3AE1C

Crystal structure of porcine heart mitochondrial complex ii bound with n-phenyl-2-(trifluoromethyl)-benzamide
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with N-Phenyl-2-(trifluoromethyl)-benzamide
rcsb
total genus 47
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3ae1C01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3ae1C02
2FBWD 1PV3A 3AEFC 2WDVD 3AE8C 2BS3C 3AE1D 3P4RC 2WU5D 4YTMC 3SFDD 3CIRD 4YTND 1NEKD 2BS2C 3AE5D 3AE6D 3ABVC 5C2TD 1KFYD 3AE4C 1L0VC 1NEND 3AECD 2FBWC 2WDVC 1KTMA 2H88D 1YQ4D 2WDRD 3AE1C 4YT0D 2WU5C 3P4PD 1KF6D 4YTPD 1OW6A 3SFDC 3CIRC 4YTNC 1NEKC 3AE5C 3AE6C 4YSYD 2G3AA 1KFYC 2WS3C 1NENC 3VRBD 3AECC 3AEED 2H88C 1YQ4C 1YQ3D 4YTPC 1ZOYD 3P4PC 4YT0C 1KF6C 4YSZD 3AE9D 3P4SD 3AE7D 2H89D 2WDQD 4YSXD 4YSYC 3VRBC 3AEEC 1E7PC 3AE3D 1OW7A 2WQYD 1YQ3C 4YXDD 3B71A 3AEBD 3VRAD 5C2TC 3SFED 1QLBC 3S9OA 1ZP0D 3AE9C 4YSZC 2WU2D 5C3JD 3VR9D 3P4SC 3AE7C 2H89C 2WDQC 3AEDD 2WDRC 3AEAD 1K05A 3AE3C 3AEGD 2WP9D 4KX6D 3P4QD 2WQYC 4YXDC 3VRAC 1K04A 1ZP0C 2WU2C 5C3JC 3VR9C 3AE2D 3AEDC 3AEAC 3VR8D 2ACZD 1ZOYC 2B76D 3AEFD 2BS4C 3AEGC 2WP9C 3AE8D 3P4QC 4KX6C 2WS3D 3P4RD 4YSXC 4YTMD 3AE2C 1OW8A 3ABVD 3AE4D 3VR8C 1L0VD 3AEBC 2ACZC 3SFEC 2B76C
chains in the Genus database with same CATH superfamily
2IBZI 4XFJA 3AE1D 3L74J 2GA1A 4L75A 1NTKE 4UB8H 2BS2C 2JR8A 2KZJA 1OVRA 3L71E 3AE4C 1ZW0A 1L0VC 1EDLA 3T97A 4ASWA 3M0DC 3V2RA 3A2AA 2V4HA 5CJ4A 3P4PD 1H0TA 3KQGA 4C7NB 4EDFA 1NEKC 1J1EB 5CHXA 4B86A 1JMBA 2BCCE 2H8PD 5APUA 3WMM0 5AVRB 5CBOA 1GL2A 3GMAA 3G3ZA 1KFMA 3RK3B 1KV4A 1RY3A 2YXQB 1OW7A 1YQ3C 3VRAD 4I2LC 5KAIE 3H1LE 1BDDA 1FZCB 1SQBJ 2B88A 3P4QD 2WQYC 1ZN5A 3L74D 2WU2C 1M57D 2V7QJ 1KZUB 2YMKA 3BRTB 2O01H 4I6LA 1SFCA 1H89A 4DJGA 5AW5B 1YTZI 1SQQG 4YTMD 2Q3IA 3L70G 3C8VA 1JB0J 2WSEH 4PV1D 3H1HG 2K3RA 1PP9J 2C9LY 1YIJP 3LW5H 2WU5D 1Z56A 3W68A 4H0LC 2IZ0A 3KZIH 3AE6D 1P84E 2Q9IA 1KILB 1M7LA 5AVXB 1SQPE 3KHUA 1LWUB 3R2PA 3M9QA 1LT1A 1S5LH 1IC2A 3GW6A 3Q2YA 1BSHA 4U3FE 2YKOA 2QJPB 3EFFK 3HUSC 3QWOC 1AVOA 1SQBD 3OAKA 4OVNF 3L75G 1QX8A 2E75B 3AE9D 4W7ZA 2H89D 3P7KA 1KQGB 3ITKA 4KJMA 4XA4A 3VRBC 2W27A 2RKLA 1BE3G 3C9IA 2OARA 3VMAA 4N6JA 3SFED 4JYCA 3CMAP 3OA7A 2NPSD 1QL1A 3RL0B 1VDFA 1PP9D 1N7SD 3TNUA 1AVYA 1LP1A 1FE6A 4DDGA 3IF4A 2KLUA 1LT9A 2JO1A 3AE2D 2P58A 1N86A 1J1EC 3A0BE 1JY2O 2E5YA 1AA0A 2M3EA 1L2PA 3H1IJ 4GIFA 1HGVA 3E1IA 5BU8B 3BCCG 2XNXA 3OW2O 3RK3C 1LTSC 2K9YA 5KKZB 1JCDA 2KSJA 2E43A 2W8ZA 2JP3A 5APQA 4LLHA 3AE5D 3CCSP 1CW5A 4JPZB 1PGPA 3FGAD 1HJ0A 4GDOA 1M1KQ 1N8RQ 1QL2A 2XNDH 3CCRP 1KC8Q 1G2CB 5L8RJ 1GDTA 1VQLP 1E5WA 2R5BA 1NTMJ 3CI9A 4HKZH 2AEFA 1NU1G 3TGUJ 1M1JB 5GTHE 4HJGH 3V4WA 4CPGA 3TK1A 3NFQA 4YXDD 3H1ID 3CC7P 4YSZC 5C3JD 3VR9D 4DCKA 3FWLA 2WDRC 4N78E 1IZNB 2V7QH 3GLMA 1YTZT 2J59M 3I56P 1URQD 1RE3A 4NPFX 3TSIA 2QM8A 3RL0g 1S4XA 3E1RA 3L74E 3LIDA 1HVVA 3B8EB 2E75C 2B87A 1FU1A 4IFFA 4JYBA 1L0LJ 2KNCA 1FC2C 4WY4B 1X9VA 5GTIH 1KQSO 3L35A 4AQRD 1NTMD 2QJYB 1N73B 1N7LA 2RMZA 3TGUD 2H43A 5CCGD 3H1JE 5APVA 3RL0C 2FYZA 1KD1Q 4PJ0E 3II6A 2NZ2A 1KF6D 5AW8B 1GU4A 1IFMA 3L73G 3CCMP 4PD4D 1SQVE 1KFYC 1WT6A 2JKVA 1GL2C 2OTLP 2NRGA 1NTZG 1YQ4C 3FXDA 2L91A 1EZVE 4L73A 1HUCA 1SQQJ 2IPPA 2D2CC 5KKZC 3L70J 1FOSE 3MP7B 3KDPB 3RK3D 3O6QB 3H1HJ 3H1KG 2E74B 3P4SC 3HE4A 3CXHD 3NXSA 5E79H 3B5NB 1K05A 1LTTC 3MHVA 1ZR4A 3S4RA 1L0LD 4D6TG 2WP9D 4KX6D 3Q5PA 2C0WA 1SQXK 4Y99B 1ZP0C 1OX3A 1S5LX 1PP9E 3FXEA 1GK6A 3AEFD 5AVWB 2GUSA 3HTKB 1L0NK 3M06A 4MN4C 1IK9A 1HGZA 4HYTB 3U1AA 1M1JC 1A02J 3L75J 2AEMA 3D6ZA 4I6MC 2BS3C 4ASVA 4WBAA 3FWNA 1RHZB 5CCGA 1K9MQ 4XE5B 4EOTA 1FDOA 1KQFB 1CSBA 1HWTC 1VL2A 1BE3J 5KJ7D 1PGJA 3PH0A 1SQQD 4BWNA 2FBWC 3L70D 4H44C 1JY2P 2WDRD 1KILD 1E79H 