3AE1C

Crystal structure of porcine heart mitochondrial complex ii bound with n-phenyl-2-(trifluoromethyl)-benzamide
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with N-Phenyl-2-(trifluoromethyl)-benzamide
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 47
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3ae1C01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3ae1C02
3AEAC 4YTND 1E7PC 2WU2D 3AECD 2WP9C 1PV3A 1OW6A 1YQ4D 4YTNC 3AE5C 3AE6D 2BS3C 3VRBD 2WU2C 3AECC 2BS4C 3VR8C 4KX6D 1KTMA 3P4SC 1OW8A 3AE1C 3AE6C 2WS3C 2B76D 1KF6D 3P4PD 2WDRC 3SFDD 2G3AA 4YSYD 1KFYD 3AE2D 2BS2C 3P4QD 1NEND 5C2TC 3AEDC 4YSZD 3ABVD 4YT0D 2H88C 3AEBD 3SFDC 4YTMC 3SFED 1YQ3C 3AE4D 3AEFD 1ZOYD 3P4RD 2H89D 2WDVD 1K04A 4YSZC 1L0VD 4YT0C 2WU5D 1ZOYC 2WDVC 2FBWD 1YQ4C 4YXDD 3VRBC 3VRAD 3AEGD 4KX6C 1NEKD 2FBWC 4YXDC 1OW7A 3VRAC 3CIRD 2B76C 1KF6C 3P4PC 4YSXD 3AEGC 2ACZD 3AEED 4YSYC 1KFYC 3AE2C 3S9OA 3P4QC 1NENC 3AE3D 3AE7D 4YTPD 3ABVC 3AEAD 3AEBC 3B71A 2WDQD 3SFEC 3AEEC 3AE4C 3AEFC 3P4RC 2H89C 2WQYD 3AE3C 4YTPC 3AE8D 1L0VC 3AE5D 2WDQC 2WU5C 3AE9D 3VR8D 3VR9D 1ZP0D 2WQYC 3AE8C 5C3JD 3P4SD 3AE1D 1QLBC 1NEKC 2WS3D 3AE9C 2WDRD 3VR9C 1ZP0C 3CIRC 4YSXC 5C2TD 1K05A 3AEDD 5C3JC 2ACZC 2H88D 4YTMD 2WP9D 1YQ3D 3AE7C
chains in the Genus database with same CATH superfamily
4W80A 3AEAC 4HYTB 1BSNA 4H0LD 1M1KQ 1YTZT 2K3RA 1L0NK 4DOJA 1K9MQ 4JPZB 4H44D 2BS4C 2OARA 4KX6D 2QRXA 3H32B 1P84I 1NTMG 2WS3C 2WDRC 4YSYD 3L71J 2ZT9D 1GMJA 3E1RA 3TDKA 4YT0D 1RE4A 1L0ND 5E79E 2H43A 2H7HA 3PLNA 4JYBA 1H88A 4U3FE 1KV4A 1L0VD 5E79H 2KNCA 3L74J 1RH5B 3TGUE 5KTBA 4WVZA 1KMIZ 1KILE 1M57D 4U3FD 3HE5B 2CK3H 3TGUD 1G2CA 2KK7A 3VRAC 3AEED 3A0BE 2O1KA 3M9BA 1N8RQ 3P4QC 1T3JA 1NTZG 1UIXA 