3AE3C

Crystal structure of porcine heart mitochondrial complex ii bound with 2-nitro-n-phenyl-benzamide
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
138
structure length
138
Chain Sequence
b'TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with 2-Nitro-N-phenyl-benzamide
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 46
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3ae3C01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3ae3C02
3VR8C 2WU5C 4KX6C 2WP9C 1K04A 3P4QD 2BS4C 1PV3A 4YSYC 4YXDC 2FBWD 3AE1C 2WU5D 3VR8D 1NEND 4YSYD 2WDVD 2H89D 3AE1D 3P4RD 1ZP0C 4YSXD 3AEDC 1KF6D 3AE6C 3B71A 2B76C 3AEAC 3AEDD 3AEGC 5C2TD 3P4PC 4YTMC 3AEAD 3VRBD 3VR9C 1KTMA 3AE9D 3AE7D 1YQ3D 3P4QC 3AEEC 3VR9D 2FBWC 3AE2C 1E7PC 1NENC 2WDVC 3AEED 2H89C 2WDRD 3P4RC 5C3JD 3AE2D 4YSXC 3AE8C 1KF6C 2WDQD 3AE8D 5C2TC 3AEBC 1OW7A 1QLBC 4YTNC 3VRBC 3VRAC 3SFDC 1L0VD 3AEBD 3AE9C 3AE7C 1YQ3C 3CIRD 3P4SD 3SFED 4YTND 3VRAD 3SFDD 2WU2C 2H88D 2WDRC 3AEFD 5C3JC 2WU2D 1OW6A 3AE5C 1NEKC 2WS3D 2WDQC 1NEKD 2BS3C 3AE5D 2WQYD 3AECD 3AE4D 3ABVD 2G3AA 1L0VC 3CIRC 3SFEC 3P4SC 3S9OA 2H88C 4YTPC 2BS2C 4YT0C 1ZOYC 3AEFC 1KFYD 3AE3C 4YTPD 2WS3C 4YT0D 1YQ4D 1ZOYD 4YSZC 4KX6D 2WP9D 1OW8A 3AE3D 4YXDD 1K05A 4YSZD 2WQYC 3AECC 3AE4C 3ABVC 1ZP0D 2ACZC 3AE6D 2B76D 2ACZD 3AEGD 1KFYC 3P4PD 4YTMD 1YQ4C
chains in the Genus database with same CATH superfamily
2VRSA 1VQ6P 2BS4C 3S1KA 1RE3A 3FX0A 4BWNA 2HODB 2KLUA 3BCCG 1EZVE 3A0HE 1IFJA 4IL6H 1N7LA 5B5EH 4TLFA 3MGNA 2KSJA 3A0BH 3P8CE 2JWDA 3H1HJ 4I1LA 1ZXGA 4IL6X 2H8PD 5CJ0A 4HYTB 2WPSA 1CZQA 2HYNA 3L70E 3MUDC 2WMMA 2N9YB 4HJGH 2JWAA 2NZ2A 2JEEA 2BCCJ 5KLIB 2QJYB 3JCUE 5C3JC 4OGQB 1BCCG 1Q82Q 3SSUA 3A2AA 3T97A 2AEMA 3RL0B 3GF7A 1RF1A 4WBAA 2K1AA 3FXEA 1XTGB 3NXSA 4R4MA 4XFJA 3WUUA 2O01N 5KJ7A 5KKZB 2R5BA 3BCCJ 1S5LH 3RBXA 2WP9D 3AE3D 1KILE 4I7ZB 3CC2P 1PPJD 1N2DC 3AECC 3H1HE 1RF0A 2HODA 1OXZA 4DHZA 4WY4B 2ZXEB 5TJHA 5KAFH 3AEGD 1S5LX 5E79E 1RQVA 2E74D 2WU5C 2B89A 2A45H 1LTJC 3CCJP 1NTZJ 1NWQA 3I56P 3MD0A 3AEDC 3RL0g 1EDKA 3H1KE 3WMM0 4GOEA 1M1JA 3VRBD 2YKOA 4IFDK 1JEKA 2XNXA 4MN4C 1KB9D 4AQRD 3CXHE 3BCCE 3FXDA 3AEED 2L91A 2O1KA 4RO0A 1VQMP 1N8RQ 1Y8AA 1N7SB 2Q5UA 2N1TD 4L73A 3CMEP 1VQKP 4LC1A 5K5GB 1IFPA 1GK4A 2GUSA 5KAIH 1FZFA 1GL2D 2C0WA 3KZIH 4N6JA 5CBNA 1G1JA 3CIRC 2GUVA 5GTIE 3HD7D 4YTPC 4Y28J 4WY4A 1LP1B 3L73D 1BCCE 5CMZA 2WSEJ 2JJLA 2LXCB 5AW4B 3VMZA 2K3RA 4YXDD 4JF7A 1SQXD 4H0LB 1JY2P 3BVHA 4PJ0H 4ZNCA 1SFCD 5APVA 1ZLLA 2OQQA 5KTBA 2FYUK 3PP5A 4K35A 3M06A 1J2JB 2PAJA 1YJWP 1E5WA 3RK2C 1JM0A 3AE1C 1L0LG 1JMBA 1KB9H 4YSYD 2AEFA 1EZVD 3AE6C 1N7SA 2M0BA 3B8EB 1USEA 1KTMA 1HGVA 2AXTH 3VMYA 1EZVI 4PV1C 1RQUA 2O01H 4UB6E 5AVSB 3VN0A 3G71P 1Z56A 1FJKA 1FS0E 4NPFX 1NHLA 5APXA 2ZT9D 2FYUG 1FZEA 2D2CD 3SFDC 1PIXA 3GW6A 1AV1A 3AE7C 3SFED 5B66H 4IFMA 2H88D 2YIUC 2Z4EA 1H0TB 1X9VA 2OYHB 1LP1A 2WU2D 1OW6A 2AEJA 1NOHA 2OTKE 3EFGA 1WRGA 3IAOA 3B5ND 2R44A 3AE4D 3IFMA 5AVZB 3P7KA 1X79B 3RBZA 1SQBG 1T2KD 3RK3B 4YT0C 3D71A 3BRTB 3CCEP 2OTJP 1AFOA 1KILD 2QSIA 2WS3C 5L8RJ 3CX5H 2L5GB 2KP8A 4W80A 1KYOH 1SS1A 1NTMG 2A06D 1N73B 4ZMDA 3WU2H 4O9BA 2FYUJ 1FDIA 3SWFA 3V2RA 1R5LA 2E76C 1JCCA 2PGDA 3CD6P 2OTLP 1L0LE 3OA7A 3HE5B 3L74D 1VQ4P 2JDIH 5C3JD 2YMYA 3AE2D 1H0TA 2OYHA 1BE3D 3CXHI 1XTCC 3CWBG 3FWLA 1BDCA 3VRAC 2RH0A 2E74B 4OVNF 1JB0J 4PD4H 4U7JA 1BGYG 4AYCA 2Q3EA 2HLOA 2WPRA 2BS3C 2Y9YA 2FYUE 3AECD 4DT0A 1BCCD 1NAYA 3VYIA 3P4SC 3E7KA 4NPDA 5KAFE 4I6LA 1N73A 1PP9G 2WVRA 3L75J 1SQVK 1JCDA 1ZRTE 1IFIA 2N1TB 4N78E 2QRXA 3RK3E 5KLVG 1S1CX 2JR8A 1JY2N 3WUVA 3ABVC 1SQBE 3H1ID 1GL2B 3VMAA 1KQGB 1GU5A 5AW3B 2FYNB 1VQNP 1GTWA 2XNDH 2Y9ZA 1ZV8A 1T8ZA 1SLQA 3VR8D 3HE5A 1NTME 3CCVP 2IZ0A 3HD7B 5KAIE 