5CCHD 3H1HD 1FZBA 1ZMEC 2H7HA 2L5GB 2QJKB 2Q3EA 1RQUA 5APYA 1L4AB 2KS1A 1NAFA 2VRSA 5AW3B 1JM0A 1YITP 2AEJA 4A7PA 1RQVA 1IFJA 1X22A 3MUDA 4EIJA 3AE3D 1Q90D 1VQ9P 3BCCJ 5K5GB 3RK2C 2QJYC 1N73C 2YNYA 1VF5D 3BASA 3L75D 4H13B 3AEGD 3O8ZA 3G71P 1SQXG 1MV8A 3GF3A 1RF0A 3EFGA 1GD2E 1ZV8A 4TT3H 1BE3D 3CCVP 4DZOA 3CXHH 3AE8D 1L0NG 2N1TA 3U1CA 1OW8A 1NGMB 4UB6H 3SWKA 2A06G 3CCUP 4IL6H 1NU1J 2FFDA 3QH9A 2POHA 1RE4A 2E74C 3SWYA 5KJ7A 3Q5RA 1HH0A 4HB1A 3HUSB 2YKQA 2OYOA 3V2NA 1SQQK 3CXHI 3B5NC 1LTJA 1EDIA 1S9KD 4RESB 2JWDA 3BCCD 2C0XA 2DW3A 2WVRA 1NTME 3CIRC 1T8ZA 2YO3A 1IFNA 2IFMA 3AECC 2ZXEB 1LTIC 1S2EA 2B89A 4PD4E 3VMYA 1LTBC 1PGOA 3L72G 1EXIA 2PGDA 2KUBA 2M5AA 3A7OA 2WSFJ 3HD7D 2E76B 4KT0J 3AE7C 2BCCG 2KP8A 4BRYB 1KYOE 3L4FA 2J58A 2ZFCA 4DHIB 3GG2A 3M0AA 3TYYA 2KXPB 1OZHA 5APTA 4NPEA 2OTKE 5AW4B 1NU1D 5APXA 1PPJG 4GOEA 2UWJE 3CCLP 2QJKC 1FZGA 3CX5I 3AEAC 3V5BA 1L0LE 2B76D 1DIPA 3Q1MA 3L73J 1HTLC 1L4AC 2IBZE 1PZQA 1RF1A 5KLVK 3H1LG 5BVZA 2OYHA 1TFFA 1M56D 1NTZJ 3ZDMA 1OVVA 3JSVC 5C39A 2GUVA 2FYUK 3PJSK 1OIPA 3SFDD 2B9BA 2WT7A 4WY4D 2HG5D 4H13C 3H1KJ 2H88D 4UB8E 1BDCA 1YJ9P 4D6TJ 2G3AA 1NENC 3AEED 3PLNA 3B4SA 2N1TB 4YTPC 1SP4A 3H1HE 1A02F 2WDQD 4L76A 4KHXA 4AUWA 2ZYDA 2K9JB 1AQTA 1SQPG 2WITA 3VN0A 3HD7A 3G9RA 1AFOA 1H8AA 1NAYA 2P2UA 2HODB 3L73D 2HPCB 2WPRA 2Y0CA 4EI2A 3AEDD 1TU3F 2QRXA 3CCQP 1NTZD 4N3YB 1U57A 1CI6B 1NU1K 2O1JA 1H88A 4ZMDA 3H25A 4OGQD 1KORA 1IO4A 3VR8D 2ZJSE 1GMJA 2KLVA 3H1KD 3T97B 3MTUE 2WSCJ 5KLVG 1JCCA 1BE3E 1H0TB 3AE4D 3EQ2A 4D6TD 1L0VD 3D70A 2ACZC 1UIIA 3F89A 3GHGA 4QMAA 1FZFA 3WU2H 2FYUG 2E76C 5KAFH 2PRRA 1GTWA 1NEKD 1GL2B 3ABVC 1KMIZ 3A3YB 4FJVA 1S3JA 1ZRTE 1FBMA 1BCCG 2D2CB 4YTNC 3KZIE 2IDBA 2OYIA 1FJKA 1GW3A 5AVZB 1S9KE 1SQXJ 1YQ3D 1BGYG 1S5LE 2QA4P 2N9YB 4YSYC 2R44A 5BU5A 2WSFH 1SLQA 4ZNCA 1L0NJ 2LKMA 1SFCB 2WQYD 4EYYQ 3VOPA 2WU2D 4IL6X 1JNMA 1GU5A 2OGUA 1NTZK 2MJZA 3R4YA 1JTHA 3CC2P 2ZYAA 2KK7A 5CJ0A 2NPSA 3HE5A 2N1TC 4R4MA 1N7SA 4K3AA 4H0LD 4H44B 4HH2A 5DJTB 4JF7A 1SQXD 1RE4C 3NMDA 3L72J 3IAOA 3H32A 2W6AA 1ZXGA 5AW1B 2YO2A 3S1KA 1QGKB 2WDVC 1L0ND 1NJIQ 3TF5A 4LGDE 2BCCJ 2A45I 2J5UA 2YKPA 5KTBA 1JY3N 1KB9I 2XV5A 2CPSA 1M90Q 3VRBD 3P8MC 5AW0B 1VPCA 5APWA 3RK2B 1JOCA 4YT0C 3TNUB 1VQPP 1LP1B 3PTZA 2GM4A 1LT9B 3H1JG 2WTYA 2QG4A 4C7RA 3K5BA 1MFTA 3GF7A 1GW4A 1OXZA 2P7JA 2BEQD 3H1LJ 2QVAA 2LXCB 4GT1A 4PV1B 1SQVG 1EQ7A 3L73E 1IJDB 4NPDA 1VQMP 2A45G 5TISH 1EZVG 3L72D 2WZ7A 1FJPA 1SQBE 1ZLLA 1ZOYC 1FZEA 2WSCH 3RBZA 2FY8A 2BCCD 2K88A 4DDIA 3VYIA 3D71A 2R32A 3UIAA 1URQA 3H1KE 1SFCC 1PPJD 3P4RC 1PIXA 3P32A 1SS1A 1DH3A 1SQPJ 1W5CE 2ZFYA 1VQ6P 4D6TE 3V4QA 2HLOA 3CL3D 3VONA 3HRNA 5EFWB 3AE1C 3H1LD 5GTIE 1FAVA 2XU6A 3WUVA 2W6BA 3KXDA 4RO0A 3P4PC 4Z1MH 4YSZD 3CC4P 4R4LA 3JC22 1HBWA 1YHQP 1W2BO 3CX5D 5CMZA 5KLVJ 2M3BA 4C7NA 3FX0A 1QLBC 1AQ5A 1U7JA 3NTNA 3N4XA 2O01N 2XDJA 1NTKK 2FYUJ 3G4SP 1QLED 2B87B 1VQNP 3VRAC 5AW7B 2E75D 2KNCB 3VTPC 1M8OB 2R5DA 4TLFA 1SQPD 3Q5SA 3MGNA 5E79E 1BCCJ 3P4QC 2XKMA 2PFXA 1DX7A 1LT9C 2HFED 3H1IE 3GHGC 4GKGA 2ZAEB 3BRVB 1FZCA 3I55P 3RL0D 1BGYJ 1PL5A 1G1IA 3LIEA 4YTMC 4JBZA 2E42A 3PP5A 1QVFO 4PV1C 1T2KC 1KFYD 4W7YA 3P8CD 3USSA 2BASA 3M9BA 1GL2D 1YQ4D 2WU5C 5KLVD 1OW6A 2OYIC 3C1LA 2PP6A 3AE6C 5AVVB 2WS3C 3HE4B 1L0NE 4DOJA 2D2CD 3CWBG 2FYUD 5AW2B 1ZOYD 1KILA 3P4SD 2W6JH 5KAIH 5CCHA 1LWUA 5AVUB 1R8EA 2PAJA 2ZT9B 3VP9A 3F5HA 5AVTB 1FS0E 2YXRB 3TGUE 1BCCD 1Y8AA 3B71A 2FKWB 1NTMG 2ZVOB 4WVZA 1ZP0D 3AE9C 2KSEA 5AW6B 2H89C 1FDMA 1NH4A 1NTKG 1NO4A 1BGYD 3L71G 2C9NY 1SQPK 5M1BA 1OVUA 3CX5H 2K37A 1T3UA 2JWAA 2NPSC 1N7SC 1EDKA 2BS4C 2M8RA 1KFNA 3L72E 1NKZB 4IOIH 3AE2C 3RK3E 1K73Q 1P84H 3CCEP 1YJWP 2ITAA 2FBWD 1PV3A 1RE3C 3CXHE 4H44D 1SVFA 3H1JJ 2YIUC 