56 A;  3HRN A;  3OJA B;  4IL6 X;  5KJ7 D;  4I2L C;  2FYN B;  2R44 A;  1G2C B;  4YT0 C;  4OVN F;  2N1T A;  4OGQ C;  3A0B E;  2WU5 D;  1GMJ A;  3C8V A;  2YKQ A;  3M9B A;  4AUW A;  2NPS C;  1DH3 A;  2O01 N;  1YYC A;  4PV1 B;  2WDQ C;  1FAV A;  1SQV D;  1PP9 E;  1H8A A;  2Q5U A;  5AW9 B;  2QJP C;  1MZ9 A;  3B5N B;  5EFW B;  2B89 A;  4XFJ A;  3VOP A;  3OAK A;  1JB0 J;  2IBZ E;  2OYH A;  1AVY A;  4LC1 A;  3AEC D;  3GHG B;  4N6J A;  5KAI H;  4LGD E;  2ZAE B;  4YTN C;  2P1J A;  2IZ0 A;  4I1L A;  3M9H A;  3H1H D;  3TGU G;  1LP1 A;  1AV1 A;  4U7J A;  1BE3 E;  3CXH H;  2M5A A;  3T97 B;  4YTP D;  3CC7 P;  1ZRT D;  2XDJ A;  3L74 G;  3H1K J;  1P84 H;  1H89 A;  5AVS B;  2M3B A;  4PD4 E;  1SQB D;  1NU1 G;  4IFM A;  1SFC D;  3VMZ A;  3U59 A;  4GDO A;  4BRY A;  1E5W A;  1T6A A;  1Q7Y Q;  4RJT A;  1NWQ A;  2A06 G;  4KX6 D;  1JY2 P;  1IK7 A;  3A2A A;  1WMK A;  3I55 P;  1VF5 B;  1OX3 A;  3EFF K;  2IBZ I;  1KIL D;  1T3J A;  1IO4 A;  2I1J A;  2E5T A;  3KZI H;  1GL2 B;  1HJB A;  1A02 J;  1KOR A;  2K3R A;  1G2C A;  5AW8 B;  2Q7C A;  1SQV E;  3WUV A;  3N7N A;  3MGN A;  2FXO A;  1KYO E;  3FX0 A;  4PV1 D;  5KLI B;  1XTG B;  2P10 A;  3CCR P;  2BS2 C;  4K35 A;  1G1J A;  4WWI A;  3S4R A;  1Y47 A;  1SQV K;  2WZ7 A;  4OGQ B;  2MJZ A;  3B5N A;  1RE3 C;  1VQO P;  1S2E A;  1FZB A;  2NPS B;  3H1H E;  4PD4 I;  2IYP A;  2OYI C;  1CW5 A;  1FZG A;  3GHG A;  2OAR A;  5BU8 B;  1GU5 A;  1PP9 J;  1N7S C;  4HJG H;  5GTH E;  1JTH B;  4WY4 C;  1ZRT E;  2OTK E;  3B71 A;  2J58 A;  1L2P A;  3U1C A;  3M9Q A;  1SQB E;  1SS1 A;  4U3F E;  2BAS A;  1PZQ A;  3T97 A;  4H0L C;  4D6T D;  1ZR2 A;  4GKG A;  4EI2 A;  3FXE A;  2HG5 D;  1SQB K;  1BE3 J;  2G8Y A;  1KIL E;  4RKU J;  4YXD C;  5CJ4 A;  3O6Q A;  1M1K Q;  1NKZ B;  4W7Z A;  3H1J G;  2JDI H;  2ZYA A;  2HR3 A;  3LW5 H;  2B88 A;  1YQ4 C;  4BWN A;  3PJS K;  1K04 A;  1JCD A;  2R32 A;  5AVQ B;  4AYC A;  2LXB A;  3AEF C;  1PGO A;  1GL2 A;  3LID A;  1LGH B;  3H1L G;  2WU2 D;  2PFX A;  1SQP G;  4IOI H;  4L73 A;  2O01 H;  1L4A C;  2OQQ A;  1NEN D;  1S5L H;  3V4W A;  1SQV J;  2AXT E;  2YMY A;  5TJH A;  1KB9 D;  3FGA D;  2FBW D;  1YTZ I;  2NPS A;  1JY3 O;  1D7M A;  3ITK A;  1J1E C;  1KQS O;  3AE3 D;  1KQL A;  1VL2 A;  1JTH A;  4ZKU A;  1LT1 A;  4Z1M H;  3ABV D;  4UB6 H;  1QLB C;  2GUV A;  4D6T E;  1HGZ A;  2OYI B;  3H1H J;  3MUD A;  1KZU B;  3TNU B;  4H13 D;  4YSX C;  1N7S B;  3N4X A;  2WP9 C;  1CSB A;  2QJK C;  3H6P A;  1H0T B;  3PRJ A;  1S9K E;  1Q90 D;  1PPJ G;  2WSC J;  1SQB J;  3PHL A;  4U3F J;  3H1L D;  4R4M A;  3M91 A;  4H0L B;  3CME P;  3OA7 A;  5KJ7 C;  2IDB A;  1ZP0 D;  3H1K G;  5B66 H;  3P4Q D;  1ZLL A;  3CI9 A;  4PJ0 E;  4AQR D;  2WU5 C;  3H32 A; 