3P4PC 4D6TD 5AW2B 5APSA 1BGYJ 2XV5A 3L72J 2KB7P 3GLMA 3VR9D 4U3FD 1SQVG 3TGUG 1E7PC 2OYIC 3O8ZA 1SFCB 1KF6C 1SQQK 1X22A 1GW4A 3L71D 1Q81Q 1LT9B 4Y99B 4I2LC 4ZKPA 1GZLA 2QJPB 3CIRD 1KZUB 3BASA 1U7JA 3V6IA 3HUSB 1RHZB 2O01J 1FDOA 3CWBE 4PJ0E 2N1TA 3KYQA 3CC4P 1T6AA 2V7QH 3TF5A 1R8EA 1QX8A 1FE6A 1HVVA 1GL2A 3S9OA 2BS2C 1BGYE 3AEFC 1HWTC 1PGQA 5H2FE 1NGMB 1JY3O 1K05A 4H13D 4YSZD 3B4SA 1SQQG 2ZFCA 2D2CB 3AE6D 1SQVJ 3MIWA 3TGUJ 3HD7A 2AXTE 1J1DC 5KLVE 3B5NB 4IOIH 4PV1D 1VQ8P 2KYVA 2BCCG 1QGKB 1RF1B 1SFCA 3OW2O 1S2EA 3AEAC 3I5CA 2IPPA 4YTMC 1VQ7P 1JOCA 1LT9A 3AE7D 3P4QC 3U1CA 2IX7C 2WDVC 3HUSA 3AE8D 1J1EC 4I6MC 1SQVE 5CCGC 3TGUE 3AEBD 2O1JA 4C46A 2E75C 1OVVA 1K73Q 1E79H 3VP9A 2KZIA 2WDRC 1M8OB 2MKVA 1SQQJ 4H44B 2WS3D 3CX5E 2W6AA 1L0NK 1RF0C 1KYOE 1FOSF 1QVGO 1VF5B 1M1JB 2E5YA 1NTZG 2WSCH 3WU2E 5CJ4A 4EIJA 1NTKK 3OAKA 3V4QA 3U1AA 2KOGA 2QJKC 4W7YA 1EDIA 4HH2A 1AVOA 2RMZA 1OVUA 3B5NA 3FGAD 4OWFA 2KK7A 1A02J 3M9BA 3CMAP 5GTHE 2ACZD 1JY3P 2XZRA 1JY2O 2KXPB 1DEEG 3PJSK 3TK1A 1NTMD 1KILA 1K04A 3H1JJ 4DOJA 5KLIC 3CCRP 1SQQE 3E1IA 1NU1D 1QEXA 1L0NG 3PRJA 2WSFH 1L4AD 2CPBA 4L75A 2H43A 1IK9A 1W2BO 1LTJB 5CBOA 2BCCE 5KKZC 2NPSB 1LWUB 1JMMA 4I7ZC 1LT1A 3MTUE 2HG5D 3KPEA 1K9MQ 3TSIA 4YTNC 3D70A 2YXQB 3P4SD 3WUTA 3V2PA 3ITKA 3Q3DA 1URQC 1RE4C 1NEKD 3AE5D 4UB8H 3ABVD 3QWOC 2Q9IA 2R32A 3CCSP 2BASA 1ZOYC 2ZYGA 1VPCA 5AW7B 3V2QA 1LGHB 2MJZA 1L0NJ 3NTNA 3JC22 1YIJP 2PP6A 3V2NA 1PP9D 2WQYC 1NTZE 3N4XA 2V7QJ 1FZBA 1SQPK 1NTKJ 1DIPA 2FFDC 1KORA 3H1IJ 2QE7H 3P4PD 1YQ4C 1HJ0A 2Y0CA 3H1LG 1VL2A 4DHJA 1M56D 1LTJA 2B87B 2KIKA 5AW0B 2NPSA 1ZP0C 1MUUA 1KF6D 3Q5RA 1LWUA 4GOFA 4HB1A 2IBZG 1G2CA 1D7MA 1W5CE 5CCHD 4DDIA 4H13B 1L0NE 5BU8B 4JYCA 2XDJA 1FDMA 2FXMA 1KQSO 2ZAEB 2BEZF 1LTSC 1NTKE 4WB4A 3L71J 1YQ3C 3P8CD 1HUCA 1P84E 4PV1B 3AEFD 3BRVB 1MFTA 1YJNP 3IR9A 2M5AB 3L70D 4GDOA 3CX5I 2G3AA 3H1LJ 2V4HA 1KYOI 4YXWH 3TNUB 5AVRB 3PTZA 1NYHA 1WT6A 1ZMEC 3H6PA 1IFMA 4RJTA 2A45G 2P10A 2OGUA 2B87A 1GDTA 4M3LA 4A7PA 1GU4A 4DZOA 4YTMD 1JY3N 3GHGB 1OIPA 2RKLA 3P4QD 4HKZH 4L74A 2OYHC 3H1HD 4XE5B 2WDVD 3PHLA 1SQPJ 3CCUP 1QVFO 3B71A 1DH3A 3H1LE 3A0HH 4IL6E 5B5EE 5CCGD 3RK3C 2KNCB 1GMJA 3A0BE 3H32B 2FBWC 2H7HA 1NENC 4JQ0D 2WDRD 3L75G 3H1KD 1VQOP 2IBZE 1AA0A 2WSFJ 4JBZA 2KUBA 4RKUJ 1N73C 2M5AA 2YKQA 2Q3IA 3CXHD 1MFZA 3BCCD 1NKNA 2QA4P 1HBWA 2YMKA 3JCUH 3TNUA 4L76A 2W8ZA 4EDFA 1MZ9A 4LGDE 2J5UA 1L4AB 3C8VA 2Y0EA 2KS1B 3MP7B 1GK6A 4LDTA 3AE3C 3GHGA 1S5LE 1FZCC 1T3JA 3L72G 5AW6B 1AJYA 1CI6B 3Q5PA 2OARA 1OWAA 4GODA 3II6A 1SQXK 2WWWA 1NJIQ 2E74C 2KNCA 2P7JA 2WU5D 3H32A 3IF4A 4EI2A 5CHXA 2E43A 2ITAA 3H25A 2HFED 3AEDD 1EXIA 3S4RA 3IN6A 5APWA 3VTPC 3M0AA 2FKWB 2IDBA 3AEEC 3CXHH 5BVZA 2I1KA 2N1TC 1YBKA 2H89C 3HRNA 5BU5A 1URQD 4YSXC 2KI7B 4TT3H 1QLED 3L73G 2R5DA 1L4AA 3G3ZA 1KD1Q 1Y47A 3AE9C 3G9RA 3CPWO 2KS1A 5M1BA 3L75E 5AVUB 2K9JB 2QIWA 1FZGA 3KZIE 1BSHA 1KFNA 1P84I 2WQYD 1H89A 1L0VC 1CI6A 3HD7C 4BRYB 1BDDA 1PL5A 1USDA 1FU1A 3Q5SA 3CCLP 2WSSH 2QEXP 4YTPD 1YQ4D 1GD2E 2IYPA 1OW8A 3M0DA 2I1JA 4JPZB 1ZP0D 1R5SA 1IZNB 1LT9C 1L2PA 2QJPC 5AW8B 1KFYC 4ZKUA 3L72E 4KX6C 1RE3C 2W27A 3HUSC 1PGJA 4YSYC 5DJTB 3L73J 3RK2D 1KB9E 2JP3A 3AE1D 3VMXA 2GA1A 1Q7YQ 3E1RA 2ZT9B 1SQXJ 3MZWB 1UIXA 2B76C 3VOPA 3PH0A 4GT1A 2QVAA 1NAFA 3L37A 1YQ3D 2Q1KA 1S3JA 2KSEA 2Z5IA 1HF9A 1YTZT 2K9JA 4UB6H 1QL2A 2D2CC 5C2TC 1KC8Q 1OW7A 1L0LD 2WTYA 3F89A 1AQ5A 2XU6A 1HJBA 4DDGA 2R3SA 2IBZI 5B66E 3C1LA 1KILB 4BRYA 3SFDD 2WU2C 4C7RA 5CCHA 1QL1A 1LTBC 2PRRA 5AVQB 2A06G 3L73E 5APQA 3B5NC 2KLVA 3R4YA 3H1JG 1RF1C 1H8AA 2FY8A 3KXDA 3L70J 1T2KC 4LLHA 4EYYQ 1DD4A 5KJ7C 4DJGA 4YT0D 5TISH 2FYUD 3R2PA 5AVYB 2YNYA 1M1KQ 2M8RA 3VP8A 1LJ2A 4NPEA 3L74G 5DJUB 2C9NY 3GG2A 2K9YA 1ZRTD 1BE3G 1LTIC 3LIEA 