1U7MA 2KS1B 1R5SA 2M0BA 3MD0A 1L0LG 4UB6E 3MIWA 1PPJE 1KTMA 2RN0A 2Q1KA 2IBZG 2AXCA 2Z5IA 3IFMA 4IL6E 1IFPA 1SQVJ 1P84I 2I1KA 4N78D 1PGQA 3AE5C 5APSA 1LTGC 2JEEA 3D6YA 1QVGO 4DHJA 3RK2D 3CCJP 2WMMA 5KLIB 4IFDK 1USEA 4GODA 2WPVB 2MKVA 3BATA 1SQQE 2WPSA 1OMIA 1G2CA 3L70E 1KILE 3A0BH 3CX5E 1T2KD 1NKNA 4YXDC 3H1JD 1M1JA 5C3JC 3VR9C 2FFDB 2HR3A 4U7JA 4ZKPA 1EDJA 1NOHA 4K35A 1MUUA 3V6IA 4U3FG 2WS3D 1GK4A 1LTJB 4YSXC 4O9BA 1SQVD 1ZR2A 2E74D 1URQC 1MKMA 1JO5A 1X8YA 2Y9YA 2ZT9C 5B66H 3B5ND 1USDA 1EZVD 1KB9D 3L75E 3CIRD 4ZKUA 2G8YA 2KYVA 1CZQA 3AECD 2R3CA 3A0HH 4LDTA 1YYCA 2M5AB 2W90A 5AW9B 3P8CE 3MZWB 2JJLA 1JY3O 1VF5B 5CCGC 5GTHH 4WY4A 4AYCA 5KLVE 4M3LA 1VQ7P 3PRJA 3V2PA 1KF6C 1N73A 3AE7D 1FZAA 1VQ4P 1W2EA 2OQQA 2FYUE 2FYNB 1E7PC 3TDKA 2BEZF 1PFIA 3S9OA 3V2QA 2Q7CA 1Y9BA 5CBNA 2QM7A 3BCCE 1RF1B 3AEAD 2Y9ZA 2OYHB 4LC1A 1BCCE 3MUDC 1L4AD 1D7MA 1K04A 2Q6QA 1YI2P 4I1LA 1XTCC 2WWWA 2WT7B 1BGYE 3O6QA 1LJ2A 2WP9C 4KX6C 1SQVK 5B66E 1FZCC 3B5NA 4OWFA 3CWBJ 1RF0C 5KLIC 3AEBC 4H13D 3AEFC 4PJ0H 2LXBA 2FXOA 1LTAC 1SQBK 3A0HE 3VP8A 2HYNA 1NU1E 1NEND 3HTKA 2FXMA 3WU2E 4YTPD 3HD7B 2A45H 3M0DA 5KAFE 1YJNP 3WUUA 3H6PA 4OH8B 1NTKJ 2FFDC 1KB9H 3EWKA 2IZ1A 3L71J 5KJ7C 2SPZA 1VQ8P 1S1CX 1JEKA 1KILC 1DD3A 1LTJC 2ZXXA 5CCHC 4RKUJ 1LWUC 1GZLA 3L74G 4YSXD 2E5TA 1DEEG 1DD4A 1UIXA 2ZT9D 5C2TC 2QJPC 2QSIA 1EZVI 2A06D 1MZ9A 3CWBD 1WRGA 2Y0DA 1L4AA 3AE3C 3W67A 4I7ZB 3GHGB 2IX7C 1EXJA 2O1KA 1VF5C 1N2DC 1JY2N 2ACZD 3AEGC 1T3JA 1FOSF 2E76D 2QEXP 4YXWH 1Q2NA 3VMZA 5H2FH 1IFIA 1NTKD 1HF9A 3CLQA 3ABVD 3PHLA 1IK7A 3E7KA 1Q86Q 1S72P 3JCUH 4WWIA 3L71D 2FYNC 2OYIB 1G1JA 2P10A 3A5TA 3AE8C 1EC5A 1X79B 1J1DB 1NTZE 1AJYA 2KI7B 1SQBG 4YTND 1VQKP 1RF1C 1Q7YQ 2OYHC 1KB9E 2AXTH 4DHZA 1KYOD 2JDIH 1RH5B 3IN6A 1OFCX 3RBXA 2ZYGA 4DT0A 2RH0A 4YSYD 2CK3H 2P67A 1BSNA 2W83C 3CPWO 1PP9G 1NYHA 3HUSA 2Z4EA 1XTGB 1IFDA 2I8DA 4OGQB 1JTHB 4U3FJ 2IBZD 3Q3DA 4C46A 2Z5HA 2WPQA 1Q82Q 3AEBD 2OTJP 2NPSB 1Y47A 1YBKA 3HE5B 1T6AA 1N7SB 2KB7P 3U59A 4GOFA 1VQOP 1JY3P 2N1TD 5B5EH 3HD7C 5AVSB 4BXLA 3BVHA 3L36A 4L74A 1NTMK 3H32B 3I5CA 2I1JA 2YIUB 5H2FE 2IYOA 2IFNA 2P1JA 5TISE 3JCUE 2O01J 1NHLA 4BRYA 1AV1A 2CPBA 1NWQA 2WSSH 1P84D 5AVYB 2B76C 2WDVD 3M9HA 2WSEJ 2KIKA 4JQ0D 1VQ5P 2N9BA 2AXTE 3LW5J 2Y0EA 1FDIA 5C2TD 1KQLA 4U3FD 2Q5UA 4I7ZC 5AVQB 1J2JB 4YT0D 4YPCA 2KZIA 3SFDC 3H1IG 4PD4H 2ZVNB 4WY4C 3KPEA 2H88C 4IFMA 4WB4A 2KOGA 1L0LK 3CMEP 1SQXE 1WMKA 4W80A 3WUTA 3VMXA 1K8AQ 2QIWA 1QEXA 2FXPA 1KYOH 3AEEC 2XZRA 1LNQA 2YMYA 1X0TA 2IYPA 1KN7A 1J1DC 4PD4I 3RGUA 4H0LB 2WDQC 1JUNA 3M91A 3N7NA 1JMMA 5B5EE 2QE7H 3KYQA 3OJAB 3SSUA 1DEBA 2K1AA 1URQB 2A06E 2LR2A 1OWAA 1LGHB 1Q81Q 2K9JA 1KYOI 3G6EP 1NVOA 3CWBE 3AEDC 5DJUB 1ZRTD 4Y28J 1MFZA 2HODA 2HPCA 3TGUG 3L37A 5TJHA 2O3JA 1SFCD 3CD6P 2R3SA 1HJBA 3SWFA 3P4RD 1R5LA 4OGQC 1CI6A 3IR9A 3VR8C 4Y99C 3SFEC 4RJTA
chains in the Genus database with same CATH topology
2FBWD 4H13D 1PV3A 3AEFC 2WDVD 4H44D 2P10A 2WSEJ 3AE8C 4XFJA 2BS3C 1PL5A 3AE1D 1PIXA 2WU5D 3P4RC 4YTMC 2E76C 2JP3A 1AJYA 2YIUC 3SFDD 3CIRD 2E74C 4H0LC 3IAOA 3Q5RA 4YTND 3LW5J 1FDOA 1NEKD 2BS2C 3AE5D 4PV1C 3AE6D 1KQFB 1FDIA 2G8YA 3ABVC 1VL2A 5C2TD 1KFYD 3AE4C 3FGAD 1L0VC 1NEND 3AECD 1KMIZ 2FBWC 4H13C 4I7ZC 2WDVC 1KTMA 1HJ0A 4H44C 2H88D 1YQ4D 2WDRD 1ZRTE 2NZ2A 3AE1C 4YT0D 2WU5C 3P4PD 1KF6D 4YTPD 4GDOA 1OW6A 3IN6A 3SFDC 3CIRC 1ZMEC 2D2CB 4YTNC 1NEKC 2J5UA 2IDBA 3AE5C 3AE6C 3Q2YA 3EWKA 4YSYD 1VF5B 2G3AA 1KFYC 2WS3C 1NENC 3VRBD 3AECC 3AEED 2D2CD 1S1CX 1RQUA 2H88C 1YQ4C 5L8RJ 1DD3A 3D6YA 1YQ3D 4YTPC 1ZOYD 3P4PC 1NYHA 1KF6C 4YT0C 4Z1MH 2E75B 4YSZD 3AE9D 4RKUJ 1WMKA 3GMAA 3P4SD 3AE7D 2H89D 4OGQB 2WDQD 1RQVA 2QIWA 4YSXD 2FXPA 4R4LA 4YSYC 1KQGB 1R8EA 2OQQA 2ZT9B 3Q3DA 1EXIA 