#chains in the Genus database with same CATH homology
 1MKM A;  1EXI A;  2WPV B;  3D71 A;  3D70 A;  1HF9 A;  3AEA D;  2WDQ D;  3AEG D;  2D2C B;  4PV1 B;  3AEA C;  1ZME C;  4PV1 D;  2WDQ C;  3AEG C;  2E74 D;  5L8R J;  4PV1 C;  3LW5 J;  2JO1 A;  3VR9 D;  4KX6 C;  2E74 C;  2P10 A;  1FDO A;  1NGM B;  2BS2 C;  2WU2 D;  3VR8 D;  3VR9 C;  5KLI C;  3H25 A;  2BEZ F;  2WU2 C;  2ZT9 D;  3Q3D A;  5C3J D;  3VR8 C;  3VRB D;  1FDI A;  1OMI A;  2WQY C;  2ZT9 C;  1YQ3 D;  5C3J C;  2QJP C;  3VRB C;  2E76 B;  1YQ3 C;  1RQU A;  4XFJ A;  4Y28 J;  3Q5P A;  1NYH A;  2H89 D;  1JB0 J;  2OQQ A;  4H44 B;  4OGQ B;  2H89 C;  2WS3 D;  5M1B A;  1NEN D;  4YSY D;  2WS3 C;  4I7Z C;  3GF7 A;  2WSE J;  1NEN C;  3AEC D;  4YSY C;  1NEK D;  3AEE D;  4YTM D;  1DIP A;  3AEC C;  1KFY D;  3AE5 D;  3AEE C;  1NEK C;  2ACZ D;  3Q5S A;  1KFY C;  1U57 A;  3AE5 C;  2ACZ C;  2BS4 C;  2K9Y A;  3FGA D;  1HJ0 A;  2WDR D;  4YTN D;  1PL5 A;  2E74 B;  2FBW D;  2WDR C;  2V7Q J;  2BEQ D;  4YTN C;  1OW8 A;  2FBW C;  2YIU C;  1ZOY D;  1ZOY C;  1KTM A;  3AE9 D;  2ZT9 B;  2QIW A;  2O01 J;  3AE9 C;  3RK3 E;  3R4Y A;  3AE6 D;  3AE3 D;  1KF6 D;  2JP3 A;  1ZRT E;  1PIX A;  3AE6 C;  3AE4 D;  3AE3 C;  4U7J A;  3AE7 D;  1KF6 C;  3AE4 C;  3GLM A;  1VL2 A;  3GMA A;  4I7Z B;  1S5L X;  3AE7 C;  3CIR D;  4Z1M H;  3P4R D;  3RL0 g;  3ABV D;  3CIR C;  3B71 A;  3P4R C;  1QLB C;  2MKV A;  3ABV C;  3P4P D;  4YXD D;  4R4L A;  3D6Y A;  1DD3 A;  1OW7 A;  1KQF B;  3T97 B;  3Q1M A;  3P4P C;  4YTP D;  4YTM C;  4YTP C;  3SFD D;  3Q5R A;  1R8E A;  1K05 A;  1DD4 A;  1VF5 D;  3SFD C;  4YSX D;  1OW6 A;  4H0L D;  1EXJ A;  4H13 D;  4YSX C;  1L0V D;  4H0L C;  2H88 D;  3AE8 D;  1L0V C;  4TT3 H;  2H88 C;  3AE8 C;  2WP9 D;  2FYN C;  2WP9 C;  3AE2 D;  4YSZ D;  2QJK C;  2NZ2 A;  3AE2 C;  3AE1 D;  3P4S D;  4YSZ C;  3AE1 C;  3P4S C;  5C2T D;  3EWK A;  3VRA D;  5C2T C;  2G3A A;  4GDO A;  1Q90 D;  3VRA C;  2J5U A;  3Q2Y A;  2B76 D;  2G8Y A;  3GF3 A;  3AED D;  2BS3 C;  2B76 C;  3AED C;  1KIL E;  1UIX A;  4RKU J;  2QSI A;  2D2C D;  2WSC J;  5KKZ C;  4YXD C;  4KX6 D;  2YMK A;  2D2C C;  2FXP A;  1E7P C;  3IN6 A;  1IK7 A;  1S1C X;  1TU3 F;  1WMK A;  3O6Q A;  4R4M A;  1VF5 B;  4IL6 X;  2QJY C;  4H0L B;  2WQY D;  4H13 B;  1VF5 C;  2E75 B;  1YQ4 D;  1KMI Z;  2E75 D;  3D6Z A;  2WSF J;  2WDV D;  4H13 C;  4KT0 J;  1YQ4 C;  2E76 D;  2E75 C;  2WDV C;  2IDB A;  4YT0 D;  1K04 A;  1ZP0 D;  2E76 C;  3P4Q D;  3SFE D;  4YT0 C;  1ZP0 C;  3IAO A;  1KQG B;  1Y9B A;  3G9R A;  3P4Q C;  3SFE C;  3AEB D;  4H44 D;  4OGQ D;  3AEB C;  1AJY A;  4H44 C;  4OGQ C;  1PV3 A;  1KOR A;  3AEF D;  2WU5 D;  1RQV A;  3AEF C;  3S9O A;  2WU5 C;  1GMJ A;  3C8V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...