4N78D 2QM7A 2QJKB 1H88A 3RK3D 1PV3A 2YKPA 1Q90D 2FBWD 1G1IA 4H44C 1NEND 1SQBD 1CW5A 1ZN5A 2A45I 3TDKA 1HH0A 3M91A 3CL3D 1VF5C 2QM8A 1FZAA 1M1JC 5AW1B 2GM4A 1LTGC 2E76D 2POHA 2YXRB 2P2UA 3AE2C 2Q7CA 2QJYC 2ZJSE 4OGQC 4FJVA 2WPVB 1YJ9P 3H1KJ 2YO3A 3RL0C 4R4LA 1ZW0A 2LKMA 3L75D 4IFFA 1OMIA 5CCGA 3VRAD 1JTHB 3NFQA 1ZR2A 1NTKG 1NO4A 1FC2C 4PD4E 3H1IG 4OH8B 3L74J 2WDQC 3CCQP 2N9BA 3UIAA 2W83C 2M3EA 1BE3J 2K88A 2ZVNB 1G2CB 4GIFA 4WY4C 2E5TA 2A06E 3MUDA 3M9QA 5APYA 1URQB 3CWBD 3G6EP 3H1JE 4CPGA 2W90A 2NPSC 1LWUC 4D6TG 2CK3H 4DCKA 3USSA 2WZ7A 3LW5H 1RY3A 4U3FG 1BGYD 3L72D 3HE4B 1K8AQ 1KQFB 1BCCJ 3VR8C 1FBMA 5AVTB 3L71G 2ZXXA 3L74E 2H89D 4YSXD 1N7SC 3HTKB 3KHUA 2FFDB 1BE3E 1KB9I 5KLVD 3VR9C 1WMKA 3PLNA 2IZ1A 3AE9D 1KV4A 1L0LK 3CCMP 3JSVC 2ZYAA 3CC7P 4RESB 1JTHA 2RN0A 3P4RC 1JUNA 3M9HA 3MHVA 4KJMA 3I55P 1EDJA 1S9KE 2WPQA 2ZYDA 1L0VD 2DW3A 3RK2B 4D6TJ 1AVYA 1TU3F 1SVFA 1W2EA 1DEBA 1EDLA 3SWKA 1URQA 4U3FJ 1RE4A 1A02F 3F5HA 4H0LC 1YTZI 1LTAC 1SQVD 3TGUD 1AQTA 1SQPG 3H1IE 1KQLA 3HE4A 1KFYD 3CX5D 5AVXB 2KZJA 4H13C 4YSZC 4KX6D 5H2FH 1CSBA 1KYOD 1KMIZ 2ZVOB 5AW9B 2XKMA 3W67A 4W7ZA 4JYBA 1SQBK 1IK7A 2HPCB 3HTKA 2B88A 2B76D 1LTTC 2J58A 2FFDA 1T3UA 1OVRA 3U59A 2B9BA 5AW5B 2YIUB 4D6TE 2OYOA 1FJPA 4XA4A 1VQLP 2LXBA 4U3FE 1NTMK 5AVWB 3KQGA 4QMAA 3P8MC 2WSCJ 5C2TD 1NU1K 3L71E 1NVOA 1IJDB 3AEAD 1SQQD 1KN7A 2I8DA 1FAVA 2BEQD 2PFXA 1M90Q 1HTLC 3AE8C 1SP4A 3VONA 1MV8A 3Q1MA 2R3CA 1IFNA 3L36A 3AEBC 1YITP 1DX7A 1LNQA 4PD4D 1L0LJ 2BCCD 4WVZA 3GHGC 1RH5B 5KJ7D 2E75D 5TISE 1IFDA 3TYYA 4K3AA 3K5BA 2IYOA 2YO2A 4YPCA 2E42A 4PD4I 3D6YA 2AXCA 2Z5HA 2E76B 1NU1G 2WT7B 3H1JD 1NKZB 2HPCA 1YI2P 1PPJG 1VQPP 5APTA 2M3BA 4H44D 4WWIA 2FXOA 2JO1A 1SQPE 3RGUA 2ACZC 1VF5D 5GTHH 4ASWA 2ZFYA 2WP9C 1PGPA 5KLVK 1NTZD 2P58A 1FZCB 1X0TA 2Q6QA 1PFIA 1L4AC 1SQBJ 2SPZA 3LW5J 3P32A 4OGQD 4GKGA 3L4FA 3KDPB 2QG4A 4KT0J 2IFMA 3AEGC 3N7NA 3RL0D 1PGOA 5E79H 1NTMJ 1OFCX 4C7NB 4DHIB 3V4WA 2WDQD 1S9KD 5AVVB 4N3YB 1NU1J 3O6QB 1QLBC 1Q2NA 2C9LY 2C0XA 3VRBC 1TFFA 2NRGA 1GW3A 1VQ9P 1DD3A 4YTND 1L0ND 4WY4D 3GF3A 3M0DC 2IFNA 3A5TA 1U57A 3CI9A 2WT7A 3AE5C 1NEKC 1Y9BA 2NPSD 1NTKD 4UB8E 4B86A 3L35A 1EC5A 1GL2C 1P84D 2Y0DA 1VQ5P 1HGZA 2J59M 3CLQA 1M7LA 1SQXG 4ASVA 2FYNC 1EQ7A 1U7MA 2OYIB 3A7OA 4KHXA 1ZOYD 3A3YB 1MKMA 3CWBJ 1FZCA 1VDFA 5APUA 1N86A 1YHQP 1NU1E 1N7SD 2P67A 2FXPA 1PPJE 3Q2YA 5GTIH 1IC2A 3BATA 1EZVG 3W68A 3FWNA 4YXDC 1JO5A 1X8YA 2LR2A 1JNMA 2WITA 1SFCC 3P4RD 3NMDA 1OX3A 4C7NA 1PP9J 1M57D 3D6ZA 3G4SP 2CPSA 1BSNA 2UWJE 3O6QA 4Y99C 5C39A 5CCHC 2G8YA 1OZHA 5KLVJ 4AUWA 3L70G 1UIIA 3GMAA 3QH9A 3EQ2A 5EFWB 1S72P 3V5BA 3H1LD 1IO4A 4H0LD 4Z1MH 2K37A 2FYZA 1FOSE 1J1DB 1P84H 2WSEH 1YYCA 1S4XA 2IBZD 2OYIA 3SWYA 1PP9E 2W6BA 2O3JA 2ZT9C 2P1JA 3SFEC 3H1HG 4EOTA 3EFFK 2HR3A 3ZDMA 2H88C 1Q86Q 2W6JH 3EWKA 1SQPD 3T97B 1PZQA 3AE4C 3LIDA 1J1EB 1NTZK 2JKVA 3C9IA 1EXJA 1SQXE 1KFMA 4BXLA 1NH4A 1ZR4A 3OJAB 2E75B 3H1KG 1KILC
chains in the Genus database with same CATH topology
1RQVA 3VR8C 2E74D 1HJ0A 2WU5C 4KX6C 2WP9C 1VL2A 1K04A 3P4QD 2BS4C 1PV3A 5KLIC 4YSYC 4YXDC 1Q90D 2FBWD 3AE1C 2WU5D 3VR8D 4H44C 1NEND 4PV1D 4YSYD 2JP3A 2WDVD 2H89D 3AE1D 3P4RD 1FDIA 1ZP0C 4YSXD 3LW5J 3AEDC 4OGQD 1KF6D 3RL0g 3Q5RA 3AE6C 3H25A 2ZT9B 3B71A 1VF5C 3D6ZA 1UIXA 2B76C 2WSCJ 3AEAC 3AEDD 4KT0J 1EXIA 2E76C 3AEGC 5C2TD 3IN6A 3P4PC 4YTMC 3O6QA 3AEAD 3VRBD 3VR9C 1WMKA 2G8YA 1KTMA 2E76D 2IDBA 3AE9D 3AE7D 1GMJA 1YQ3D 3P4QC 3AEEC 3GLMA 2FBWC 3VR9D 4H13B 3AE2C 5KKZC 1E7PC 1NENC 4PV1C 3GMAA 2WDVC 2BEQD 2QJYC 1HF9A 1RQUA 3AEED 2H89C 2WDRD 3P4RC 5C3JD 3AE2D 4YSXC 3AE8C 4OGQC 4TT3H 1KF6C 2WDQD 2WPVB 4I7ZC 3Q1MA 4IL6X 2WSFJ 3AE8D 2D2CC 4H0LD 5C2TC 3AEBC 1OW7A 4R4LA 4RKUJ 2BEZF 4Z1MH 1QLBC 2ZT9D 4YTNC 3D70A 