3AE3C

Crystal structure of porcine heart mitochondrial complex ii bound with 2-nitro-n-phenyl-benzamide
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of porcine heart mitochondrial complex II bound with 2-Nitro-N-phenyl-benzamide
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
total genus 46
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3ae3C01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3ae3C02
3AE8C 3AEAD 3P4QC 4YSXC 4YTMD 4YSYD 4YXDD 3SFEC 3P4RC 3VR9D 4YT0D 3VR8D 2FBWC 2H88D 3AEGD 1PV3A 3P4PD 1ZOYD 1YQ3D 4YT0C 3VR8C 5C2TC 4YTPD 2WU5D 3AECC 2H89D 3AEDC 3VRAD 3AE7C 3AEAC 2BS3C 1OW7A 2WS3C 3AE3D 3CIRD 1L0VC 5C3JD 1ZP0D 2WDQC 2WU2C 2WU5C 1NEKC 3SFDD 2ACZD 1OW8A 2G3AA 2H89C 3AEFC 3ABVD 2WDVD 1ZOYC 3P4SD 2WDRD 2WU2D 3VRAC 1NEND 2H88C 3VRBD 2WDRC 3AEBD 5C2TD 1NEKD 3AE2D 4YSYC 1K05A 1ZP0C 2WDQD 1NENC 3AE7D 3AECD 5C3JC 3AE6C 3SFED 3VR9C 1OW6A 2ACZC 3VRBC 4YTND 3AE2C 3SFDC 2WP9C 2B76D 3AE4D 2WQYD 3AEED 4YSXD 3S9OA 3AE9C 1YQ4C 2BS2C 3AE5C 4YTMC 1KTMA 3AE6D 4KX6D 1YQ3C 1KFYD 3AE1D 2BS4C 2FBWD 3P4PC 4KX6C 3AE8D 3P4SC 3AEBC 2B76C 3AEEC 1K04A 2WP9D 3AE1C 3AEDD 3P4RD 3AE3C 3CIRC 1QLBC 1E7PC 3ABVC 1YQ4D 2WDVC 1KF6C 3AE9D 3AEFD 3AE5D 4YSZD 1KFYC 3P4QD 3B71A 3AEGC 3AE4C 1L0VD 1KF6D 4YXDC 4YSZC 2WS3D 4YTPC 2WQYC 4YTNC
chains in the Genus database with same CATH superfamily
1LP1B 2L91A 1LT9B 2KS1B 4NPDA 1G1IA 5GTIH 1IFMA 5AW2B 2KB7P 1DX7A 2A45G 3KDPB 1Y47A 3HUSC 3CL3D 5AW8B 2ZFYA 1NTKK 4R4MA 1NU1K 2N1TC 3SFDD 2P1JA 4DT0A 1SQQJ 1N2DC 2HPCA 1N7LA 2J58A 1URQC 1BCCD 1LT1A 2W6AA 4N78D 3AE7D 3AECD 3TGUE 2KK7A 3L74D 2I1KA 2M3BA 4AQRD 1VF5D 3PLNA 4IFFA 2Y0DA 3L71D 2N1TA 5M1BA 1H89A 1DEBA 2OTLP 1G2CA 3H1KE 1IFPA 2B87B 3H1JG 4GOFA 1R5LA 2N9BA 3L36A 3L72J 2N9YB 5AW4B 3CCRP 1FZCB 3AEDD 1L0NE 2WPSA 2P67A 1ZRTE 1HTLC 1ZW0A 2Y0EA 1SQXE 2K3RA 1TFFA 1JTHA 1H88A 3AE8C 3AEAD 1BCCJ 2QJYB 2RH0A 1M1JB 1VQ9P 4H44C 4YT0D 3SWFA 1NWQA 1JY3P 1FZAA 2YNYA 4LC1A 2P10A 4H13C 1ZV8A 5E79H 1KQLA 3AEAC 3W68A 1OIPA 1EZVE 1NTKD 3TSIA 2NPSB 3TYYA 3SSUA 2JJLA 2ACZD 1ZOYC 4HKZH 2OYHA 1SQBJ 3VRAC 1USDA 1VQNP 3KZIE 1LJ2A 5BU5A 4BXLA 3H1KJ 3F89A 1LT9A 2O1KA 4AYCA 1KORA 3T97B 4YSXD 5E79E 1J2JB 1HJBA 3A2AA 2XU6A 2OYHC 3RK2B 1PP9D 2A45H 2K37A 4JYBA 1S5LH 3WU2E 4HYTB 3P4RD 3L75E 3L71G 1CI6A 1E7PC 2FY8A 1QX8A 2HR3A 2KXPB 1JEKA 4YSXC 4U3FG 1RHZB 3P4QC 2HYNA 2Z5IA 1Y8AA 4IFDK 4I6LA 2XDJA 1GW3A 2W27A 2OYIC 1S2EA 4C7NB 4L76A 4K3AA 3CCJP 1IZNB 4OVNF 1KYOI 3HTKA 1HF9A 3PJSK 4JPZB 3S4RA 1YITP 1HVVA 1Q86Q 1KFMA 1BGYG 1NEKC 1OW8A 1R8EA 2WDVD 1OVRA 2Q9IA 5AW5B 4DOJA 1S9KD 1FZBA 3O6QB 4Y99B 3P8MC 4PD4D 3L70J 3SWKA 2XV5A 2OTKE 3SFED 1VQKP 3HE5A 2XZRA 1HGVA 2QSIA 1YYCA 1A02F 1GL2C 2GM4A 1T2KD 1W5CE 3FWNA 1NTZG 1M1JA 3OAKA 1NYHA 1SQQE 3HE5B 2A06G 3S9OA 2FXOA 3L72D 2K1AA 3H1KD 3VONA 1L4AD 1M7LA 3G3ZA 1FE6A 1QEXA 3FWLA 4KX6C 3AEBC 2RMZA 4LGDE 2JEEA 5KLIC 4C46A 3AE1C 3CWBG 3NXSA 1EC5A 3B71A 4WY4A 3HTKB 3RBXA 5B66H 1L0VD 4RO0A 2LXCB 2IX7C 4GT1A 1FZCC 1FDIA 1SQPE 1M1JC 4YTMD 3CCMP 3SWYA 1Q2NA 4IL6X 1JM0A 1GZLA 4HH2A 1Q82Q 3M9QA 1GL2B 3CX5I 3H1IJ 3BCCD 1EDKA 3AECC 4TT3H 1FZEA 2FYUJ 3B4SA 3VRAD 1KYOE 3MUDA 1BSHA 1L0VC 3O8ZA 1BCCE 1ZP0D 5GTIE 1P84E 2WU2C 2W90A 3PHLA 1VQ8P 3EWKA 3R4YA 4DHIB 1PPJD 2C0WA 1GW4A 2SPZA 2V7QJ 3G71P 2QE7H 4OH8B 4CPGA 2JR8A 1ZMEC 1BE3J 2DW3A 1J1EB 1SQVG 1KQFB 2WSEH 4D6TJ 1SP4A 5EFWB 2NPSD 1Q90D 3V5BA 1DD3A 1SVFA 4WBAA 1CZQA 2QRXA 3TF5A 3AE6D 2ZT9D 2WSCH 1KFYD 4JYCA 2YXQB 3AE8D 5AVVB 3TGUG 3H1HG 3LW5H 4ZKPA 4UB6H 2B76C 2P2UA 1L0LJ 1PZQA 2WP9D 2AXTH 1U7MA 2W6JH 1L4AC 2QJPC 2E76D 1PIXA 3S1KA 2KZIA 3I56P 3TDKA 2E74D 1URQB 1EZVG 2OYOA 1HGZA 3PTZA 2Z5HA 3M06A 4YXDD 4QMAA 3RL0C 1ZOYD 4EIJA 3VR8C 2D2CC 1SLQA 2FFDA 