1GK6A 3S4RA 4IOIH 1N7SC 3A0BH 3W67A 4AYCA 3M9HA 1IK9A 1S2EA 1L4AB 2HPCB 3HE4B 1FZGA 4BRYA 4BWNA 3D70A 4U7JA 5CCHA 1NU1G 2WWWA 1SQXE 2E43A 2GM4A 1LT9A 1S9KE 2IBZI 3AE9C 3HUSB 1ZP0C 4I6LA 2ACZC 3GHGB 1K73Q 3HD7C 1OVVA 3S1KA 1NAYA 1LGHB 1FZEA 3CWBG 1D7MA 1J1EC 2M0BA 1HUCA 4JBZA 1ZRTE 3VRBD 1JM0A 2WU2C 3AECC 1M90Q 2ITAA 3L72G 4RKUJ 2AXCA 2MKVA 2E76B 2I8DA 3H32A 3L70E 1PIXA 3A0HE 1NEND 2PGDA 3IFMA 1JCCA 2H88C 3A0HH 1YQ3C 3B5ND 1W2BO 1K04A 2KIKA 3H1JJ 1M1JC 2A06E 2NPSC 3CX5D 4OH8B 2QVAA 2ZYAA 4GT1A 3V2RA 2FBWD 3MIWA 2AEMA 2A06D 4K3AA 1NEKD 1RQVA 1IJDB 2QJKB 4YXDC 4GOEA 1IFIA 4ZMDA 1WMKA 1PL5A 3KPEA 5EFWB 1GL2C 3LW5J 2WT7B 1ZN5A 3L75D 5AW1B 1IO4A 1ZMEC 2OYIC 2H89C 3FX0A 4Z1MH 3AE5D 1L4AA 1HVVA 3I55P 1GK4A 3AE1D 1NTKG 1QLBC 1Q86Q 4EI2A 4JF7A 3L70J 3HUSA 1KB9E 2V7QJ 1W2EA 4NPFX 2WP9D 1PGOA 1LTJB 3AE7C 2W27A 3MTUE 3GHGA 3P32A 1KB9H 1OFCX 4WY4A 2OYHA 1KB9D 2E5YA 3WUTA 3A2AA 1IFMA 1A02F 4H0LB 1SVFA 5AW9B 2IZ0A 3PTZA 4H44B 3W68A 4D6TG 2ZVNB 1GW4A 2BS2C 3VMAA 3M91A 3P7KA 1AV1A 1Q90D 2ZT9B 1EZVG 1NO4A 3V4WA 3OAKA 2FFDB 1RF0C 1NTME 3H1IG 1X0TA 2O3JA 2WDVC 2GA1A 3V4QA 3SWYA 5CCGC 5KAFE 5APUA 1VF5D 5KAFH 4ZNCA 3F5HA 4YTPD 5AVWB 1H0TA 2WT7A 4DHZA 2WQYD 1QVFO 5BU5A 1LTIC 3O6QB 3FWLA 3P4SD 1DEBA 3KHUA 3G4SP 2R3CA 1GD2E 4UB6E 3ZDMA 3RK2D 5CCHD 4DDGA 3L73G 3CLQA 1SQBG 2OGUA 3VYIA 3NFQA 1L0LG 1FJPA 2OQQA 1NTMJ 4JQ0D 1H8AA 1N2DC 5APVA 1JEKA 3GF7A 3C9IA 3VMYA 2A45G 3CC2P 1T2KD 3CWBE 1PPJG 2E76C 3T97B 3ABVD 1GU5A 2W6AA 3NXSA 1FZAA 1EZVI 4YSZC 3B5NB 2JWAA 5KLVE 1PGJA 2K9YA 2XKMA 3TF5A 1NTZJ 2QJYB 4OGQD 5BU8B 3RK3D 2JKVA 1NU1J 2FY8A 4FJVA 3N4XA 3HRNA 2ZYDA 3H1HD 2B88A 1Q2NA 3M9QA 2P7JA 3H1JG 1JUNA 4N6JA 1KFMA 1BCCD 1VDFA 1NVOA 3KDPB 1TFFA 2AEJA 2JO1A 2FKWB 1IC2A 