3VRBC 2D2CD 3SFDC 3VRAC 1PIXA 2E74B 1L0VD 3AEBD 3AE9C 3AE7C 1DD3A 1YQ3C 3G9RA 2E75C 3CIRD 3P4SD 3SFED 1OMIA 4YTND 3VRAD 3GF3A 2NZ2A 3SFDD 2WU2C 5M1BA 2H88D 2YIUC 2YMKA 2E75D 4PV1B 1U57A 1TU3F 1JB0J 2WDRC 3AEFD 4U7JA 3Q3DA 2WU2D 2O01J 1OW6A 2MKVA 2QIWA 3AE5C 4H44B 1NEKC 5C3JC 2WS3D 2WDQC 4OGQB 1FDOA 1Y9BA 3IAOA 2J5UA 1NEKD 2BS3C 3C8VA 3AE5D 4H0LC 3R4YA 4GDOA 3D6YA 2WQYD 3GF7A 1VF5B 3AECD 2ZT9C 3AE4D 3ABVD 2G3AA 2E76B 1L0VC 3CIRC 1R8EA 3SFEC 3P4SC 4R4MA 1PL5A 4XFJA 3S9OA 2H88C 4YTPC 2BS2C 1DD4A 4Y28J 4YT0C 1ZOYC 3Q5SA 2FYNC 3D71A 3AEFC 2WSEJ 1KFYD 3EWKA 3AE3C 2QSIA 4YTPD 1ZRTE 2WS3C 4YT0D 4H13C 1YQ4D 2QJKC 1ZOYD 4YSZC 4KX6D 2WP9D 1NYHA 1OW8A 3T97B 3AE3D 1MKMA 1KMIZ 5L8RJ 1ZMEC 1NGMB 4YXDD 1K05A 4H13D 3RK3E 1S1CX 4YSZD 2WQYC 4H0LB 1KILE 4H44D 1AJYA 4I7ZB 2P10A 3AECC 3AE4C 3ABVC 2JO1A 3FGAD 2D2CB 3Q5PA 2V7QJ 1EXJA 1ZP0D 2OQQA 2FXPA 1IK7A 2ACZC 3AE6D 1DIPA 1KQGB 1KORA 1VF5D 2B76D 2QJPC 2E75B 2E74C 2K9YA 2ACZD 1KFYC 1S5LX 1KQFB 3Q2YA 3AEGD 3P4PD 4YTMD 1YQ4C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VR8 C;  2WU5 C;  4KX6 C;  2WP9 C;  1K04 A;  3P4Q D;  2BS4 C;  1PV3 A;  4YSY C;  4YXD C;  2FBW D;  3AE1 C;  2WU5 D;  3VR8 D;  1NEN D;  4YSY D;  2WDV D;  2H89 D;  3AE1 D;  3P4R D;  1ZP0 C;  4YSX D;  3AED C;  1KF6 D;  3AE6 C;  3B71 A;  2B76 C;  3AEA C;  3AED D;  3AEG C;  5C2T D;  3P4P C;  4YTM C;  3AEA D;  3VRB D;  3VR9 C;  1KTM A;  3AE9 D;  3AE7 D;  1YQ3 D;  3P4Q C;  3AEE C;  3VR9 D;  2FBW C;  3AE2 C;  1E7P C;  1NEN C;  2WDV C;  3AEE D;  2H89 C;  2WDR D;  3P4R C;  5C3J D;  3AE2 D;  4YSX C;  3AE8 C;  1KF6 C;  2WDQ D;  3AE8 D;  5C2T C;  3AEB C;  1OW7 A;  1QLB C;  4YTN C;  3VRB C;  3VRA C;  3SFD C;  1L0V D;  3AEB D;  3AE9 C;  3AE7 C;  1YQ3 C;  3CIR D;  3P4S D;  3SFE D;  4YTN D;  3VRA D;  3SFD D;  2WU2 C;  2H88 D;  2WDR C;  3AEF D;  5C3J C;  2WU2 D;  1OW6 A;  3AE5 C;  1NEK C;  2WS3 D;  2WDQ C;  1NEK D;  2BS3 C;  3AE5 D;  2WQY D;  3AEC D;  3AE4 D;  3ABV D;  2G3A A;  1L0V C;  3CIR C;  3SFE C;  3P4S C;  3S9O A;  2H88 C;  4YTP C;  2BS2 C;  4YT0 C;  1ZOY C;  3AEF C;  1KFY D;  3AE3 C;  4YTP D;  2WS3 C;  4YT0 D;  1YQ4 D;  1ZOY D;  4YSZ C;  4KX6 D;  2WP9 D;  1OW8 A;  3AE3 D;  4YXD D;  1K05 A;  4YSZ D;  2WQY C;  3AEC C;  3AE4 C;  3ABV C;  1ZP0 D;  2ACZ C;  3AE6 D;  2B76 D;  2ACZ D;  3AEG D;  1KFY C;  3P4P D;  4YTM D;  1YQ4 C; 
#chains in the Genus database with same CATH topology
 2VRS A;  1VQ6 P;  2BS4 C;  3S1K A;  1RE3 A;  3FX0 A;  4BWN A;  2HOD B;  2KLU A;  3BCC G;  1EZV E;  3A0H E;  1IFJ A;  4IL6 H;  1N7L A;  5B5E H;  4TLF A;  3MGN A;  2KSJ A;  3A0B H;  3P8C E;  2JWD A;  3H1H J;  4I1L A;  1ZXG A;  4IL6 X;  2H8P D;  5CJ0 A;  4HYT B;  2WPS A;  1CZQ A;  2HYN A;  3L70 E;  3MUD C;  2WMM A;  2N9Y B;  4HJG H;  2JWA A;  2NZ2 A;  2JEE A;  2BCC J;  5KLI B;  2QJY B;  3JCU E;  5C3J C;  4OGQ B;  1BCC G;  1Q82 Q;  3SSU A;  3A2A A;  3T97 A;  2AEM A;  3RL0 B;  3GF7 A;  1RF1 A;  4WBA A;  2K1A A;  3FXE A;  1XTG B;  3NXS A;  4R4M A;  4XFJ A;  3WUU A;  2O01 N;  5KJ7 A;  5KKZ B;  2R5B A;  3BCC J;  1S5L H;  3RBX A;  2WP9 D;  3AE3 D;  1KIL E;  4I7Z B;  3CC2 P;  1PPJ D;  1N2D C;  3AEC C;  3H1H E;  1RF0 A;  2HOD A;  1OXZ A;  4DHZ A;  4WY4 B;  2ZXE B;  5TJH A;  5KAF H;  3AEG D;  1S5L X;  5E79 E;  1RQV A;  2E74 D;  2WU5 C;  2B89 A;  2A45 H;  1LTJ C;  3CCJ P;  1NTZ J;  1NWQ A;  3I56 P;  3MD0 A;  3AED C;  3RL0 g;  1EDK A;  3H1K E;  3WMM 0;  4GOE A;  1M1J A;  3VRB D;  2YKO A;  4IFD K;  1JEK A;  2XNX A;  4MN4 C;  1KB9 D;  4AQR D;  3CXH E;  3BCC E;  3FXD A;  3AEE D;  2L91 A;  2O1K A;  4RO0 A;  1VQM P;  1N8R Q;  1Y8A A;  1N7S B;  2Q5U A;  2N1T D;  4L73 A;  3CME P;  1VQK P;  4LC1 A;  5K5G B;  1IFP A;  1GK4 A;  2GUS A;  5KAI