1JTHB 3HUSA 2QG4A 3N7NA 4B86A 3KQGA 2WS3C 2HODB 1W2BO 2KSEA 1KILC 3UIAA 2YO3A 2E75C 2Q3EA 4ASWA 4N78E 1AFOA 2K9JA 4DJGA 3G6EP 3VYIA 1M56D 3D6YA 3A7OA 1GMJA 3GG2A 1LWUC 1OW6A 5AVYB 1ZR2A 4WWIA 1NTZD 1UIIA 3SFDC 1RF1C 2FKWB 1S9KE 1NVOA 1J1EC 1L0LK 4O9BA 1JY3N 5APWA 1SQBG 2BASA 1SQQD 4KX6D 3NTNA 1YQ3C 4U3FE 3CWBJ 3L71J 1AQ5A 4RKUJ 1KILE 1PP9E 1T3UA 1S4XA 1QLBC 3NFQA 1YQ4D 3JSVC 3AE5D 3CC4P 1PGPA 1NKZB 2YO2A 2GUSA 1BDCA 1HUCA 3PH0A 3CLQA 2ITAA 1WT6A 2I1JA 1RH5B 1GU5A 1NO4A 3FX0A 3M0DA 3CXHD 1AJYA 2WVRA 2N1TD 3CCUP 1RE3C 2H89D 1N8RQ 3CD6P 3L75D 1EZVD 1LTJB 2BS3C 1KB9H 1UIXA 4EYYQ 3KXDA 4DDIA 1OW7A 3KHUA 4H13B 4XE5B 1T2KC 2VRSA 4JQ0D 1AV1A 1P84H 2BCCD 2WDQC 2XNDH 2FXMA 1IJDB 1DIPA 3B5NB 4IFMA 3D70A 2Q6QA 1LNQA 2H43A 1MUUA 3Q1MA 5C2TD 3H6PA 5AW6B 3AE2D 1SFCB 2K9YA 2RN0A 1NTKG 2WSEJ 4WY4B 1RE3A 3U1CA 4MN4C 5APVA 3RK3D 1BDDA 2B9BA 1KD1Q 3GHGB 5AVSB 3LIEA 5AVUB 2B76D 1IFNA 4WB4A 1QGKB 1IK7A 1URQA 4OGQD 2V7QH 1NKNA 2YKOA 2MKVA 1KTMA 2ZVNB 4HJGH 2FBWD 1N7SD 2IPPA 2W83C 3L73D 3V2RA 5KLVJ 3A0BE 3CCEP 2LR2A 3L72E 1K04A 2P58A 3JCUE 4NPFX 1EXJA 1JMBA 1SQBD 3FXEA 3EFFK 3B8EB 3M0AA 2WS3D 3BCCE 2R44A 2UWJE 3WMM0 1K9MQ 4KJMA 1PPJE 2ZYGA 3VR8D 2H88D 3CXHI 1PV3A 1LGHB 3D71A 1MFTA 4FJVA 1KC8Q 4YPCA 3VP8A 4UB8H 3BRVB 3G9RA 5CCGA 1OFCX 2QA4P 1X79B 5APQA 1FC2C 5KAFH 2E74B 3H1ID 1URQD 1BE3D 3ABVD 2H89C 5DJUB 2WSFH 5KAIH 2WMMA 3M9BA 3JC22 3VP9A 1P84D 4RJTA 1NENC 1FJPA 1SQVJ 3AE6C 3I5CA 3H1LD 4Y99C 1L4AB 2IYOA 3L74G 5CJ0A 1M8OB 3AE2C 3WU2H 3L35A 1AA0A 1L0NK 2IFNA 2OARA 2E5TA 2Q5UA 5KKZC 1HWTC 1SQQG 2JKVA 2GA1A 1U7JA 2XKMA 1NTMJ 1OVVA 4EOTA 4L74A 5BVZA 3BASA 1SQPJ 2O01J 1ZR4A 1PGJA 4DCKA 2FYUG 4PJ0H 1OZHA 2WPRA 3TGUJ 2KS1A 1G1JA 1GD2E 4Z1MH 3VOPA 3ZDMA 3CC2P 2BCCJ 3P32A 4U3FD 1IC2A 3L70D 3CWBE 1OWAA 3L73G 1JUNA 1VF5C 3CXHE 5AW3B 1FOSF 1MV8A 1ZXGA 4H0LC 5C2TC 1XTCC 3MD0A 2NPSA 2A45I 3E1RA 4L75A 3AEDC 2E43A 2ZJSE 3D6ZA 5CCHD 1Z56A 4U7JA 3B5NC 5AW1B 3AE3D 3CIRD 1NTZE 1Q7YQ 2YIUB 4W80A 2H88C 2R5BA 1HH0A 3RK3C 2HODA 1NTZJ 2WPVB 3N4XA 1K05A 1ZP0C 1KYOD 5GTHH 4H44D 3GLMA 3GHGC 3KZIH 1E5WA 1KQGB 3VRBC 3V4QA 2KLVA 1IFDA 3B5NA 4DHZA 4H13D 1S72P 4OGQC 3V6IA 1SQBE 1YQ4C 3L74J 3CC7P 3WUVA 1N73C 2R3CA 3LW5J 1Y9BA 2E76B 4NPEA 2WT7A 3FXDA 2WSCJ 1SQQK 4WY4D 5CJ4A 1L4AA 1SQPG 1KILB 3A0HH 1SQPK 3A0HE 2OYIB 4DDGA 2O01H 3RK3B 2HLOA 4YSZD 4D6TD 1KFYC 1NAFA 1NH4A 5TISE 5BU8B 3Q2YA 1KF6D 4TLFA 1MKMA 3P8CD 1GDTA 3A3YB 4YSYD 1TU3F 4RESB 2FYUD 1RQVA 1N7SB 4GODA 2QJKB 2FFDC 3PP5A 4WY4C 3KPEA 5L8RJ 1NTZK 1YIJP 1QLED 1MFZA 3V4WA 1BSNA 1XTGB 3L73J 5KLVD 1NTMK 1BE3E 1K8AQ 1KILA 2JO1A 1OMIA 4IOIH 2C9LY 2BCCG 2M8RA 2P7JA 2ZAEB 5AW7B 3P4SD 1BGYJ 2WU2D 1MZ9A 3MP7B 2R3SA 2D2CD 1N7SC 1QL2A 1LTJC 4PD4I 4I1LA 2Y9ZA 1DEEG 4BWNA 1YI2P 1VQLP 2C9NY 1D7MA 2B88A 1NTMG 4GIFA 2M5AA 2C0XA 3A5TA 3L71E 1X0TA 3U59A 4U3FJ 1IK9A 1E79H 2A06D 2QVAA 1LT9C 5DJTB 3TGUD 2YKPA 1KYOH 1RE4C 1JY3O 1N7SA 5CCHA 2Y0CA 1AQTA 4ZMDA 3OA7A 5AW9B 3AE9D 1S1CX 2FYNC 1GK4A 2R5DA 1KN7A 3L75G 2N1TB 2AEMA 4R4LA 4IL6E 3GF7A 5AVTB 2IBZG 4XA4A 3VR9D 4YXWH 3CCVP 1L0ND 2AEFA 1VL2A 2E5YA 2KLUA 4YT0C 2OGUA 3H1HE 1X9VA 2IBZE 3B5ND 3H1IE 1NTKJ 3TK1A 3AE7C 1A02J 1YHQP 5APSA 1PL5A 1SFCD 2OYIA 2O1JA 2E75B 2LKMA 2G8YA 2KIKA 3VRBD 1YJNP 2WDQD 2NRGA 3HRNA 5B5EE 2WSFJ 3LIDA 3VR9C 4OGQB 2OYHB 4DHJA 2WP9C 3VTPC 4GDOA 1BCCG 1WMKA 3AEED 2Z4EA 2ZFCA 2IZ0A 3RL0D 3CCSP 4AUWA 2MJZA 3P4PC 1VQPP 1S5LE 1H8AA 3RK3E 4H0LD 4JF7A 3H1HD 4PV1C 1SQPD 1L0LG 2WT7B 2WITA 2ZVOB 3CPWO 2E74C 1RF1A 1FS0E 2PAJA 3U1AA 1KF6C 1VQ6P 2I8DA 2H7HA 3AEGC 5TISH 1K73Q 1OX3A 2K9JB 3MHVA 2WSSH 3W67A 4EDFA 2HPCB 3HD7B 2BEZF 4C7RA 5H2FE 1FZCA 5APXA 3P4PD 2WTYA 2CPSA 2JP3A 2FYZA 4N6JA 3V2NA 1NU1D 1KQSO 1SFCA 1L2PA 5C3JD 1RF1B 2IFMA 3CCLP 