3VRBC 3AEEC 2D2CC 1DD4A 5KKZC 3GF7A 1Q90D 1E7PC 3AE3D 3G9RA 2BEZF 2BEQD 2WPVB 1OW7A 2MKVA 1UIXA 1YQ3C 2WQYD 4YXDD 3B71A 3AEBD 3VRAD 2ZT9D 2WSFJ 5C2TC 2E76B 3SFED 2QJPC 2QSIA 1QLBC 4KT0J 3S9OA 1ZP0D 3AE9C 4YSZC 2WU2D 2E74B 5C3JD 1OMIA 1Y9BA 3AE7C 4H0LB 4IL6X 2H89C 3P4SC 3VR9D 2WDQC 1KILE 4PV1B 2QJYC 3AEDD 1VF5D 1TU3F 2WDRC 3AEAD 1K05A 1U57A 3AE3C 4H13B 4I7ZB 3AEGD 2WP9D 4KX6D 3P4QD 2WQYC 3R4YA 3Q5PA 3GLMA 4YXDC 3VRAC 5M1BA 3GF3A 2E75D 1K04A 1ZP0C 1EXJA 3H25A 2WU2C 5C3JC 3VR9C 2JO1A 3AE2D 4OGQD 2V7QJ 3Q5SA 2QJKC 1KORA 2YMKA 3AEDC 4TT3H 1VF5C 1S5LX 3AEAC 3VR8D 4Y28J 1ZOYC 2ACZD 1GMJA 4U7JA 3O6QA 2B76D 3RL0g 3AEFD 2BS4C 1DIPA 3AEGC 2WP9C 3Q1MA 3AE8D 3P4QC 4KX6C 2WS3D 3P4RD 4R4MA 2O01J 4YSXC 4YTMD 3T97B 2E76D 2E75C 3C8VA 2E74D 4H0LD 1JB0J 3AE2C 3D71A 4OGQC 3RK3E 1HF9A 2WSCJ 4PV1D 1OW8A 1MKMA 4H44B 3ABVD 1NGMB 1IK7A 5KLIC 3AE4D 3VR8C 1L0VD 3AEBC 3D70A 2ZT9C 2ACZC 2FYNC 3SFEC 2K9YA 3D6ZA 2B76C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FBW D;  1PV3 A;  3AEF C;  2WDV D;  3AE8 C;  2BS3 C;  3AE1 D;  3P4R C;  2WU5 D;  4YTM C;  3SFD D;  3CIR D;  4YTN D;  1NEK D;  2BS2 C;  3AE5 D;  3AE6 D;  3ABV C;  5C2T D;  1KFY D;  3AE4 C;  1L0V C;  1NEN D;  3AEC D;  2FBW C;  2WDV C;  1KTM A;  2H88 D;  1YQ4 D;  2WDR D;  3AE1 C;  4YT0 D;  2WU5 C;  3P4P D;  1KF6 D;  4YTP D;  1OW6 A;  3SFD C;  3CIR C;  4YTN C;  1NEK C;  3AE5 C;  3AE6 C;  4YSY D;  2G3A A;  1KFY C;  2WS3 C;  1NEN C;  3VRB D;  3AEC C;  3AEE D;  2H88 C;  1YQ4 C;  1YQ3 D;  4YTP C;  1ZOY D;  3P4P C;  4YT0 C;  1KF6 C;  4YSZ D;  3AE9 D;  3P4S D;  3AE7 D;  2H89 D;  2WDQ D;  4YSX D;  4YSY C;  3VRB C;  3AEE C;  1E7P C;  3AE3 D;  1OW7 A;  2WQY D;  1YQ3 C;  4YXD D;  3B71 A;  3AEB D;  3VRA D;  5C2T C;  3SFE D;  1QLB C;  3S9O A;  1ZP0 D;  3AE9 C;  4YSZ C;  2WU2 D;  5C3J D;  3VR9 D;  3P4S C;  3AE7 C;  2H89 C;  2WDQ C;  3AED D;  2WDR C;  3AEA D;  1K05 A;  3AE3 C;  3AEG D;  2WP9 D;  4KX6 D;  3P4Q D;  2WQY C;  4YXD C;  3VRA C;  1K04 A;  1ZP0 C;  2WU2 C;  5C3J C;  3VR9 C;  3AE2 D;  3AED C;  3AEA C;  3VR8 D;  2ACZ D;  1ZOY C;  2B76 D;  3AEF D;  2BS4 C;  3AEG C;  2WP9 C;  3AE8 D;  3P4Q C;  4KX6 C;  2WS3 D;  3P4R D;  4YSX C;  4YTM D;  3AE2 C;  1OW8 A;  3ABV D;  3AE4 D;  3VR8 C;  1L0V D;  3AEB C;  2ACZ C;  3SFE C;  2B76 C; 
#chains in the Genus database with same CATH topology
 2IBZ I;  4XFJ A;  3AE1 D;  3L74 J;  2GA1 A;  4L75 A;  1NTK E;  4UB8 H;  2BS2 C;  2JR8 A;  2KZJ A;  1OVR A;  3L71 E;  3AE4 C;  1ZW0 A;  1L0V C;  1EDL A;  3T97 A;  4ASW A;  3M0D C;  3V2R A;  3A2A A;  2V4H A;  5CJ4 A;  3P4P D;  1H0T A;  3KQG A;  4C7N B;  4EDF A;  1NEK C;  1J1E B;  5CHX A;  4B86 A;  1JMB A;  2BCC E;  2H8P D;  5APU A;  3WMM 0;  5AVR B;  5CBO A;  1GL2 A;  3GMA A;  3G3Z A;  1KFM A;  3RK3 B;  1KV4 A;  1RY3 A;  2YXQ B;  1OW7 A;  1YQ3 C;  3VRA D;  4I2L C;  5KAI E;  3H1L E;  1BDD A;  1FZC B;  1SQB J;  2B88 A;  3P4Q D;  2WQY C;  1ZN5 A;  3L74 D;  2WU2 C;  1M57 D;  2V7Q J;  1KZU B;  2YMK A;  3BRT B;  2O01 H;  4I6L A;  1SFC A;  1H89 A;  4DJG A;  5AW5 B;  1YTZ I;  1SQQ G;  4YTM D;  2Q3I A;  3L70 G;  3C8V A;  1JB0 J;  2WSE H;  4PV1 D;  3H1H G;  2K3R A;  1PP9 J;  2C9L Y;  1YIJ P;  3LW5 H;  2WU5 D;  1Z56 A;  3W68 A;  4H0L C;  2IZ0 A;  3KZI H;  3AE6 D;  1P84 E;  2Q9I A;  1KIL B;  1M7L A;  5AVX B;  1SQP E;  3KHU A;  1LWU B;  3R2P A;  3M9Q A;  1LT1 A;  1S5L H;  1IC2 A;  3GW6 A;  3Q2Y A;  1BSH A;  4U3F E;  2YKO A;  2QJP B;  3EFF K;  3HUS C;  3QWO C;  1AVO A;  1SQB D;  3OAK A;  4OVN F;  3L75 G;  1QX8 A;  2E75 B;  3AE9 D;  4W7Z A;  2H89 D;  3P7K A;  1KQG B;  3ITK A;  4KJM A;  4XA4 A;  3VRB C;  2W27 A;  2RKL A;  1BE3 G;  3C9I A;  2OAR A;  3VMA A;  4N6J A;  3SFE D;  4JYC A;  3CMA