H;  1FZF A;  1GL2 D;  2C0W A;  3KZI H;  4N6J A;  5CBN A;  1G1J A;  3CIR C;  2GUV A;  5GTI E;  3HD7 D;  4YTP C;  4Y28 J;  4WY4 A;  1LP1 B;  3L73 D;  1BCC E;  5CMZ A;  2WSE J;  2JJL A;  2LXC B;  5AW4 B;  3VMZ A;  2K3R A;  4YXD D;  4JF7 A;  1SQX D;  4H0L B;  1JY2 P;  3BVH A;  4PJ0 H;  4ZNC A;  1SFC D;  5APV A;  1ZLL A;  2OQQ A;  5KTB A;  2FYU K;  3PP5 A;  4K35 A;  3M06 A;  1J2J B;  2PAJ A;  1YJW P;  1E5W A;  3RK2 C;  1JM0 A;  3AE1 C;  1L0L G;  1JMB A;  1KB9 H;  4YSY D;  2AEF A;  1EZV D;  3AE6 C;  1N7S A;  2M0B A;  3B8E B;  1USE A;  1KTM A;  1HGV A;  2AXT H;  3VMY A;  1EZV I;  4PV1 C;  1RQU A;  2O01 H;  4UB6 E;  5AVS B;  3VN0 A;  3G71 P;  1Z56 A;  1FJK A;  1FS0 E;  4NPF X;  1NHL A;  5APX A;  2ZT9 D;  2FYU G;  1FZE A;  2D2C D;  3SFD C;  1PIX A;  3GW6 A;  1AV1 A;  3AE7 C;  3SFE D;  5B66 H;  4IFM A;  2H88 D;  2YIU C;  2Z4E A;  1H0T B;  1X9V A;  2OYH B;  1LP1 A;  2WU2 D;  1OW6 A;  2AEJ A;  1NOH A;  2OTK E;  3EFG A;  1WRG A;  3IAO A;  3B5N D;  2R44 A;  3AE4 D;  3IFM A;  5AVZ B;  3P7K A;  1X79 B;  3RBZ A;  1SQB G;  1T2K D;  3RK3 B;  4YT0 C;  3D71 A;  3BRT B;  3CCE P;  2OTJ P;  1AFO A;  1KIL D;  2QSI A;  2WS3 C;  5L8R J;  3CX5 H;  2L5G B;  2KP8 A;  4W80 A;  1KYO H;  1SS1 A;  1NTM G;  2A06 D;  1N73 B;  4ZMD A;  3WU2 H;  4O9B A;  2FYU J;  1FDI A;  3SWF A;  3V2R A;  1R5L A;  2E76 C;  1JCC A;  2PGD A;  3CD6 P;  2OTL P;  1L0L E;  3OA7 A;  3HE5 B;  3L74 D;  1VQ4 P;  2JDI H;  5C3J D;  2YMY A;  3AE2 D;  1H0T A;  2OYH A;  1BE3 D;  3CXH I;  1XTC C;  3CWB G;  3FWL A;  1BDC A;  3VRA C;  2RH0 A;  2E74 B;  4OVN F;  1JB0 J;  4PD4 H;  4U7J A;  1BGY G;  4AYC A;  2Q3E A;  2HLO A;  2WPR A;  2BS3 C;  2Y9Y A;  2FYU E;  3AEC D;  4DT0 A;  1BCC D;  1NAY A;  3VYI A;  3P4S C;  3E7K A;  4NPD A;  5KAF E;  4I6L A;  1N73 A;  1PP9 G;  2WVR A;  3L75 J;  1SQV K;  1JCD A;  1ZRT E;  1IFI A;  2N1T B;  4N78 E;  2QRX A;  3RK3 E;  5KLV G;  1S1C X;  2JR8 A;  1JY2 N;  3WUV A;  3ABV C;  1SQB E;  3H1I D;  1GL2 B;  3VMA A;  1KQG B;  1GU5 A;  5AW3 B;  2FYN B;  1VQN P;  1GTW A;  2XND H;  2Y9Z A;  1ZV8 A;  1T8Z A;  1SLQ A;  3VR8 D;  3HE5 A;  1NTM E;  3CCV P;  2IZ0 A;  3HD7 B;  5KAI E;  3P4P C;  4D6T D;  5AW2 B;  5APS A;  1BGY J;  2XV5 A;  3L72 J;  2KB7 P;  3GLM A;  3VR9 D;  4U3F D;  1SQV G;  3TGU G;  1E7P C;  2OYI C;  3O8Z A;  1SFC B;  1KF6 C;  1SQQ K;  1X22 A;  1GW4 A;  3L71 D;  1Q81 Q;  1LT9 B;  4Y99 B;  4I2L C;  4ZKP A;  1GZL A;  2QJP B;  3CIR D;  1KZU B;  3BAS A;  1U7J A;  3V6I A;  3HUS B;  1RHZ B;  2O01 J;  1FDO A;  3CWB E;  4PJ0 E;  2N1T A;  3KYQ A;  3CC4 P;  1T6A A;  2V7Q H;  3TF5 A;  1R8E A;  1QX8 A;  1FE6 A;  1HVV A;  1GL2 A;  3S9O A;  2BS2 C;  1BGY E;  3AEF C;  1HWT C;  1PGQ A;  5H2F E;  1NGM B;  1JY3 O;  1K05 A;  4H13 D;  4YSZ D;  3B4S A;  1SQQ G;  2ZFC A;  2D2C B;  3AE6 D;  1SQV J;  3MIW A;  3TGU J;  3HD7 A;  2AXT E;  1J1D C;  5KLV E;  3B5N B;  4IOI H;  4PV1 D;  1VQ8 P;  2KYV A;  2BCC G;  1QGK B;  1RF1 B;  1SFC A;  3OW2 O;  1S2E A;  3AEA C;  3I5C A;  2IPP A;  4YTM C;  1VQ7 P;  1JOC A;  1LT9 A;  3AE7 D;  3P4Q C;  3U1C A;  2IX7 C;  2WDV C;  3HUS A;  3AE8 D;  1J1E C;  4I6M C;  1SQV E;  5CCG C;  3TGU E;  3AEB D;  2O1J A;  4C46 A;  2E75 C;  1OVV A;  1K73 Q;  1E79 H;  3VP9 A;  2KZI A;  2WDR C;  1M8O B;  2MKV A;  1SQQ J;  4H44 B;  2WS3 D;  3CX5 E;  2W6A A;  1L0N K;  1RF0 C;  1KYO E;  1FOS F;  1QVG O;  1VF5 B;  1M1J B;  2E5Y A;  1NTZ G;  2WSC H;  3WU2 E;  5CJ4 A;  4EIJ A;  1NTK K;  3OAK A;  3V4Q A;  3U1A A;  2KOG A;  2QJK C;  4W7Y A;  1EDI A;  4HH2 A;  1AVO A;  2RMZ A;  1OVU A;  3B5N A;  3FGA D;  4OWF A;  2KK7 A;  1A02 J;  3M9B A;  3CMA P;  5GTH E;  2ACZ D;  1JY3 P;  2XZR A;  1JY2 O;  2KXP B;  1DEE G;  3PJS K;  3TK1 A;  1NTM D;  1KIL