1USEA 2G3AA 2W6BA 1WRGA 3M0DC 3MUDC 1LTSC 2WDRC 2JWDA 1LTAC 2FXPA 5C3JC 4PD4E 3T97A 3P7KA 3HD7C 3H1IG 5TJHA 1IO4A 1SFCC 2XNXA 1NTKE 2RKLA 3BCCJ 5KLIB 1FOSE 4C7NA 3H1LE 2FYUE 5KJ7C 3IAOA 3G4SP 1FDOA 3Q3DA 1EQ7A 1L0LE 1RF0A 5AVXB 4OWFA 3H1JJ 3Q5RA 3HD7A 3CMAP 3GW6A 3P4QD 1SQVK 3R2PA 3L70E 4XFJA 4YTPC 4ZKUA 1DD4A 1EZVI 1H0TB 1KB9D 1DH3A 5K5GB 5CBNA 3C8VA 4D6TE 2KYVA 5KJ7D 1T3JA 2ZYDA 2OTJP 3VMZA 1PFIA 4BRYB 2AXCA 1BGYE 3L70G 2V4HA 3O6QA 1CW5A 4HB1A 2QM8A 1FU1A 3HE4A 1OVUA 2PRRA 4H44B 5CHXA 1AVOA 1M90Q 2KP8A 2GUVA 2ZXEB 3AEBD 2H8PD 1NU1G 4K35A 4GKGA 5B5EH 3H1HJ 3EQ2A 4WVZA 3CX5H 1YTZI 2O3JA 1JY2P 1JY2O 1U57A 4KT0J 4PV1D 2E75D 2WQYD 3AE9C 2WPQA 4D6TG 4A7PA 3TNUA 1KILD 1FBMA 1JCDA 3AE1D 2BS4C 2ZT9C 5KKZB 1JMMA 3A0BH 3BVHA 1KV4A 2WDVC 3L37A 5AVZB 3OW2O 2QJYC 1KB9I 3E1IA 1SQXG 3I55P 2WQYC 4YTNC 3MTUE 5CMZA 4L73A 2QEXP 1NHLA 1OXZA 2IBZI 4ASVA 3SFEC 3VMYA 2FBWC 1FZGA 2KNCB 5AW0B 3QH9A 4YTPD 2ZYAA 4I7ZC 4UB8E 2PP6A 3P8CE 1JO5A 2D2CB 2B89A 1VQ4P 3L4FA 3C9IA 4LLHA 3Q5PA 1IFJA 2WDRD 3PRJA 2J59M 3RBZA 4W7YA 1VPCA 1LWUB 2NPSC 2JWAA 1NEKD 1LTJA 1PGOA 2POHA 1HBWA 3C1LA 3TNUB 1QVFO 5KLVG 5KTBA 5KLVE 1FAVA 1SQVE 2AEJA 1KMIZ 1JCCA 4UB6E 2HG5D 3OJAB 3CXHH 2IDBA 2E76C 5CBOA 3BATA 3IFMA 3HUSB 3IF4A 2FYUK 5AVWB 4Y28J 1PP9G 1VF5B 1FDMA 2KSJA 3GHGA 1VDFA 5AVQB 2YMKA 2QM7A 1L0LD 1T6AA 4PJ0E 3EFGA 1FJKA 1YJ9P 3H25A 2YMYA 4I6MC 1N73A 2QJKC 2CK3H 5KAFE 1GK6A 1EDJA 2PFXA 2AXTE 3QWOC 2JDIH 3CMEP 2Y9YA 2KOGA 3GMAA 1KB9E 4N3YB 1M57D 1QVGO 1W2EA 1NJIQ 1GL2A 5CCGC 3IR9A 5B66E 1P84I 1N73B 2K88A 2O01N 4KHXA 5C39A 3KYQA 3RL0g 4I2LC 2KNCA 1NU1E 1GU4A 3RL0B 4EI2A 1NTME 3H32B 5KAIE 1VQOP 4ZNCA 1JNMA 2QJPB 3IN6A 4H0LB 1EDIA 1G2CB 2WWWA 3AE5C 1SQXJ 1J1DB 3L74E 2WZ7A 3K5BA 3H1KG 3M9HA 5CCGD 4IL6H 2ZXXA 1EXIA 1ZN5A 3H1JE 3MIWA 3AEEC 3HD7D 3RK2D 1YTZT 1LTBC 3ITKA 2M0BA 1R5SA 2YKQA 4BRYA 1RE4A 3L75J 3CX5D 3AEGD 3VMXA 2J5UA 2WU5D 2KI7B 1H0TA 2IZ1A 1LTGC 3USSA 1RY3A 1IFIA 4W7ZA 1CI6B 1T8ZA 2KZJA 2Q1KA 2Q7CA 3V2PA 5KLVK 1EDLA 2HFED 3F5HA 3MGNA 1VQMP 1S3JA 1X8YA 2BCCE 3WUTA 2OQQA 1LTIC 3L72G 1QL1A 1SQXK 1SS1A 1BGYD 2ACZC 1X22A 1L0NJ 2CPBA 2E42A 3M91A 1SQVD 3GF3A 1JOCA 4YTND 1ZRTD 3AE4D 2L5GB 2BS2C 1JB0J 3RGUA 5KJ7A 1VQ5P 3CX5E 2R32A 3P4SC 1RF0C 1NAYA 1NGMB 5H2FH 5APUA 3AEFD 1PP9J 1NOHA 3NMDA 4DZOA 3WUUA 1N86A 1SQXD 5GTHE 3CCQP 2LXBA 3P4RC 3JCUH 2NZ2A 1L0NG 1YQ3D 3MZWB 1Q81Q 3L73E 5APYA 3V2QA 1YJWP 4GOEA 1PPJG 2Q3IA 4JBZA 1M1KQ 1HJ0A 1GL2D 4LDTA 1LWUA 4PD4H 3H32A 2BEQD 2WU5C 1FZFA 3AEFC 1NTMD 3BCCG 1NEND 2B87A 5AVRB 1LTTC 1YBKA 4M3LA 3VMAA 3Q5SA 2QIWA 5APTA 4YSYC 4I7ZB 1KZUB 2FFDB 4PV1B 1AVYA 2PGDA 1BE3G 2A06E 3H1LJ 3H1JD 2KUBA 2M3EA 3E7KA 3RK2C 1J1DC 3HE4B 3II6A 2FYNB 1LP1A 3VN0A 1CSBA 4YTMC 1S5LX 3H1LG 1VQ7P 1JY2N 1RQUA 1ZLLA 1KFNA 1PGQA 1SQBK 3CI9A 2IBZD 2M5AB 2IYPA 1NU1J 3CWBD 3AE3C 3CIRC 2ZT9B 3ABVC 2YXRB 2W8ZA 5CCHC 3BRTB 1GTWA 3AE4C 4YXDC 4YSZC 3FGAD 2YIUC
chains in the Genus database with same CATH topology
3AE8C 3AEAD 2QJKC 3GF7A 3P4QC 2BEZF 4YSXC 4YTMD 1VF5C 4YSYD 3C8VA 4H44C 4IL6X 4YXDD 3SFEC 3P4RC 3VR9D 4YT0D 3VR8D 1TU3F 2FBWC 1RQVA 2H88D 3AEGD 1PV3A 3P4PD 1VL2A 2J5UA 2NZ2A 1AJYA 3D71A 1ZOYD 4H0LC 1YQ3D 4YT0C 2D2CC 3VR8C 5C2TC 4YTPD 2WU5D 3SFDD 2JP3A 2P10A 3AECC 4TT3H 4H13C 2H89D 3AEDC 3GMAA 3D6ZA 3VRAD 3G9RA 4I7ZC 3AE7C 5L8RJ 3AEAC 4U7JA 2BS3C 1UIXA 2WDVD 1HJ0A 1OW7A 4R4LA 3O6QA 2WS3C 1HF9A 3AE3D 3CIRD 2D2CB 4H13B 4R4MA 1L0VC 1PL5A 5C3JD 1ZP0D 2JO1A 1OMIA 2WDQC 2WU2C 2E75B 2E74B 2BEQD 2WU5C 1NEKC 2G8YA 1DIPA 2ACZD 1OW8A 2G3AA 2H89C 3AEFC 1R8EA 3Q5PA 1ZOYC 3D70A 4H44B 2WDRD 3P4SD 2WU2D 3EWKA 3R4YA 3VRAC 1NEND 2E75C 2H88C 3VRBD 2WDRC 2V7QJ 3Q5SA 3AEBD 3Q1MA 2WPVB 2D2CD 2QIWA 1NEKD 5C2TD 3AE2D 4YSYC 1K05A 2K9YA 2OQQA 1ZP0C 