P;  3OA7 A;  2NPS D;  1QL1 A;  3RL0 B;  1VDF A;  1PP9 D;  1N7S D;  3TNU A;  1AVY A;  1LP1 A;  1FE6 A;  4DDG A;  3IF4 A;  2KLU A;  1LT9 A;  2JO1 A;  3AE2 D;  2P58 A;  1N86 A;  1J1E C;  3A0B E;  1JY2 O;  2E5Y A;  1AA0 A;  2M3E A;  1L2P A;  3H1I J;  4GIF A;  1HGV A;  3E1I A;  5BU8 B;  3BCC G;  2XNX A;  3OW2 O;  3RK3 C;  1LTS C;  2K9Y A;  5KKZ B;  1JCD A;  2KSJ A;  2E43 A;  2W8Z A;  2JP3 A;  5APQ A;  4LLH A;  3AE5 D;  3CCS P;  1CW5 A;  4JPZ B;  1PGP A;  3FGA D;  1HJ0 A;  4GDO A;  1M1K Q;  1N8R Q;  1QL2 A;  2XND H;  3CCR P;  1KC8 Q;  1G2C B;  5L8R J;  1GDT A;  1VQL P;  1E5W A;  2R5B A;  1NTM J;  3CI9 A;  4HKZ H;  2AEF A;  1NU1 G;  3TGU J;  1M1J B;  5GTH E;  4HJG H;  3V4W A;  4CPG A;  3TK1 A;  3NFQ A;  4YXD D;  3H1I D;  3CC7 P;  4YSZ C;  5C3J D;  3VR9 D;  4DCK A;  3FWL A;  2WDR C;  4N78 E;  1IZN B;  2V7Q H;  3GLM A;  1YTZ T;  2J59 M;  3I56 P;  1URQ D;  1RE3 A;  4NPF X;  3TSI A;  2QM8 A;  3RL0 g;  1S4X A;  3E1R A;  3L74 E;  3LID A;  1HVV A;  3B8E B;  2E75 C;  2B87 A;  1FU1 A;  4IFF A;  4JYB A;  1L0L J;  2KNC A;  1FC2 C;  4WY4 B;  1X9V A;  5GTI H;  1KQS O;  3L35 A;  4AQR D;  1NTM D;  2QJY B;  1N73 B;  1N7L A;  2RMZ A;  3TGU D;  2H43 A;  5CCG D;  3H1J E;  5APV A;  3RL0 C;  2FYZ A;  1KD1 Q;  4PJ0 E;  3II6 A;  2NZ2 A;  1KF6 D;  5AW8 B;  1GU4 A;  1IFM A;  3L73 G;  3CCM P;  4PD4 D;  1SQV E;  1KFY C;  1WT6 A;  2JKV A;  1GL2 C;  2OTL P;  2NRG A;  1NTZ G;  1YQ4 C;  3FXD A;  2L91 A;  1EZV E;  4L73 A;  1HUC A;  1SQQ J;  2IPP A;  2D2C C;  5KKZ C;  3L70 J;  1FOS E;  3MP7 B;  3KDP B;  3RK3 D;  3O6Q B;  3H1H J;  3H1K G;  2E74 B;  3P4S C;  3HE4 A;  3CXH D;  3NXS A;  5E79 H;  3B5N B;  1K05 A;  1LTT C;  3MHV A;  1ZR4 A;  3S4R A;  1L0L D;  4D6T G;  2WP9 D;  4KX6 D;  3Q5P A;  2C0W A;  1SQX K;  4Y99 B;  1ZP0 C;  1OX3 A;  1S5L X;  1PP9 E;  3FXE A;  1GK6 A;  3AEF D;  5AVW B;  2GUS A;  3HTK B;  1L0N K;  3M06 A;  4MN4 C;  1IK9 A;  1HGZ A;  4HYT B;  3U1A A;  1M1J C;  1A02 J;  3L75 J;  2AEM A;  3D6Z A;  4I6M C;  2BS3 C;  4ASV A;  4WBA A;  3FWN A;  1RHZ B;  5CCG A;  1K9M Q;  4XE5 B;  4EOT A;  1FDO A;  1KQF B;  1CSB A;  1HWT C;  1VL2 A;  1BE3 J;  5KJ7 D;  1PGJ A;  3PH0 A;  1SQQ D;  4BWN A;  2FBW C;  3L70 D;  4H44 C;  1JY2 P;  2WDR D;  1KIL D;  1E79 H;  5CCH D;  3H1H D;  1FZB A;  1ZME C;  2H7H A;  2L5G B;  2QJK B;  2Q3E A;  1RQU A;  5APY A;  1L4A B;  2KS1 A;  1NAF A;  2VRS A;  5AW3 B;  1JM0 A;  1YIT P;  2AEJ A;  4A7P A;  1RQV A;  1IFJ A;  1X22 A;  3MUD A;  4EIJ A;  3AE3 D;  1Q90 D;  1VQ9 P;  3BCC J;  5K5G B;  3RK2 C;  2QJY C;  1N73 C;  2YNY A;  1VF5 D;  3BAS A;  3L75 D;  4H13 B;  3AEG D;  3O8Z A;  3G71 P;  1SQX G;  1MV8 A;  3GF3 A;  1RF0 A;  3EFG A;  1GD2 E;  1ZV8 A;  4TT3 H;  1BE3 D;  3CCV P;  4DZO A;  3CXH H;  3AE8 D;  1L0N G;  2N1T A;  3U1C A;  1OW8 A;  1NGM B;  4UB6 H;  3SWK A;  2A06 G;  3CCU P;  4IL6 H;  1NU1 J;  2FFD A;  3QH9 A;  2POH A;  1RE4 A;  2E74 C;  3SWY A;  5KJ7 A;  3Q5R A;  1HH0 A;  4HB1 A;  3HUS B;  2YKQ A;  2OYO A;  3V2N A;  1SQQ K;  3CXH I;  3B5N C;  1LTJ A;  1EDI A;  1S9K D;  4RES B;  2JWD A;  3BCC D;  2C0X A;  2DW3 A;  2WVR A;  1NTM E;  3CIR C;  1T8Z A;  2YO3 A;  1IFN A;  2IFM A;  3AEC C;  2ZXE B;  1LTI C;  1S2E A;  2B89 A;  4PD4 E;  3VMY A;  1LTB C;  1PGO A;  3L72 G;  1EXI A;  2PGD A;  2KUB A;  2M5A A;  3A7O A;  2WSF J;  3HD7 D;  2E76 B;  4KT0 J;  3AE7 C;  2BCC G;  2KP8 A;  4BRY B;  1KYO E;  3L4F A;  2J58 A;  2ZFC A;  4DHI B;  3GG2 A;  3M0A A;  3TYY A;  2KXP B;  1OZH A;  5APT A;  4NPE A;  2OTK E;  5AW4 B;  1NU1 D;  5APX A;  1PPJ G;  4GOE A;  2UWJ E;  3CCL P;  2QJK C;  1FZG A;  3CX5 I;  3AEA C;  3V5B A;  1L0L E;  2B76 D;  1DIP A;  3Q1M A;  3L73 J;  1HTL C;  1L4A C;  2IBZ E;  1PZQ A;  