A;  1K04 A;  3H1J J;  4DOJ A;  5KLI C;  3CCR P;  1SQQ E;  3E1I A;  1NU1 D;  1QEX A;  1L0N G;  3PRJ A;  2WSF H;  1L4A D;  2CPB A;  4L75 A;  2H43 A;  1IK9 A;  1W2B O;  1LTJ B;  5CBO A;  2BCC E;  5KKZ C;  2NPS B;  1LWU B;  1JMM A;  4I7Z C;  1LT1 A;  3MTU E;  2HG5 D;  3KPE A;  1K9M Q;  3TSI A;  4YTN C;  3D70 A;  2YXQ B;  3P4S D;  3WUT A;  3V2P A;  3ITK A;  3Q3D A;  1URQ C;  1RE4 C;  1NEK D;  3AE5 D;  4UB8 H;  3ABV D;  3QWO C;  2Q9I A;  2R32 A;  3CCS P;  2BAS A;  1ZOY C;  2ZYG A;  1VPC A;  5AW7 B;  3V2Q A;  1LGH B;  2MJZ A;  1L0N J;  3NTN A;  3JC2 2;  1YIJ P;  2PP6 A;  3V2N A;  1PP9 D;  2WQY C;  1NTZ E;  3N4X A;  2V7Q J;  1FZB A;  1SQP K;  1NTK J;  1DIP A;  2FFD C;  1KOR A;  3H1I J;  2QE7 H;  3P4P D;  1YQ4 C;  1HJ0 A;  2Y0C A;  3H1L G;  1VL2 A;  4DHJ A;  1M56 D;  1LTJ A;  2B87 B;  2KIK A;  5AW0 B;  2NPS A;  1ZP0 C;  1MUU A;  1KF6 D;  3Q5R A;  1LWU A;  4GOF A;  4HB1 A;  2IBZ G;  1G2C A;  1D7M A;  1W5C E;  5CCH D;  4DDI A;  4H13 B;  1L0N E;  5BU8 B;  4JYC A;  2XDJ A;  1FDM A;  2FXM A;  1KQS O;  2ZAE B;  2BEZ F;  1LTS C;  1NTK E;  4WB4 A;  3L71 J;  1YQ3 C;  3P8C D;  1HUC A;  1P84 E;  4PV1 B;  3AEF D;  3BRV B;  1MFT A;  1YJN P;  3IR9 A;  2M5A B;  3L70 D;  4GDO A;  3CX5 I;  2G3A A;  3H1L J;  2V4H A;  1KYO I;  4YXW H;  3TNU B;  5AVR B;  3PTZ A;  1NYH A;  1WT6 A;  1ZME C;  3H6P A;  1IFM A;  4RJT A;  2A45 G;  2P10 A;  2OGU A;  2B87 A;  1GDT A;  4M3L A;  4A7P A;  1GU4 A;  4DZO A;  4YTM D;  1JY3 N;  3GHG B;  1OIP A;  2RKL A;  3P4Q D;  4HKZ H;  4L74 A;  2OYH C;  3H1H D;  4XE5 B;  2WDV D;  3PHL A;  1SQP J;  3CCU P;  1QVF O;  3B71 A;  1DH3 A;  3H1L E;  3A0H H;  4IL6 E;  5B5E E;  5CCG D;  3RK3 C;  2KNC B;  1GMJ A;  3A0B E;  3H32 B;  2FBW C;  2H7H A;  1NEN C;  4JQ0 D;  2WDR D;  3L75 G;  3H1K D;  1VQO P;  2IBZ E;  1AA0 A;  2WSF J;  4JBZ A;  2KUB A;  4RKU J;  1N73 C;  2M5A A;  2YKQ A;  2Q3I A;  3CXH D;  1MFZ A;  3BCC D;  1NKN A;  2QA4 P;  1HBW A;  2YMK A;  3JCU H;  3TNU A;  4L76 A;  2W8Z A;  4EDF A;  1MZ9 A;  4LGD E;  2J5U A;  1L4A B;  3C8V A;  2Y0E A;  2KS1 B;  3MP7 B;  1GK6 A;  4LDT A;  3AE3 C;  3GHG A;  1S5L E;  1FZC C;  1T3J A;  3L72 G;  5AW6 B;  1AJY A;  1CI6 B;  3Q5P A;  2OAR A;  1OWA A;  4GOD A;  3II6 A;  1SQX K;  2WWW A;  1NJI Q;  2E74 C;  2KNC A;  2P7J A;  2WU5 D;  3H32 A;  3IF4 A;  4EI2 A;  5CHX A;  2E43 A;  2ITA A;  3H25 A;  2HFE D;  3AED D;  1EXI A;  3S4R A;  3IN6 A;  5APW A;  3VTP C;  3M0A A;  2FKW B;  2IDB A;  3AEE C;  3CXH H;  5BVZ A;  2I1K A;  2N1T C;  1YBK A;  2H89 C;  3HRN A;  5BU5 A;  1URQ D;  4YSX C;  2KI7 B;  4TT3 H;  1QLE D;  3L73 G;  2R5D A;  1L4A A;  3G3Z A;  1KD1 Q;  1Y47 A;  3AE9 C;  3G9R A;  3CPW O;  2KS1 A;  5M1B A;  3L75 E;  5AVU B;  2K9J B;  2QIW A;  1FZG A;  3KZI E;  1BSH A;  1KFN A;  1P84 I;  2WQY D;  1H89 A;  1L0V C;  1CI6 A;  3HD7 C;  4BRY B;  1BDD A;  1PL5 A;  1USD A;  1FU1 A;  3Q5S A;  3CCL P;  2WSS H;  2QEX P;  4YTP D;  1YQ4 D;  1GD2 E;  2IYP A;  1OW8 A;  3M0D A;  2I1J A;  4JPZ B;  1ZP0 D;  1R5S A;  1IZN B;  1LT9 C;  1L2P A;  2QJP C;  5AW8 B;  1KFY C;  4ZKU A;  3L72 E;  4KX6 C;  1RE3 C;  2W27 A;  3HUS C;  1PGJ A;  4YSY C;  5DJT B;  3L73 J;  3RK2 D;  1KB9 E;  2JP3 A;  3AE1 D;  3VMX A;  2GA1 A;  1Q7Y Q;  3E1R A;  2ZT9 B;  1SQX J;  3MZW B;  1UIX A;  2B76 C;  3VOP A;  3PH0 A;  4GT1 A;  2QVA A;  1NAF A;  3L37 A;  1YQ3 D;  2Q1K A;  1S3J A;  2KSE A;  2Z5I A;  1HF9 A;  1YTZ T;  2K9J A;  4UB6 H;  1QL2 A;  2D2C C;  5C2T C;  1KC8 Q;  1OW7 A;  1L0L D;  2WTY A;  3F89 A;  1AQ5 A;  2XU6 A;  1HJB A;  4DDG A;  2R3S A;  2IBZ I;  5B66 E;  3C1L A;  1KIL B;  4BRY A;  3SFD D;  2WU2 C;  4C7R A;  5CCH A;  1QL1 A;  1LTB C;  2PRR A;  5AVQ B;  2A06 G;  3L73 E;  5APQ A;  3B5N C;  2KLV A;  