2FXPA 4I7ZB 2WDQD 1NENC 3AE7D 4PV1B 3AECD 3D6YA 5C3JC 3AE6C 4H44D 2WSEJ 3RL0g 1ZMEC 1GMJA 3GLMA 2WSFJ 3SFED 3VR9C 4OGQB 1OW6A 2ACZC 1KQGB 3VRBC 1KMIZ 2QSIA 1KQFB 3GF3A 4YTND 3AE2C 1VF5D 3SFDC 4H13D 2IDBA 1U57A 4KT0J 4OGQC 1Q90D 2WP9C 2E76C 3IN6A 1NYHA 1KORA 4H0LB 4PV1D 4GDOA 2B76D 5KKZC 1DD3A 1WMKA 2E75D 3T97B 2WQYD 3AEED 3AE4D 3S9OA 1YQ4C 1IK7A 3AE9C 4YSXD 2BS2C 4OGQD 5M1BA 3AE5C 1JB0J 2MKVA 4YTMC 1KTMA 1S5LX 2ZT9D 3AE6D 4KX6D 1YQ3C 1KFYD 3AE1D 4Y28J 2BS4C 2FBWD 1VF5B 3IAOA 1Y9BA 2E76B 3LW5J 1FDOA 1RQUA 3P4PC 2ZT9C 4KX6C 3AE8D 1EXIA 3P4SC 3RK3E 3Q3DA 4H0LD 2O01J 3AEBC 2WSCJ 4PV1C 2B76C 1NGMB 5KLIC 3AEEC 1K04A 2YMKA 2WP9D 3AE1C 3AEDD 4RKUJ 3ABVD 1KILE 3P4RD 3AE3C 3CIRC 1ZRTE 2E74C 1QLBC 2ZT9B 3Q5RA 1EXJA 1E7PC 3ABVC 1YQ4D 2WDVC 1KF6C 2QJPC 3AE9D 3AEFD 2QJYC 3AE5D 4YSZD 1S1CX 2FYNC 1KFYC 3P4QD 2E76D 1PIXA 3B71A 4Z1MH 3AEGC 3H25A 3AE4C 1L0VD 3Q2YA 1KF6D 4YXDC 4YSZC 2WS3D 3FGAD 1MKMA 2E74D 4XFJA 4YTPC 1FDIA 1DD4A 2WQYC 4YTNC 2YIUC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AE8 C;  3AEA D;  3P4Q C;  4YSX C;  4YTM D;  4YSY D;  4YXD D;  3SFE C;  3P4R C;  3VR9 D;  4YT0 D;  3VR8 D;  2FBW C;  2H88 D;  3AEG D;  1PV3 A;  3P4P D;  1ZOY D;  1YQ3 D;  4YT0 C;  3VR8 C;  5C2T C;  4YTP D;  2WU5 D;  3AEC C;  2H89 D;  3AED C;  3VRA D;  3AE7 C;  3AEA C;  2BS3 C;  1OW7 A;  2WS3 C;  3AE3 D;  3CIR D;  1L0V C;  5C3J D;  1ZP0 D;  2WDQ C;  2WU2 C;  2WU5 C;  1NEK C;  3SFD D;  2ACZ D;  1OW8 A;  2G3A A;  2H89 C;  3AEF C;  3ABV D;  2WDV D;  1ZOY C;  3P4S D;  2WDR D;  2WU2 D;  3VRA C;  1NEN D;  2H88 C;  3VRB D;  2WDR C;  3AEB D;  5C2T D;  1NEK D;  3AE2 D;  4YSY C;  1K05 A;  1ZP0 C;  2WDQ D;  1NEN C;  3AE7 D;  3AEC D;  5C3J C;  3AE6 C;  3SFE D;  3VR9 C;  1OW6 A;  2ACZ C;  3VRB C;  4YTN D;  3AE2 C;  3SFD C;  2WP9 C;  2B76 D;  3AE4 D;  2WQY D;  3AEE D;  4YSX D;  3S9O A;  3AE9 C;  1YQ4 C;  2BS2 C;  3AE5 C;  4YTM C;  1KTM A;  3AE6 D;  4KX6 D;  1YQ3 C;  1KFY D;  3AE1 D;  2BS4 C;  2FBW D;  3P4P C;  4KX6 C;  3AE8 D;  3P4S C;  3AEB C;  2B76 C;  3AEE C;  1K04 A;  2WP9 D;  3AE1 C;  3AED D;  3P4R D;  3AE3 C;  3CIR C;  1QLB C;  1E7P C;  3ABV C;  1YQ4 D;  2WDV C;  1KF6 C;  3AE9 D;  3AEF D;  3AE5 D;  4YSZ D;  1KFY C;  3P4Q D;  3B71 A;  3AEG C;  3AE4 C;  1L0V D;  1KF6 D;  4YXD C;  4YSZ C;  2WS3 D;  4YTP C;  2WQY C;  4YTN C; 
#chains in the Genus database with same CATH topology
 1LP1 B;  2L91 A;  1LT9 B;  2KS1 B;  4NPD A;  1G1I A;  5GTI H;  1IFM A;  5AW2 B;  2KB7 P;  1DX7 A;  2A45 G;  3KDP B;  1Y47 A;  3HUS C;  3CL3 D;  5AW8 B;  2ZFY A;  1NTK K;  4R4M A;  1NU1 K;  2N1T C;  3SFD D;  2P1J A;  4DT0 A;  1SQQ J;  1N2D C;  2HPC A;  1N7L A;  2J58 A;  1URQ C;  1BCC D;  1LT1 A;  2W6A A;  4N78 D;  3AE7 D;  3AEC D;  3TGU E;  2KK7 A;  3L74 D;  2I1K A;  2M3B A;  4AQR D;  1VF5 D;  3PLN A;  4IFF A;  2Y0D A;  3L71 D;  2N1T A;  5M1B A;  1H89 A;  1DEB A;  2OTL P;  1G2C A;  3H1K E;  1IFP A;  2B87 B;  3H1J G;  4GOF A;  1R5L A;  2N9B A;  3L36 A;  3L72 J;  2N9Y B;  5AW4 B;  3CCR P;  1FZC B;  3AED D;  1L0N E;  2WPS A;  2P67 A;  1ZRT E;  1HTL C;  1ZW0 A;  2Y0E A;  1SQX E;  2K3R A;  1TFF A;  1JTH A;  1H88 A;  3AE8 C;  3AEA D;  1BCC J;  2QJY B;  2RH0 A;  1M1J B;  1VQ9 P;  4H44 C;  4YT0 D;  3SWF A;  1NWQ A;  1JY3 P;  1FZA A;  2YNY A;  4LC1 A;  2P10 A;  4H13 C;  1ZV8 A;  5E79 H;  1KQL A;  3AEA C;  3W68 A;  1OIP A;  1EZV E;  1NTK D;  3TSI A;  2NPS B;  3TYY A;  3SSU A;  2JJL A;  2ACZ D;  1ZOY C;  4HKZ H;  2OYH A;  1SQB J;  3VRA C;  1USD A;  1VQN P;  3KZI E;  1LJ2 A;  5BU5 A;  4BXL A;  3H1K J;  3F89 A;  1LT9 A;  2O1K A;  4AYC A;  1KOR A;  3T97 B;  4YSX D;  5E79 E;  1J2J B;  1HJB A;  3A2A A;  2XU6 A;  2OYH C;  3RK2 B;  1PP9 D;  2A45 H;  2K37 