1RF1 A;  5KLV K;  3H1L G;  5BVZ A;  2OYH A;  1TFF A;  1M56 D;  1NTZ J;  3ZDM A;  1OVV A;  3JSV C;  5C39 A;  2GUV A;  2FYU K;  3PJS K;  1OIP A;  3SFD D;  2B9B A;  2WT7 A;  4WY4 D;  2HG5 D;  4H13 C;  3H1K J;  2H88 D;  4UB8 E;  1BDC A;  1YJ9 P;  4D6T J;  2G3A A;  1NEN C;  3AEE D;  3PLN A;  3B4S A;  2N1T B;  4YTP C;  1SP4 A;  3H1H E;  1A02 F;  2WDQ D;  4L76 A;  4KHX A;  4AUW A;  2ZYD A;  2K9J B;  1AQT A;  1SQP G;  2WIT A;  3VN0 A;  3HD7 A;  3G9R A;  1AFO A;  1H8A A;  1NAY A;  2P2U A;  2HOD B;  3L73 D;  2HPC B;  2WPR A;  2Y0C A;  4EI2 A;  3AED D;  1TU3 F;  2QRX A;  3CCQ P;  1NTZ D;  4N3Y B;  1U57 A;  1CI6 B;  1NU1 K;  2O1J A;  1H88 A;  4ZMD A;  3H25 A;  4OGQ D;  1KOR A;  1IO4 A;  3VR8 D;  2ZJS E;  1GMJ A;  2KLV A;  3H1K D;  3T97 B;  3MTU E;  2WSC J;  5KLV G;  1JCC A;  1BE3 E;  1H0T B;  3AE4 D;  3EQ2 A;  4D6T D;  1L0V D;  3D70 A;  2ACZ C;  1UII A;  3F89 A;  3GHG A;  4QMA A;  1FZF A;  3WU2 H;  2FYU G;  2E76 C;  5KAF H;  2PRR A;  1GTW A;  1NEK D;  1GL2 B;  3ABV C;  1KMI Z;  3A3Y B;  4FJV A;  1S3J A;  1ZRT E;  1FBM A;  1BCC G;  2D2C B;  4YTN C;  3KZI E;  2IDB A;  2OYI A;  1FJK A;  1GW3 A;  5AVZ B;  1S9K E;  1SQX J;  1YQ3 D;  1BGY G;  1S5L E;  2QA4 P;  2N9Y B;  4YSY C;  2R44 A;  5BU5 A;  2WSF H;  1SLQ A;  4ZNC A;  1L0N J;  2LKM A;  1SFC B;  2WQY D;  4EYY Q;  3VOP A;  2WU2 D;  4IL6 X;  1JNM A;  1GU5 A;  2OGU A;  1NTZ K;  2MJZ A;  3R4Y A;  1JTH A;  3CC2 P;  2ZYA A;  2KK7 A;  5CJ0 A;  2NPS A;  3HE5 A;  2N1T C;  4R4M A;  1N7S A;  4K3A A;  4H0L D;  4H44 B;  4HH2 A;  5DJT B;  4JF7 A;  1SQX D;  1RE4 C;  3NMD A;  3L72 J;  3IAO A;  3H32 A;  2W6A A;  1ZXG A;  5AW1 B;  2YO2 A;  3S1K A;  1QGK B;  2WDV C;  1L0N D;  1NJI Q;  3TF5 A;  4LGD E;  2BCC J;  2A45 I;  2J5U A;  2YKP A;  5KTB A;  1JY3 N;  1KB9 I;  2XV5 A;  2CPS A;  1M90 Q;  3VRB D;  3P8M C;  5AW0 B;  1VPC A;  5APW A;  3RK2 B;  1JOC A;  4YT0 C;  3TNU B;  1VQP P;  1LP1 B;  3PTZ A;  2GM4 A;  1LT9 B;  3H1J G;  2WTY A;  2QG4 A;  4C7R A;  3K5B A;  1MFT A;  3GF7 A;  1GW4 A;  1OXZ A;  2P7J A;  2BEQ D;  3H1L J;  2QVA A;  2LXC B;  4GT1 A;  4PV1 B;  1SQV G;  1EQ7 A;  3L73 E;  1IJD B;  4NPD A;  1VQM P;  2A45 G;  5TIS H;  1EZV G;  3L72 D;  2WZ7 A;  1FJP A;  1SQB E;  1ZLL A;  1ZOY C;  1FZE A;  2WSC H;  3RBZ A;  2FY8 A;  2BCC D;  2K88 A;  4DDI A;  3VYI A;  3D71 A;  2R32 A;  3UIA A;  1URQ A;  3H1K E;  1SFC C;  1PPJ D;  3P4R C;  1PIX A;  3P32 A;  1SS1 A;  1DH3 A;  1SQP J;  1W5C E;  2ZFY A;  1VQ6 P;  4D6T E;  3V4Q A;  2HLO A;  3CL3 D;  3VON A;  3HRN A;  5EFW B;  3AE1 C;  3H1L D;  5GTI E;  1FAV A;  2XU6 A;  3WUV A;  2W6B A;  3KXD A;  4RO0 A;  3P4P C;  4Z1M H;  4YSZ D;  3CC4 P;  4R4L A;  3JC2 2;  1HBW A;  1YHQ P;  1W2B O;  3CX5 D;  5CMZ A;  5KLV J;  2M3B A;  4C7N A;  3FX0 A;  1QLB C;  1AQ5 A;  1U7J A;  3NTN A;  3N4X A;  2O01 N;  2XDJ A;  1NTK K;  2FYU J;  3G4S P;  1QLE D;  2B87 B;  1VQN P;  3VRA C;  5AW7 B;  2E75 D;  2KNC B;  3VTP C;  1M8O B;  2R5D A;  4TLF A;  1SQP D;  3Q5S A;  3MGN A;  5E79 E;  1BCC J;  3P4Q C;  2XKM A;  2PFX A;  1DX7 A;  1LT9 C;  2HFE D;  3H1I E;  3GHG C;  4GKG A;  2ZAE B;  3BRV B;  1FZC A;  3I55 P;  3RL0 D;  1BGY J;  1PL5 A;  1G1I A;  3LIE A;  4YTM C;  4JBZ A;  2E42 A;  3PP5 A;  1QVF O;  4PV1 C;  1T2K C;  1KFY D;  4W7Y A;  3P8C D;  3USS A;  2BAS A;  3M9B A;  1GL2 D;  1YQ4 D;  2WU5 C;  5KLV D;  1OW6 A;  2OYI C;  3C1L A;  2PP6 A;  3AE6 C;  5AVV B;  2WS3 C;  3HE4 B;  1L0N E;  4DOJ A;  2D2C D;  3CWB G;  2FYU D;  5AW2 B;  1ZOY D;  1KIL A;  3P4S D;  2W6J H;  5KAI H;  5CCH A;  1LWU A;  5AVU B;  1R8E A;  2PAJ A;  2ZT9 B;  3VP9 A;  3F5H A;  5AVT B;  1FS0 E;  2YXR B;  3TGU E;  1BCC D;  1Y8A A;  3B71 A;  2FKW B;  1NTM G;  2ZVO B;  4WVZ A;  