3R4Y A;  3H1J G;  1RF1 C;  1H8A A;  2FY8 A;  3KXD A;  3L70 J;  1T2K C;  4LLH A;  4EYY Q;  1DD4 A;  5KJ7 C;  4DJG A;  4YT0 D;  5TIS H;  2FYU D;  3R2P A;  5AVY B;  2YNY A;  1M1K Q;  2M8R A;  3VP8 A;  1LJ2 A;  4NPE A;  3L74 G;  5DJU B;  2C9N Y;  3GG2 A;  2K9Y A;  1ZRT D;  1BE3 G;  1LTI C;  3LIE A;  4N78 D;  2QM7 A;  2QJK B;  1H88 A;  3RK3 D;  1PV3 A;  2YKP A;  1Q90 D;  2FBW D;  1G1I A;  4H44 C;  1NEN D;  1SQB D;  1CW5 A;  1ZN5 A;  2A45 I;  3TDK A;  1HH0 A;  3M91 A;  3CL3 D;  1VF5 C;  2QM8 A;  1FZA A;  1M1J C;  5AW1 B;  2GM4 A;  1LTG C;  2E76 D;  2POH A;  2YXR B;  2P2U A;  3AE2 C;  2Q7C A;  2QJY C;  2ZJS E;  4OGQ C;  4FJV A;  2WPV B;  1YJ9 P;  3H1K J;  2YO3 A;  3RL0 C;  4R4L A;  1ZW0 A;  2LKM A;  3L75 D;  4IFF A;  1OMI A;  5CCG A;  3VRA D;  1JTH B;  3NFQ A;  1ZR2 A;  1NTK G;  1NO4 A;  1FC2 C;  4PD4 E;  3H1I G;  4OH8 B;  3L74 J;  2WDQ C;  3CCQ P;  2N9B A;  3UIA A;  2W83 C;  2M3E A;  1BE3 J;  2K88 A;  2ZVN B;  1G2C B;  4GIF A;  4WY4 C;  2E5T A;  2A06 E;  3MUD A;  3M9Q A;  5APY A;  1URQ B;  3CWB D;  3G6E P;  3H1J E;  4CPG A;  2W90 A;  2NPS C;  1LWU C;  4D6T G;  2CK3 H;  4DCK A;  3USS A;  2WZ7 A;  3LW5 H;  1RY3 A;  4U3F G;  1BGY D;  3L72 D;  3HE4 B;  1K8A Q;  1KQF B;  1BCC J;  3VR8 C;  1FBM A;  5AVT B;  3L71 G;  2ZXX A;  3L74 E;  2H89 D;  4YSX D;  1N7S C;  3HTK B;  3KHU A;  2FFD B;  1BE3 E;  1KB9 I;  5KLV D;  3VR9 C;  1WMK A;  3PLN A;  2IZ1 A;  3AE9 D;  1KV4 A;  1L0L K;  3CCM P;  3JSV C;  2ZYA A;  3CC7 P;  4RES B;  1JTH A;  2RN0 A;  3P4R C;  1JUN A;  3M9H A;  3MHV A;  4KJM A;  3I55 P;  1EDJ A;  1S9K E;  2WPQ A;  2ZYD A;  1L0V D;  2DW3 A;  3RK2 B;  4D6T J;  1AVY A;  1TU3 F;  1SVF A;  1W2E A;  1DEB A;  1EDL A;  3SWK A;  1URQ A;  4U3F J;  1RE4 A;  1A02 F;  3F5H A;  4H0L C;  1YTZ I;  1LTA C;  1SQV D;  3TGU D;  1AQT A;  1SQP G;  3H1I E;  1KQL A;  3HE4 A;  1KFY D;  3CX5 D;  5AVX B;  2KZJ A;  4H13 C;  4YSZ C;  4KX6 D;  5H2F H;  1CSB A;  1KYO D;  1KMI Z;  2ZVO B;  5AW9 B;  2XKM A;  3W67 A;  4W7Z A;  4JYB A;  1SQB K;  1IK7 A;  2HPC B;  3HTK A;  2B88 A;  2B76 D;  1LTT C;  2J58 A;  2FFD A;  1T3U A;  1OVR A;  3U59 A;  2B9B A;  5AW5 B;  2YIU B;  4D6T E;  2OYO A;  1FJP A;  4XA4 A;  1VQL P;  2LXB A;  4U3F E;  1NTM K;  5AVW B;  3KQG A;  4QMA A;  3P8M C;  2WSC J;  5C2T D;  1NU1 K;  3L71 E;  1NVO A;  1IJD B;  3AEA D;  1SQQ D;  1KN7 A;  2I8D A;  1FAV A;  2BEQ D;  2PFX A;  1M90 Q;  1HTL C;  3AE8 C;  1SP4 A;  3VON A;  1MV8 A;  3Q1M A;  2R3C A;  1IFN A;  3L36 A;  3AEB C;  1YIT P;  1DX7 A;  1LNQ A;  4PD4 D;  1L0L J;  2BCC D;  4WVZ A;  3GHG C;  1RH5 B;  5KJ7 D;  2E75 D;  5TIS E;  1IFD A;  3TYY A;  4K3A A;  3K5B A;  2IYO A;  2YO2 A;  4YPC A;  2E42 A;  4PD4 I;  3D6Y A;  2AXC A;  2Z5H A;  2E76 B;  1NU1 G;  2WT7 B;  3H1J D;  1NKZ B;  2HPC A;  1YI2 P;  1PPJ G;  1VQP P;  5APT A;  2M3B A;  4H44 D;  4WWI A;  2FXO A;  2JO1 A;  1SQP E;  3RGU A;  2ACZ C;  1VF5 D;  5GTH H;  4ASW A;  2ZFY A;  2WP9 C;  1PGP A;  5KLV K;  1NTZ D;  2P58 A;  1FZC B;  1X0T A;  2Q6Q A;  1PFI A;  1L4A C;  1SQB J;  2SPZ A;  3LW5 J;  3P32 A;  4OGQ D;  4GKG A;  3L4F A;  3KDP B;  2QG4 A;  4KT0 J;  2IFM A;  3AEG C;  3N7N A;  3RL0 D;  1PGO A;  5E79 H;  1NTM J;  1OFC X;  4C7N B;  4DHI B;  3V4W A;  2WDQ D;  1S9K D;  5AVV B;  4N3Y B;  1NU1 J;  3O6Q B;  1QLB C;  1Q2N A;  2C9L Y;  2C0X A;  3VRB C;  1TFF A;  2NRG A;  1GW3 A;  1VQ9 P;  1DD3 A;  4YTN D;  1L0N D;  4WY4 D;  3GF3 A;  3M0D C;  2IFN A;  3A5T A;  1U57 A;  3CI9 A;  2WT7 A;  3AE5 C;  1NEK C;  1Y9B A;  2NPS D;  1NTK D;  4UB8 E;  4B86 A;  3L35 A;  1EC5 A;  1GL2 C;  1P84 D;  2Y0D A;  1VQ5 P;  1HGZ A;  2J59 M;  3CLQ A;  1M7L A;  1SQX G;  4ASV A;  2FYN C;  1EQ7 A;  1U7M A;  2OYI B;  3A7O A;  4KHX A;  1ZOY D;  