A;  4JYB A;  1S5L H;  3WU2 E;  4HYT B;  3P4R D;  3L75 E;  3L71 G;  1CI6 A;  1E7P C;  2FY8 A;  1QX8 A;  2HR3 A;  2KXP B;  1JEK A;  4YSX C;  4U3F G;  1RHZ B;  3P4Q C;  2HYN A;  2Z5I A;  1Y8A A;  4IFD K;  4I6L A;  2XDJ A;  1GW3 A;  2W27 A;  2OYI C;  1S2E A;  4C7N B;  4L76 A;  4K3A A;  3CCJ P;  1IZN B;  4OVN F;  1KYO I;  3HTK A;  1HF9 A;  3PJS K;  4JPZ B;  3S4R A;  1YIT P;  1HVV A;  1Q86 Q;  1KFM A;  1BGY G;  1NEK C;  1OW8 A;  1R8E A;  2WDV D;  1OVR A;  2Q9I A;  5AW5 B;  4DOJ A;  1S9K D;  1FZB A;  3O6Q B;  4Y99 B;  3P8M C;  4PD4 D;  3L70 J;  3SWK A;  2XV5 A;  2OTK E;  3SFE D;  1VQK P;  3HE5 A;  2XZR A;  1HGV A;  2QSI A;  1YYC A;  1A02 F;  1GL2 C;  2GM4 A;  1T2K D;  1W5C E;  3FWN A;  1NTZ G;  1M1J A;  3OAK A;  1NYH A;  1SQQ E;  3HE5 B;  2A06 G;  3S9O A;  2FXO A;  3L72 D;  2K1A A;  3H1K D;  3VON A;  1L4A D;  1M7L A;  3G3Z A;  1FE6 A;  1QEX A;  3FWL A;  4KX6 C;  3AEB C;  2RMZ A;  4LGD E;  2JEE A;  5KLI C;  4C46 A;  3AE1 C;  3CWB G;  3NXS A;  1EC5 A;  3B71 A;  4WY4 A;  3HTK B;  3RBX A;  5B66 H;  1L0V D;  4RO0 A;  2LXC B;  2IX7 C;  4GT1 A;  1FZC C;  1FDI A;  1SQP E;  1M1J C;  4YTM D;  3CCM P;  3SWY A;  1Q2N A;  4IL6 X;  1JM0 A;  1GZL A;  4HH2 A;  1Q82 Q;  3M9Q A;  1GL2 B;  3CX5 I;  3H1I J;  3BCC D;  1EDK A;  3AEC C;  4TT3 H;  1FZE A;  2FYU J;  3B4S A;  3VRA D;  1KYO E;  3MUD A;  1BSH A;  1L0V C;  3O8Z A;  1BCC E;  1ZP0 D;  5GTI E;  1P84 E;  2WU2 C;  2W90 A;  3PHL A;  1VQ8 P;  3EWK A;  3R4Y A;  4DHI B;  1PPJ D;  2C0W A;  1GW4 A;  2SPZ A;  2V7Q J;  3G71 P;  2QE7 H;  4OH8 B;  4CPG A;  2JR8 A;  1ZME C;  1BE3 J;  2DW3 A;  1J1E B;  1SQV G;  1KQF B;  2WSE H;  4D6T J;  1SP4 A;  5EFW B;  2NPS D;  1Q90 D;  3V5B A;  1DD3 A;  1SVF A;  4WBA A;  1CZQ A;  2QRX A;  3TF5 A;  3AE6 D;  2ZT9 D;  2WSC H;  1KFY D;  4JYC A;  2YXQ B;  3AE8 D;  5AVV B;  3TGU G;  3H1H G;  3LW5 H;  4ZKP A;  4UB6 H;  2B76 C;  2P2U A;  1L0L J;  1PZQ A;  2WP9 D;  2AXT H;  1U7M A;  2W6J H;  1L4A C;  2QJP C;  2E76 D;  1PIX A;  3S1K A;  2KZI A;  3I56 P;  3TDK A;  2E74 D;  1URQ B;  1EZV G;  2OYO A;  1HGZ A;  3PTZ A;  2Z5H A;  3M06 A;  4YXD D;  4QMA A;  3RL0 C;  1ZOY D;  4EIJ A;  3VR8 C;  2D2C C;  1SLQ A;  2FFD A;  1JTH B;  3HUS A;  2QG4 A;  3N7N A;  4B86 A;  3KQG A;  2WS3 C;  2HOD B;  1W2B O;  2KSE A;  1KIL C;  3UIA A;  2YO3 A;  2E75 C;  2Q3E A;  4ASW A;  4N78 E;  1AFO A;  2K9J A;  4DJG A;  3G6E P;  3VYI A;  1M56 D;  3D6Y A;  3A7O A;  1GMJ A;  3GG2 A;  1LWU C;  1OW6 A;  5AVY B;  1ZR2 A;  4WWI A;  1NTZ D;  1UII A;  3SFD C;  1RF1 C;  2FKW B;  1S9K E;  1NVO A;  1J1E C;  1L0L K;  4O9B A;  1JY3 N;  5APW A;  1SQB G;  2BAS A;  1SQQ D;  4KX6 D;  3NTN A;  1YQ3 C;  4U3F E;  3CWB J;  3L71 J;  1AQ5 A;  4RKU J;  1KIL E;  1PP9 E;  1T3U A;  1S4X A;  1QLB C;  3NFQ A;  1YQ4 D;  3JSV C;  3AE5 D;  3CC4 P;  1PGP A;  1NKZ B;  2YO2 A;  2GUS A;  1BDC A;  1HUC A;  3PH0 A;  3CLQ A;  2ITA A;  1WT6 A;  2I1J A;  1RH5 B;  1GU5 A;  1NO4 A;  3FX0 A;  3M0D A;  3CXH D;  1AJY A;  2WVR A;  2N1T D;  3CCU P;  1RE3 C;  2H89 D;  1N8R Q;  3CD6 P;  3L75 D;  1EZV D;  1LTJ B;  2BS3 C;  1KB9 H;  1UIX A;  4EYY Q;  3KXD A;  4DDI A;  1OW7 A;  3KHU A;  4H13 B;  4XE5 B;  1T2K C;  2VRS A;  4JQ0 D;  1AV1 A;  1P84 H;  2BCC D;  2WDQ C;  2XND H;  2FXM A;  1IJD B;  1DIP A;  3B5N B;  4IFM A;  3D70 A;  2Q6Q A;  1LNQ A;  2H43 A;  1MUU A;  3Q1M A;  5C2T D;  3H6P A;  5AW6 B;  3AE2 D;  1SFC B;  2K9Y A;  2RN0 A;  1NTK G;  2WSE J;  4WY4 B;  1RE3 A;  3U1C A;  4MN4 C;  5APV A;  3RK3 D;  1BDD A;  2B9B A;  1KD1 Q;  3GHG B;  5AVS B;  3LIE A;  5AVU B;  2B76 D;  1IFN A;  4WB4 A;  1QGK B;  1IK7 A;  1URQ A;  4OGQ D;  2V7Q H;  1NKN A;  2YKO A;  2MKV A;  1KTM A;  2ZVN B;  4HJG H;  2FBW D;  1N7S D;  2IPP A;  