1ZP0 D;  3AE9 C;  2KSE A;  5AW6 B;  2H89 C;  1FDM A;  1NH4 A;  1NTK G;  1NO4 A;  1BGY D;  3L71 G;  2C9N Y;  1SQP K;  5M1B A;  1OVU A;  3CX5 H;  2K37 A;  1T3U A;  2JWA A;  2NPS C;  1N7S C;  1EDK A;  2BS4 C;  2M8R A;  1KFN A;  3L72 E;  1NKZ B;  4IOI H;  3AE2 C;  3RK3 E;  1K73 Q;  1P84 H;  3CCE P;  1YJW P;  2ITA A;  2FBW D;  1PV3 A;  1RE3 C;  3CXH E;  4H44 D;  1SVF A;  3H1J J;  2YIU C;  1U7M A;  2KS1 B;  1R5S A;  2M0B A;  3MD0 A;  1L0L G;  4UB6 E;  3MIW A;  1PPJ E;  1KTM A;  2RN0 A;  2Q1K A;  2IBZ G;  2AXC A;  2Z5I A;  3IFM A;  4IL6 E;  1IFP A;  1SQV J;  1P84 I;  2I1K A;  4N78 D;  1PGQ A;  3AE5 C;  5APS A;  1LTG C;  2JEE A;  3D6Y A;  1QVG O;  4DHJ A;  3RK2 D;  3CCJ P;  2WMM A;  5KLI B;  4IFD K;  1USE A;  4GOD A;  2WPV B;  2MKV A;  3BAT A;  1SQQ E;  2WPS A;  1OMI A;  1G2C A;  3L70 E;  1KIL E;  3A0B H;  3CX5 E;  1T2K D;  1NKN A;  4YXD C;  3H1J D;  1M1J A;  5C3J C;  3VR9 C;  2FFD B;  2HR3 A;  4U7J A;  4ZKP A;  1EDJ A;  1NOH A;  4K35 A;  1MUU A;  3V6I A;  4U3F G;  2WS3 D;  1GK4 A;  1LTJ B;  4YSX C;  4O9B A;  1SQV D;  1ZR2 A;  2E74 D;  1URQ C;  1MKM A;  1JO5 A;  1X8Y A;  2Y9Y A;  2ZT9 C;  5B66 H;  3B5N D;  1USD A;  1EZV D;  1KB9 D;  3L75 E;  3CIR D;  4ZKU A;  2G8Y A;  2KYV A;  1CZQ A;  3AEC D;  2R3C A;  3A0H H;  4LDT A;  1YYC A;  2M5A B;  2W90 A;  5AW9 B;  3P8C E;  3MZW B;  2JJL A;  1JY3 O;  1VF5 B;  5CCG C;  5GTH H;  4WY4 A;  4AYC A;  5KLV E;  4M3L A;  1VQ7 P;  3PRJ A;  3V2P A;  1KF6 C;  1N73 A;  3AE7 D;  1FZA A;  1VQ4 P;  1W2E A;  2OQQ A;  2FYU E;  2FYN B;  1E7P C;  3TDK A;  2BEZ F;  1PFI A;  3S9O A;  3V2Q A;  2Q7C A;  1Y9B A;  5CBN A;  2QM7 A;  3BCC E;  1RF1 B;  3AEA D;  2Y9Z A;  2OYH B;  4LC1 A;  1BCC E;  3MUD C;  1L4A D;  1D7M A;  1K04 A;  2Q6Q A;  1YI2 P;  4I1L A;  1XTC C;  2WWW A;  2WT7 B;  1BGY E;  3O6Q A;  1LJ2 A;  2WP9 C;  4KX6 C;  1SQV K;  5B66 E;  1FZC C;  3B5N A;  4OWF A;  3CWB J;  1RF0 C;  5KLI C;  3AEB C;  4H13 D;  3AEF C;  4PJ0 H;  2LXB A;  2FXO A;  1LTA C;  1SQB K;  3A0H E;  3VP8 A;  2HYN A;  1NU1 E;  1NEN D;  3HTK A;  2FXM A;  3WU2 E;  4YTP D;  3HD7 B;  2A45 H;  3M0D A;  5KAF E;  1YJN P;  3WUU A;  3H6P A;  4OH8 B;  1NTK J;  2FFD C;  1KB9 H;  3EWK A;  2IZ1 A;  3L71 J;  5KJ7 C;  2SPZ A;  1VQ8 P;  1S1C X;  1JEK A;  1KIL C;  1DD3 A;  1LTJ C;  2ZXX A;  5CCH C;  4RKU J;  1LWU C;  1GZL A;  3L74 G;  4YSX D;  2E5T A;  1DEE G;  1DD4 A;  1UIX A;  2ZT9 D;  5C2T C;  2QJP C;  2QSI A;  1EZV I;  2A06 D;  1MZ9 A;  3CWB D;  1WRG A;  2Y0D A;  1L4A A;  3AE3 C;  3W67 A;  4I7Z B;  3GHG B;  2IX7 C;  1EXJ A;  2O1K A;  1VF5 C;  1N2D C;  1JY2 N;  2ACZ D;  3AEG C;  1T3J A;  1FOS F;  2E76 D;  2QEX P;  4YXW H;  1Q2N A;  3VMZ A;  5H2F H;  1IFI A;  1NTK D;  1HF9 A;  3CLQ A;  3ABV D;  3PHL A;  1IK7 A;  3E7K A;  1Q86 Q;  1S72 P;  3JCU H;  4WWI A;  3L71 D;  2FYN C;  2OYI B;  1G1J A;  2P10 A;  3A5T A;  3AE8 C;  1EC5 A;  1X79 B;  1J1D B;  1NTZ E;  1AJY A;  2KI7 B;  1SQB G;  4YTN D;  1VQK P;  1RF1 C;  1Q7Y Q;  2OYH C;  1KB9 E;  2AXT H;  4DHZ A;  1KYO D;  2JDI H;  1RH5 B;  3IN6 A;  1OFC X;  3RBX A;  2ZYG A;  4DT0 A;  2RH0 A;  4YSY D;  2CK3 H;  2P67 A;  1BSN A;  2W83 C;  3CPW O;  1PP9 G;  1NYH A;  3HUS A;  2Z4E A;  1XTG B;  1IFD A;  2I8D A;  4OGQ B;  1JTH B;  4U3F J;  2IBZ D;  3Q3D A;  4C46 A;  2Z5H A;  2WPQ A;  1Q82 Q;  3AEB D;  2OTJ P;  2NPS B;  1Y47 A;  1YBK A;  3HE5 B;  1T6A A;  1N7S B;  2KB7 P;  3U59 A;  4GOF A;  1VQO P;  1JY3 P;  2N1T D;  5B5E H;  3HD7 C;  5AVS B;  4BXL A;  3BVH A;  3L36 A;  4L74 A;  1NTM K;  3H32 B;  3I5C A;  2I1J A;  2YIU B;  5H2F E;  2IYO A;  2IFN A;  2P1J A;  5TIS E;  3JCU E;  2O01 J;  1NHL A;  4BRY A;  1AV1 A;  2CPB A;  1NWQ A;  2WSS H;  1P84 D;  5AVY B;  2B76 C;  2WDV