3Q5RA 3CWBJ 2BCCD 2YXRB 2KZJA 2WITA 3LIEA 1IK7A 2KLUA 1XTGB 2FYUK 1JY3O 1SQQK 4KT0J 1AQ5A 2FYNB 1LTJC 1E7PC 3L72J 3H1KG 4PD4D 4DCKA 2W6JH 1JTHB 5AVRB 2IZ1A 2Y0CA 5CBNA 2JJLA 3VP9A 2BS3C 4H0LC 1QEXA 1SQQD 2M3EA 2A45I 4H44C 1VQ5P 1RF1A 1SQPG 3D71A 4K35A 2KSJA 3AEBD 1QLED 4PV1C 2ZT9C 4YT0C 1DH3A 2FFDC 2FXPA 3RL0g 4EDFA 1M56D 3B5NA 1HBWA 3O8ZA 1YQ4C 3L4FA 3H25A 1NKZB 3CXHE 2PFXA 2KOGA 5AW6B 4GDOA 1LTSC 4GIFA 4EIJA 3VN0A 4DHIB 3CXHH 2MJZA 4YSXD 1JY2O 3B8EB 1VF5B 1KFYC 3S9OA 2J5UA 2WDQD 3AEEC 1NTKJ 2ZFCA 1G2CB 1VQLP 1XTCC 1JB0J 3VOPA 1YTZI 2R5BA 3KYQA 2YKOA 2WU5C 5AW7B 3OA7A 1KYOD 3F89A 1OVUA 3L71E 3GMAA 1URQD 1SLQA 5CMZA 2RMZA 1YITP 2LKMA 2PP6A 2QG4A 5C2TD 3L71D 4BRYB 3FXEA 1KQFB 1KQGB 3RK2B 1KZUB 3GLMA 2Q3IA 1KD1Q 1S5LE 5TISE 3CI9A 3WMM0 2PAJA 1S5LH 1LT9B 2I1KA 4D6TJ 4DHJA 5TISH 3L74D 1PV3A 3L73E 3BCCD 1JTHA 1X22A 1SQBE 3E7KA 1OIPA 1PP9D 1L0LE 3PRJA 1VQPP 3H1IJ 3AE2D 1NHLA 4NPDA 2G8YA 3L37A 3P4RD 1WT6A 2WVRA 2W90A 1E5WA 4R4LA 2JDIH 1PPJE 1HGVA 1OMIA 2P58A 5APWA 3NMDA 5AW5B 2M5AB 4OVNF 2Z5IA 2FBWC 2JWDA 3CIRD 2B76C 2QJYC 5KAIE 5KKZB 3RK3B 1H89A 2C0XA 3I5CA 5KAIH 2XZRA 3CX5I 4N3YB 3AEFC 1NWQA 2YKQA 4ASWA 5KJ7C 3L73J 1W5CE 1RE3A 1KILD 1SQBJ 4LDTA 1M1JA 1L0LJ 1HWTC 2Q9IA 2E75D 2IFMA 1SQXK 3A7OA 3H1JE 1R5LA 1USDA 4YTND 2WP9C 2C9NY 2ZYGA 2XV5A 1Q82Q 2Q1KA 3VR8C 1SQXD 1A02J 3VMXA 5K5GB 2R3SA 1BE3G 2Y9ZA 1S9KD 1DX7A 2XU6A 4WY4B 4HJGH 2OYHB 3AEDC 3LW5H 1IFNA 3CCEP 2R44A 2QJPB 1AA0A 3CCMP 3IN6A 3R4YA 1ZRTD 2YIUB 1CI6A 4W7YA 1R5SA 1RE4C 2D2CD 2M5AA 2E5TA 4WB4A 3MZWB 3D6YA 1P84E 3L70D 2V7QH 4HH2A 1CZQA 1N7LA 2JP3A 1VF5C 2L5GB 5TJHA 3AEAD 1VL2A 4N78E 1VQ4P 1P84H 3CMEP 2E74C 3U1AA 1X79B 4YTPC 3RL0C 2WTYA 4L74A 4XFJA 1TU3F 4I7ZB 1JY3P 4O9BA 2WQYC 4IL6X 2WS3D 