2W83 C;  3L73 D;  3V2R A;  5KLV J;  3A0B E;  3CCE P;  2LR2 A;  3L72 E;  1K04 A;  2P58 A;  3JCU E;  4NPF X;  1EXJ A;  1JMB A;  1SQB D;  3FXE A;  3EFF K;  3B8E B;  3M0A A;  2WS3 D;  3BCC E;  2R44 A;  2UWJ E;  3WMM 0;  1K9M Q;  4KJM A;  1PPJ E;  2ZYG A;  3VR8 D;  2H88 D;  3CXH I;  1PV3 A;  1LGH B;  3D71 A;  1MFT A;  4FJV A;  1KC8 Q;  4YPC A;  3VP8 A;  4UB8 H;  3BRV B;  3G9R A;  5CCG A;  1OFC X;  2QA4 P;  1X79 B;  5APQ A;  1FC2 C;  5KAF H;  2E74 B;  3H1I D;  1URQ D;  1BE3 D;  3ABV D;  2H89 C;  5DJU B;  2WSF H;  5KAI H;  2WMM A;  3M9B A;  3JC2 2;  3VP9 A;  1P84 D;  4RJT A;  1NEN C;  1FJP A;  1SQV J;  3AE6 C;  3I5C A;  3H1L D;  4Y99 C;  1L4A B;  2IYO A;  3L74 G;  5CJ0 A;  1M8O B;  3AE2 C;  3WU2 H;  3L35 A;  1AA0 A;  1L0N K;  2IFN A;  2OAR A;  2E5T A;  2Q5U A;  5KKZ C;  1HWT C;  1SQQ G;  2JKV A;  2GA1 A;  1U7J A;  2XKM A;  1NTM J;  1OVV A;  4EOT A;  4L74 A;  5BVZ A;  3BAS A;  1SQP J;  2O01 J;  1ZR4 A;  1PGJ A;  4DCK A;  2FYU G;  4PJ0 H;  1OZH A;  2WPR A;  3TGU J;  2KS1 A;  1G1J A;  1GD2 E;  4Z1M H;  3VOP A;  3ZDM A;  3CC2 P;  2BCC J;  3P32 A;  4U3F D;  1IC2 A;  3L70 D;  3CWB E;  1OWA A;  3L73 G;  1JUN A;  1VF5 C;  3CXH E;  5AW3 B;  1FOS F;  1MV8 A;  1ZXG A;  4H0L C;  5C2T C;  1XTC C;  3MD0 A;  2NPS A;  2A45 I;  3E1R A;  4L75 A;  3AED C;  2E43 A;  2ZJS E;  3D6Z A;  5CCH D;  1Z56 A;  4U7J A;  3B5N C;  5AW1 B;  3AE3 D;  3CIR D;  1NTZ E;  1Q7Y Q;  2YIU B;  4W80 A;  2H88 C;  2R5B A;  1HH0 A;  3RK3 C;  2HOD A;  1NTZ J;  2WPV B;  3N4X A;  1K05 A;  1ZP0 C;  1KYO D;  5GTH H;  4H44 D;  3GLM A;  3GHG C;  3KZI H;  1E5W A;  1KQG B;  3VRB C;  3V4Q A;  2KLV A;  1IFD A;  3B5N A;  4DHZ A;  4H13 D;  1S72 P;  4OGQ C;  3V6I A;  1SQB E;  1YQ4 C;  3L74 J;  3CC7 P;  3WUV A;  1N73 C;  2R3C A;  3LW5 J;  1Y9B A;  2E76 B;  4NPE A;  2WT7 A;  3FXD A;  2WSC J;  1SQQ K;  4WY4 D;  5CJ4 A;  1L4A A;  1SQP G;  1KIL B;  3A0H H;  1SQP K;  3A0H E;  2OYI B;  4DDG A;  2O01 H;  3RK3 B;  2HLO A;  4YSZ D;  4D6T D;  1KFY C;  1NAF A;  1NH4 A;  5TIS E;  5BU8 B;  3Q2Y A;  1KF6 D;  4TLF A;  1MKM A;  3P8C D;  1GDT A;  3A3Y B;  4YSY D;  1TU3 F;  4RES B;  2FYU D;  1RQV A;  1N7S B;  4GOD A;  2QJK B;  2FFD C;  3PP5 A;  4WY4 C;  3KPE A;  5L8R J;  1NTZ K;  1YIJ P;  1QLE D;  1MFZ A;  3V4W A;  1BSN A;  1XTG B;  3L73 J;  5KLV D;  1NTM K;  1BE3 E;  1K8A Q;  1KIL A;  2JO1 A;  1OMI A;  4IOI H;  2C9L Y;  2BCC G;  2M8R A;  2P7J A;  2ZAE B;  5AW7 B;  3P4S D;  1BGY J;  2WU2 D;  1MZ9 A;  3MP7 B;  2R3S A;  2D2C D;  1N7S C;  1QL2 A;  1LTJ C;  4PD4 I;  4I1L A;  2Y9Z A;  1DEE G;  4BWN A;  1YI2 P;  1VQL P;  2C9N Y;  1D7M A;  2B88 A;  1NTM G;  4GIF A;  2M5A A;  2C0X A;  3A5T A;  3L71 E;  1X0T A;  3U59 A;  4U3F J;  1IK9 A;  1E79 H;  2A06 D;  2QVA A;  1LT9 C;  5DJT B;  3TGU D;  2YKP A;  1KYO H;  1RE4 C;  1JY3 O;  1N7S A;  5CCH A;  2Y0C A;  1AQT A;  4ZMD A;  3OA7 A;  5AW9 B;  3AE9 D;  1S1C X;  2FYN C;  1GK4 A;  2R5D A;  1KN7 A;  3L75 G;  2N1T B;  2AEM A;  4R4L A;  4IL6 E;  3GF7 A;  5AVT B;  2IBZ G;  4XA4 A;  3VR9 D;  4YXW H;  3CCV P;  1L0N D;  2AEF A;  1VL2 A;  2E5Y A;  2KLU A;  4YT0 C;  2OGU A;  3H1H E;  1X9V A;  2IBZ E;  3B5N D;  3H1I E;  1NTK J;  3TK1 A;  3AE7 C;  1A02 J;  1YHQ P;  5APS A;  1PL5 A;  1SFC D;  2OYI A;  2O1J A;  2E75 B;  2LKM A;  2G8Y A;  2KIK A;  3VRB D;  1YJN P;  2WDQ D;  2NRG A;  3HRN A;  5B5E E;  2WSF J;  3LID A;  3VR9 C;  4OGQ B;  2OYH B;  4DHJ A;  2WP9 C;  3VTP C;  4GDO A;  1BCC G;  1WMK A;  3AEE D;  2Z4E A;  2ZFC A;  2IZ0 A;  3RL0 D;  3CCS P;  4AUW A;  2MJZ A;  3P4P C;  1VQP P;  1S5L E;  1H8A A;  3RK3 E;  4H0L D;  4JF7 A;  3H1H D;  4PV1 C;  1SQP D;  1L0L G;  2WT7 B;  2WIT A;  2ZVO B;  3CPW O;  2E74 C;  1RF1 A;  1FS0 E;  2PAJ A;  3U1A