D;  3M9H A;  2WSE J;  2KIK A;  4JQ0 D;  1VQ5 P;  2N9B A;  2AXT E;  3LW5 J;  2Y0E A;  1FDI A;  5C2T D;  1KQL A;  4U3F D;  2Q5U A;  4I7Z C;  5AVQ B;  1J2J B;  4YT0 D;  4YPC A;  2KZI A;  3SFD C;  3H1I G;  4PD4 H;  2ZVN B;  4WY4 C;  3KPE A;  2H88 C;  4IFM A;  4WB4 A;  2KOG A;  1L0L K;  3CME P;  1SQX E;  1WMK A;  4W80 A;  3WUT A;  3VMX A;  1K8A Q;  2QIW A;  1QEX A;  2FXP A;  1KYO H;  3AEE C;  2XZR A;  1LNQ A;  2YMY A;  1X0T A;  2IYP A;  1KN7 A;  1J1D C;  4PD4 I;  3RGU A;  4H0L B;  2WDQ C;  1JUN A;  3M91 A;  3N7N A;  1JMM A;  5B5E E;  2QE7 H;  3KYQ A;  3OJA B;  3SSU A;  1DEB A;  2K1A A;  1URQ B;  2A06 E;  2LR2 A;  1OWA A;  1LGH B;  1Q81 Q;  2K9J A;  1KYO I;  3G6E P;  1NVO A;  3CWB E;  3AED C;  5DJU B;  1ZRT D;  4Y28 J;  1MFZ A;  2HOD A;  2HPC A;  3TGU G;  3L37 A;  5TJH A;  2O3J A;  1SFC D;  3CD6 P;  2R3S A;  1HJB A;  3SWF A;  3P4R D;  1R5L A;  4OGQ C;  1CI6 A;  3IR9 A;  3VR8 C;  4Y99 C;  3SFE C;  4RJT A; 
#chains in the Genus database with same CATH homology
 2FBW D;  4H13 D;  1PV3 A;  3AEF C;  2WDV D;  4H44 D;  2P10 A;  2WSE J;  3AE8 C;  4XFJ A;  2BS3 C;  1PL5 A;  3AE1 D;  1PIX A;  2WU5 D;  3P4R C;  4YTM C;  2E76 C;  2JP3 A;  1AJY A;  2YIU C;  3SFD D;  3CIR D;  2E74 C;  4H0L C;  3IAO A;  3Q5R A;  4YTN D;  3LW5 J;  1FDO A;  1NEK D;  2BS2 C;  3AE5 D;  4PV1 C;  3AE6 D;  1KQF B;  1FDI A;  2G8Y A;  3ABV C;  1VL2 A;  5C2T D;  1KFY D;  3AE4 C;  3FGA D;  1L0V C;  1NEN D;  3AEC D;  1KMI Z;  2FBW C;  4H13 C;  4I7Z C;  2WDV C;  1KTM A;  1HJ0 A;  4H44 C;  2H88 D;  1YQ4 D;  2WDR D;  1ZRT E;  2NZ2 A;  3AE1 C;  4YT0 D;  2WU5 C;  3P4P D;  1KF6 D;  4YTP D;  4GDO A;  1OW6 A;  3IN6 A;  3SFD C;  3CIR C;  1ZME C;  2D2C B;  4YTN C;  1NEK C;  2J5U A;  2IDB A;  3AE5 C;  3AE6 C;  3Q2Y A;  3EWK A;  4YSY D;  1VF5 B;  2G3A A;  1KFY C;  2WS3 C;  1NEN C;  3VRB D;  3AEC C;  3AEE D;  2D2C D;  1S1C X;  1RQU A;  2H88 C;  1YQ4 C;  5L8R J;  1DD3 A;  3D6Y A;  1YQ3 D;  4YTP C;  1ZOY D;  3P4P C;  1NYH A;  1KF6 C;  4YT0 C;  4Z1M H;  2E75 B;  4YSZ D;  3AE9 D;  4RKU J;  1WMK A;  3GMA A;  3P4S D;  3AE7 D;  2H89 D;  4OGQ B;  2WDQ D;  1RQV A;  2QIW A;  4YSX D;  2FXP A;  4R4L A;  4YSY C;  1KQG B;  1R8E A;  2OQQ A;  2ZT9 B;  3Q3D A;  1EXI A;  3VRB C;  3AEE C;  2D2C C;  1DD4 A;  5KKZ C;  3GF7 A;  1Q90 D;  1E7P C;  3AE3 D;  3G9R A;  2BEZ F;  2BEQ D;  2WPV B;  1OW7 A;  2MKV A;  1UIX A;  1YQ3 C;  2WQY D;  4YXD D;  3B71 A;  3AEB D;  3VRA D;  2ZT9 D;  2WSF J;  5C2T C;  2E76 B;  3SFE D;  2QJP C;  2QSI A;  1QLB C;  4KT0 J;  3S9O A;  1ZP0 D;  3AE9 C;  4YSZ C;  2WU2 D;  2E74 B;  5C3J D;  1OMI A;  1Y9B A;  3AE7 C;  4H0L B;  4IL6 X;  2H89 C;  3P4S C;  3VR9 D;  2WDQ C;  1KIL E;  4PV1 B;  2QJY C;  3AED D;  1VF5 D;  1TU3 F;  2WDR C;  3AEA D;  1K05 A;  1U57 A;  3AE3 C;  4H13 B;  4I7Z B;  3AEG D;  2WP9 D;  4KX6 D;  3P4Q D;  2WQY C;  3R4Y A;  3Q5P A;  3GLM A;  4YXD C;  3VRA C;  5M1B A;  3GF3 A;  2E75 D;  1K04 A;  1ZP0 C;  1EXJ A;  3H25 A;  2WU2 C;  5C3J C;  3VR9 C;  2JO1 A;  3AE2 D;  4OGQ D;  2V7Q J;  3Q5S A;  2QJK C;  1KOR A;  2YMK A;  3AED C;  4TT3 H;  1VF5 C;  1S5L X;  3AEA C;  3VR8 D;  4Y28 J;  1ZOY C;  2ACZ D;  1GMJ A;  4U7J A;  3O6Q A;  2B76 D;  3RL0 g;  3AEF D;  2BS4 C;  1DIP A;  3AEG C;  2WP9 C;  3Q1M A;  3AE8 D;  3P4Q C;  4KX6 C;  2WS3 D;  3P4R D;  4R4M A;  2O01 J;  4YSX C;  4YTM D;  3T97 B;  2E76 D;  2E75 C;  3C8V A;  2E74 D;  4H0L D;  1JB0 J;  3AE2 C;  3D71 A;  4OGQ C;  3RK3 E;  1HF9 A;  2WSC J;  4PV1 D;  1OW8 A;  1MKM A;  4H44 B;  3ABV D;  1NGM B;  1IK7 A;  5KLI C;  3AE4 D;  3VR8 C;  1L0V D;  3AEB C;  3D70 A;  2ZT9 C;  2ACZ C;  2FYN C;  3SFE C;  2K9Y A;  3D6Z A;  2B76 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...