3A3Y B;  1MKM A;  3CWB J;  1FZC A;  1VDF A;  5APU A;  1N86 A;  1YHQ P;  1NU1 E;  1N7S D;  2P67 A;  2FXP A;  1PPJ E;  3Q2Y A;  5GTI H;  1IC2 A;  3BAT A;  1EZV G;  3W68 A;  3FWN A;  4YXD C;  1JO5 A;  1X8Y A;  2LR2 A;  1JNM A;  2WIT A;  1SFC C;  3P4R D;  3NMD A;  1OX3 A;  4C7N A;  1PP9 J;  1M57 D;  3D6Z A;  3G4S P;  2CPS A;  1BSN A;  2UWJ E;  3O6Q A;  4Y99 C;  5C39 A;  5CCH C;  2G8Y A;  1OZH A;  5KLV J;  4AUW A;  3L70 G;  1UII A;  3GMA A;  3QH9 A;  3EQ2 A;  5EFW B;  1S72 P;  3V5B A;  3H1L D;  1IO4 A;  4H0L D;  4Z1M H;  2K37 A;  2FYZ A;  1FOS E;  1J1D B;  1P84 H;  2WSE H;  1YYC A;  1S4X A;  2IBZ D;  2OYI A;  3SWY A;  1PP9 E;  2W6B A;  2O3J A;  2ZT9 C;  2P1J A;  3SFE C;  3H1H G;  4EOT A;  3EFF K;  2HR3 A;  3ZDM A;  2H88 C;  1Q86 Q;  2W6J H;  3EWK A;  1SQP D;  3T97 B;  1PZQ A;  3AE4 C;  3LID A;  1J1E B;  1NTZ K;  2JKV A;  3C9I A;  1EXJ A;  1SQX E;  1KFM A;  4BXL A;  1NH4 A;  1ZR4 A;  3OJA B;  2E75 B;  3H1K G;  1KIL C; 
#chains in the Genus database with same CATH homology
 1RQV A;  3VR8 C;  2E74 D;  1HJ0 A;  2WU5 C;  4KX6 C;  2WP9 C;  1VL2 A;  1K04 A;  3P4Q D;  2BS4 C;  1PV3 A;  5KLI C;  4YSY C;  4YXD C;  1Q90 D;  2FBW D;  3AE1 C;  2WU5 D;  3VR8 D;  4H44 C;  1NEN D;  4PV1 D;  4YSY D;  2JP3 A;  2WDV D;  2H89 D;  3AE1 D;  3P4R D;  1FDI A;  1ZP0 C;  4YSX D;  3LW5 J;  3AED C;  4OGQ D;  1KF6 D;  3RL0 g;  3Q5R A;  3AE6 C;  3H25 A;  2ZT9 B;  3B71 A;  1VF5 C;  3D6Z A;  1UIX A;  2B76 C;  2WSC J;  3AEA C;  3AED D;  4KT0 J;  1EXI A;  2E76 C;  3AEG C;  5C2T D;  3IN6 A;  3P4P C;  4YTM C;  3O6Q A;  3AEA D;  3VRB D;  3VR9 C;  1WMK A;  2G8Y A;  1KTM A;  2E76 D;  2IDB A;  3AE9 D;  3AE7 D;  1GMJ A;  1YQ3 D;  3P4Q C;  3AEE C;  3GLM A;  2FBW C;  3VR9 D;  4H13 B;  3AE2 C;  5KKZ C;  1E7P C;  1NEN C;  4PV1 C;  3GMA A;  2WDV C;  2BEQ D;  2QJY C;  1HF9 A;  1RQU A;  3AEE D;  2H89 C;  2WDR D;  3P4R C;  5C3J D;  3AE2 D;  4YSX C;  3AE8 C;  4OGQ C;  4TT3 H;  1KF6 C;  2WDQ D;  2WPV B;  4I7Z C;  3Q1M A;  4IL6 X;  2WSF J;  3AE8 D;  2D2C C;  4H0L D;  5C2T C;  3AEB C;  1OW7 A;  4R4L A;  4RKU J;  2BEZ F;  4Z1M H;  1QLB C;  2ZT9 D;  4YTN C;  3D70 A;  3VRB C;  2D2C D;  3SFD C;  3VRA C;  1PIX A;  2E74 B;  1L0V D;  3AEB D;  3AE9 C;  3AE7 C;  1DD3 A;  1YQ3 C;  3G9R A;  2E75 C;  3CIR D;  3P4S D;  3SFE D;  1OMI A;  4YTN D;  3VRA D;  3GF3 A;  2NZ2 A;  3SFD D;  2WU2 C;  5M1B A;  2H88 D;  2YIU C;  2YMK A;  2E75 D;  4PV1 B;  1U57 A;  1TU3 F;  1JB0 J;  2WDR C;  3AEF D;  4U7J A;  3Q3D A;  2WU2 D;  2O01 J;  1OW6 A;  2MKV A;  2QIW A;  3AE5 C;  4H44 B;  1NEK C;  5C3J C;  2WS3 D;  2WDQ C;  4OGQ B;  1FDO A;  1Y9B A;  3IAO A;  2J5U A;  1NEK D;  2BS3 C;  3C8V A;  3AE5 D;  4H0L C;  3R4Y A;  4GDO A;  3D6Y A;  2WQY D;  3GF7 A;  1VF5 B;  3AEC D;  2ZT9 C;  3AE4 D;  3ABV D;  2G3A A;  2E76 B;  1L0V C;  3CIR C;  1R8E A;  3SFE C;  3P4S C;  4R4M A;  1PL5 A;  4XFJ A;  3S9O A;  2H88 C;  4YTP C;  2BS2 C;  1DD4 A;  4Y28 J;  4YT0 C;  1ZOY C;  3Q5S A;  2FYN C;  3D71 A;  3AEF C;  2WSE J;  1KFY D;  3EWK A;  3AE3 C;  2QSI A;  4YTP D;  1ZRT E;  2WS3 C;  4YT0 D;  4H13 C;  1YQ4 D;  2QJK C;  1ZOY D;  4YSZ C;  4KX6 D;  2WP9 D;  1NYH A;  1OW8 A;  3T97 B;  3AE3 D;  1MKM A;  1KMI Z;  5L8R J;  1ZME C;  1NGM B;  4YXD D;  1K05 A;  4H13 D;  3RK3 E;  1S1C X;  4YSZ D;  2WQY C;  4H0L B;  1KIL E;  4H44 D;  1AJY A;  4I7Z B;  2P10 A;  3AEC C;  3AE4 C;  3ABV C;  2JO1 A;  3FGA D;  2D2C B;  3Q5P A;  2V7Q J;  1EXJ A;  1ZP0 D;  2OQQ A;  2FXP A;  1IK7 A;  2ACZ C;  3AE6 D;  1DIP A;  1KQG B;  1KOR A;  1VF5 D;  2B76 D;  2QJP C;  2E75 B;  2E74 C;  2K9Y A;  2ACZ D;  1KFY C;  1S5L X;  1KQF B;  3Q2Y A;  3AEG D;  3P4P D;  4YTM D;  1YQ4 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...