A;  1KF6 C;  1VQ6 P;  2I8D A;  2H7H A;  3AEG C;  5TIS H;  1K73 Q;  1OX3 A;  2K9J B;  3MHV A;  2WSS H;  3W67 A;  4EDF A;  2HPC B;  3HD7 B;  2BEZ F;  4C7R A;  5H2F E;  1FZC A;  5APX A;  3P4P D;  2WTY A;  2CPS A;  2JP3 A;  2FYZ A;  4N6J A;  3V2N A;  1NU1 D;  1KQS O;  1SFC A;  1L2P A;  5C3J D;  1RF1 B;  2IFM A;  3CCL P;  1USE A;  2G3A A;  2W6B A;  1WRG A;  3M0D C;  3MUD C;  1LTS C;  2WDR C;  2JWD A;  1LTA C;  2FXP A;  5C3J C;  4PD4 E;  3T97 A;  3P7K A;  3HD7 C;  3H1I G;  5TJH A;  1IO4 A;  1SFC C;  2XNX A;  1NTK E;  2RKL A;  3BCC J;  5KLI B;  1FOS E;  4C7N A;  3H1L E;  2FYU E;  5KJ7 C;  3IAO A;  3G4S P;  1FDO A;  3Q3D A;  1EQ7 A;  1L0L E;  1RF0 A;  5AVX B;  4OWF A;  3H1J J;  3Q5R A;  3HD7 A;  3CMA P;  3GW6 A;  3P4Q D;  1SQV K;  3R2P A;  3L70 E;  4XFJ A;  4YTP C;  4ZKU A;  1DD4 A;  1EZV I;  1H0T B;  1KB9 D;  1DH3 A;  5K5G B;  5CBN A;  3C8V A;  4D6T E;  2KYV A;  5KJ7 D;  1T3J A;  2ZYD A;  2OTJ P;  3VMZ A;  1PFI A;  4BRY B;  2AXC A;  1BGY E;  3L70 G;  2V4H A;  3O6Q A;  1CW5 A;  4HB1 A;  2QM8 A;  1FU1 A;  3HE4 A;  1OVU A;  2PRR A;  4H44 B;  5CHX A;  1AVO A;  1M90 Q;  2KP8 A;  2GUV A;  2ZXE B;  3AEB D;  2H8P D;  1NU1 G;  4K35 A;  4GKG A;  5B5E H;  3H1H J;  3EQ2 A;  4WVZ A;  3CX5 H;  1YTZ I;  2O3J A;  1JY2 P;  1JY2 O;  1U57 A;  4KT0 J;  4PV1 D;  2E75 D;  2WQY D;  3AE9 C;  2WPQ A;  4D6T G;  4A7P A;  3TNU A;  1KIL D;  1FBM A;  1JCD A;  3AE1 D;  2BS4 C;  2ZT9 C;  5KKZ B;  1JMM A;  3A0B H;  3BVH A;  1KV4 A;  2WDV C;  3L37 A;  5AVZ B;  3OW2 O;  2QJY C;  1KB9 I;  3E1I A;  1SQX G;  3I55 P;  2WQY C;  4YTN C;  3MTU E;  5CMZ A;  4L73 A;  2QEX P;  1NHL A;  1OXZ A;  2IBZ I;  4ASV A;  3SFE C;  3VMY A;  2FBW C;  1FZG A;  2KNC B;  5AW0 B;  3QH9 A;  4YTP D;  2ZYA A;  4I7Z C;  4UB8 E;  2PP6 A;  3P8C E;  1JO5 A;  2D2C B;  2B89 A;  1VQ4 P;  3L4F A;  3C9I A;  4LLH A;  3Q5P A;  1IFJ A;  2WDR D;  3PRJ A;  2J59 M;  3RBZ A;  4W7Y A;  1VPC A;  1LWU B;  2NPS C;  2JWA A;  1NEK D;  1LTJ A;  1PGO A;  2POH A;  1HBW A;  3C1L A;  3TNU B;  1QVF O;  5KLV G;  5KTB A;  5KLV E;  1FAV A;  1SQV E;  2AEJ A;  1KMI Z;  1JCC A;  4UB6 E;  2HG5 D;  3OJA B;  3CXH H;  2IDB A;  2E76 C;  5CBO A;  3BAT A;  3IFM A;  3HUS B;  3IF4 A;  2FYU K;  5AVW B;  4Y28 J;  1PP9 G;  1VF5 B;  1FDM A;  2KSJ A;  3GHG A;  1VDF A;  5AVQ B;  2YMK A;  2QM7 A;  1L0L D;  1T6A A;  4PJ0 E;  3EFG A;  1FJK A;  1YJ9 P;  3H25 A;  2YMY A;  4I6M C;  1N73 A;  2QJK C;  2CK3 H;  5KAF E;  1GK6 A;  1EDJ A;  2PFX A;  2AXT E;  3QWO C;  2JDI H;  3CME P;  2Y9Y A;  2KOG A;  3GMA A;  1KB9 E;  4N3Y B;  1M57 D;  1QVG O;  1W2E A;  1NJI Q;  1GL2 A;  5CCG C;  3IR9 A;  5B66 E;  1P84 I;  1N73 B;  2K88 A;  2O01 N;  4KHX A;  5C39 A;  3KYQ A;  3RL0 g;  4I2L C;  2KNC A;  1NU1 E;  1GU4 A;  3RL0 B;  4EI2 A;  1NTM E;  3H32 B;  5KAI E;  1VQO P;  4ZNC A;  1JNM A;  2QJP B;  3IN6 A;  4H0L B;  1EDI A;  1G2C B;  2WWW A;  3AE5 C;  1SQX J;  1J1D B;  3L74 E;  2WZ7 A;  3K5B A;  3H1K G;  3M9H A;  5CCG D;  4IL6 H;  2ZXX A;  1EXI A;  1ZN5 A;  3H1J E;  3MIW A;  3AEE C;  3HD7 D;  3RK2 D;  1YTZ T;  1LTB C;  3ITK A;  2M0B A;  1R5S A;  2YKQ A;  4BRY A;  1RE4 A;  3L75 J;  3CX5 D;  3AEG D;  3VMX A;  2J5U A;  2WU5 D;  2KI7 B;  1H0T A;  2IZ1 A;  1LTG C;  3USS A;  1RY3 A;  1IFI A;  4W7Z A;  1CI6 B;  1T8Z A;  2KZJ A;  2Q1K A;  2Q7C A;  3V2P A;  5KLV K;  1EDL A;  2HFE D;  3F5H A;  3MGN A;  1VQM P;  1S3J A;  1X8Y A;  2BCC E;  3WUT A;  2OQQ A;  1LTI C;  3L72 G;  1QL1 A;  1SQX K;  1SS1 A;  1BGY D;  2ACZ C;  1X22 A;  1L0N J;  2CPB A;  2E42 A;  3M91 A;  1SQV D;  3GF3 A;  1JOC A;  4YTN D;  1ZRT D;  3AE4 D;  2L5G B;  2BS2 C;  1JB0 J;  3RGU A;  5KJ7 A;  1VQ5 P;  3CX5 E;  2R32 A;  3P4S C;  1RF0 C;  1NAY A;  1NGM B;  5H2F H;  5APU A;  3AEF D;  1PP9 J;  1NOH A;  3NMD A;  4DZO A;  3WUU A;  1N86 A;  1SQX D;  5GTH E;  3CCQ P;  2LXB A;  3P4R C;  3JCU H;  2NZ2 A;  1L0N G;  1YQ3 D;  3MZW B;  1Q81 Q;  3L73 E;  5APY A;  3V2Q A;  1YJW P;  4GOE A;  1PPJ G;  2Q3I A;  4JBZ A;  1M1K Q;  1HJ0 A;  1GL2 D;  4LDT A;  1LWU A;  4PD4 H;  3H32 A;  2BEQ D;  2WU5 C;  1FZF A;  3AEF C;  1NTM D;  3BCC G;  1NEN D;  2B87 A;  5AVR B;  1LTT C;  1YBK A;  4M3L A;  3VMA A;  3Q5S A;  2QIW A;  5APT A;  4YSY C;  4I7Z B;  1KZU B;  2FFD B;  4PV1 B;  1AVY A;  2PGD A;  1BE3 G;  2A06 E;  3H1L J;  3H1J D;  2KUB A;  2M3E A;  3E7K A;  3RK2 C;  1J1D C;  3HE4 B;  3II6 A;  2FYN B;  1LP1 A;  3VN0 A;  1CSB A;  4YTM C;  1S5L X;  3H1L G;  1VQ7 P;  1JY2 N;  1RQU A;  1ZLL A;  1KFN A;  1PGQ A;  1SQB K;  3CI9 A;  2IBZ D;  2M5A B;  2IYP A;  1NU1 J;  3CWB D;  3AE3 C;  3CIR C;  2ZT9 B;  3ABV C;  2YXR B;  2W8Z A;  5CCH C;  3BRT B;  1GTW A;  3AE4 C;  4YXD C;  4YSZ C;  3FGA D;  2YIU C; 
#chains in the Genus database with same CATH homology
 3AE8 C;  3AEA D;  2QJK C;  3GF7 A;  3P4Q C;  2BEZ F;  4YSX C;  4YTM D;  1VF5 C;  4YSY D;  3C8V A;  4H44 C;  4IL6 X;  4YXD D;  3SFE C;  3P4R C;  3VR9 D;  4YT0 D;  3VR8 D;  1TU3 F;  2FBW C;  1RQV A;  2H88 D;  3AEG D;  1PV3 A;  3P4P D;  1VL2 A;  2J5U A;  2NZ2 A;  1AJY A;  3D71 A;  1ZOY D;  4H0L C;  1YQ3 D;  4YT0 C;  2D2C C;  3VR8 C;  5C2T C;  4YTP D;  2WU5 D;  3SFD D;  2JP3 A;  2P10 A;  3AEC C;  4TT3 H;  4H13 C;  2H89 D;  3AED C;  3GMA A;  3D6Z A;  3VRA D;  3G9R A;  4I7Z C;  3AE7 C;  5L8R J;  3AEA C;  4U7J A;  2BS3 C;  1UIX A;  2WDV D;  1HJ0 A;  1OW7 A;  4R4L A;  3O6Q A;  2WS3 C;  1HF9 A;  3AE3 D;  3CIR D;  2D2C B;  4H13 B;  4R4M A;  1L0V C;  1PL5 A;  5C3J D;  1ZP0 D;  2JO1 A;  1OMI A;  2WDQ C;  2WU2 C;  2E75 B;  2E74 B;  2BEQ D;  2WU5 C;  1NEK C;  2G8Y A;  1DIP A;  2ACZ D;  1OW8 A;  2G3A A;  2H89 C;  3AEF C;  1R8E A;  3Q5P A;  1ZOY C;  3D70 A;  4H44 B;  2WDR D;  3P4S D;  2WU2 D;  3EWK A;  3R4Y A;  3VRA C;  1NEN D;  2E75 C;  2H88 C;  3VRB D;  2WDR C;  2V7Q J;  3Q5S A;  3AEB D;  3Q1M A;  2WPV B;  2D2C D;  2QIW A;  1NEK D;  5C2T D;  3AE2 D;  4YSY C;  1K05 A;  2K9Y A;  2OQQ A;  1ZP0 C;  2FXP A;  4I7Z B;  2WDQ D;  1NEN C;  3AE7 D;  4PV1 B;  3AEC D;  3D6Y A;  5C3J C;  3AE6 C;  4H44 D;  2WSE J;  3RL0 g;  1ZME C;  1GMJ A;  3GLM A;  2WSF J;  3SFE D;  3VR9 C;  4OGQ B;  1OW6 A;  2ACZ C;  1KQG B;  3VRB C;  1KMI Z;  2QSI A;  1KQF B;  3GF3 A;  4YTN D;  3AE2 C;  1VF5 D;  3SFD C;  4H13 D;  2IDB A;  1U57 A;  4KT0 J;  4OGQ C;  1Q90 D;  2WP9 C;  2E76 C;  3IN6 A;  1NYH A;  1KOR A;  4H0L B;  4PV1 D;  4GDO A;  2B76 D;  5KKZ C;  1DD3 A;  1WMK A;  2E75 D;  3T97 B;  2WQY D;  3AEE D;  3AE4 D;  3S9O A;  1YQ4 C;  1IK7 A;  3AE9 C;  4YSX D;  2BS2 C;  4OGQ D;  5M1B A;  3AE5 C;  1JB0 J;  2MKV A;  4YTM C;  1KTM A;  1S5L X;  2ZT9 D;  3AE6 D;  4KX6 D;  1YQ3 C;  1KFY D;  3AE1 D;  4Y28 J;  2BS4 C;  2FBW D;  1VF5 B;  3IAO A;  1Y9B A;  2E76 B;  3LW5 J;  1FDO A;  1RQU A;  3P4P C;  2ZT9 C;  4KX6 C;  3AE8 D;  1EXI A;  3P4S C;  3RK3 E;  3Q3D A;  4H0L D;  2O01 J;  3AEB C;  2WSC J;  4PV1 C;  2B76 C;  1NGM B;  5KLI C;  3AEE C;  1K04 A;  2YMK A;  2WP9 D;  3AE1 C;  3AED D;  4RKU J;  3ABV D;  1KIL E;  3P4R D;  3AE3 C;  3CIR C;  1ZRT E;  2E74 C;  1QLB C;  2ZT9 B;  3Q5R A;  1EXJ A;  1E7P C;  3ABV C;  1YQ4 D;  2WDV C;  1KF6 C;  2QJP C;  3AE9 D;  3AEF D;  2QJY C;  3AE5 D;  4YSZ D;  1S1C X;  2FYN C;  1KFY C;  3P4Q D;  2E76 D;  1PIX A;  3B71 A;  4Z1M H;  3AEG C;  3H25 A;  3AE4 C;  1L0V D;  3Q2Y A;  1KF6 D;  4YXD C;  4YSZ C;  2WS3 D;  3FGA D;  1MKM A;  2E74 D;  4XFJ A;  4YTP C;  1FDI A;  1DD4 A;  2WQY C;  4YTN C;  2YIU C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...