2WDRD 1H0TB 3H1KJ 5APXA 1YIJP 1AVOA 1URQB 2P10A 1CSBA 3KQGA 4H13C 4Y99C 1PZQA 1FBMA 3RK2C 3WUUA 5CCHC 1RHZB 1BGYG 2IPPA 1IFDA 2OTJP 1LT9C 1FS0E 2BCCG 1AJYA 1SQPJ 3M0DA 3MUDA 3CC4P 1S3JA 1ZLLA 5KLIB 1Q81Q 1CW5A 1FE6A 2G3AA 4MN4C 1LWUA 3P4QD 2IBZE 3U1CA 1BDDA 5AVYB 1OWAA 2YMYA 1T2KC 1VQOP 4YTMC 1N7SD 1DEEG 1ZOYD 2IBZD 3G3ZA 1NGMB 2FYUG 2YMKA 1JY2P 1VQNP 2HLOA 2IDBA 3CL3D 3RGUA 2KZIA 3FGAD 1NOHA 1SP4A 3H1LG 2W8ZA 1FZCB 1NTMK 1KF6C 2ACZD 4TLFA 1KC8Q 2WSCH 3IF4A 1YJWP 5KKZC 3RK3C 4KHXA 3SFEC 5GTHE 4HB1A 3G71P 2ZXEB 3CCVP 1NTMD 1GU4A 3MHVA 5GTHH 2O01J 1ZV8A 3VR9D 2K9JA 2WMMA 2Z4EA 2N1TA 3GF3A 4L75A 1KILB 2KXPB 2W83C 3VP8A 2AXTE 5AW8B 1VQ6P 2E75B 2H88D 4OWFA 2CPSA 4ZKUA 1YQ3D 2AXTH 1URQA 1EDKA 3QH9A 1L4AC 1ZXGA 4XE5B 4GOFA 4LLHA 3P8CE 2WZ7A 2NPSD 3EWKA 1EQ7A 1NTZE 5DJTB 1FAVA 2P2UA 3HUSC 1SQVG 1NU1E 4BXLA 3WUVA 2WSCJ 1S4XA 3GHGC 4WY4C 2OYHC 1GL2D 4PD4I 3BCCG 1S1CX 2H89D 5CJ4A 1BE3E 2WPSA 1GTWA 5C39A 1PP9G 2QJPC 1YBKA 3FWNA 1EDJA 1RF1B 5M1BA 3LIDA 1E79H 1GZLA 3NTNA 2YIUC 5KLVK 3P4PC 1USEA 3CWBD 2RKLA 1FZCA 2D2CB 3L72E 3AE3D 3AE7D 5AVUB 1FOSF 3KXDA 3GG2A 3BVHA 3AE4C 3L72D 1EC5A 3D6ZA 3BATA 5AVXB 5KLVD 2WDQC 1L0NG 5AW0B 2C0WA 1VQKP 4I7ZC 2QJKC 2Q6QA 3V2QA 3Q3DA 1KILA 1J2JB 1K05A 4U3FG 2HODB 3TGUG 2R32A 3TYYA 3USSA 1KYOI 1BE3J 2W6BA 2NZ2A 4ASVA 3Q5PA 2JEEA 1ZR4A 2YKPA 3SSUA 2FXMA 5KLIC 1BGYE 1HJ0A 1N73A 3CMAP 3SFDD 3OJAB 1Y8AA 3TK1A 1NTKE 2POHA 1KQLA 1SQXG 5AW4B 1N7SB 2J59M 1YJNP 1YHQP 4DJGA 1YI2P 1Y9BA 1JY3N 2KYVA 3AEGD 2B87B 4KX6C 3QWOC 1OW7A 1KORA 1YYCA 1GDTA 1J1DB 3V6IA 2QM7A 5B5EE 4YSYC 4I1LA 2HYNA 4D6TE 3I56P 3G6EP 2Y0EA 3WU2E 5B5EH 2HR3A 2QEXP 3H1LE 1IFPA 1SFCA 3CCSP 1WRGA 3WU2H 5AVSB 1L0VC 4D6TD 1GW3A 2KLVA 1EZVE 1HGZA 3H6PA 1PGQA 4WBAA 3CXHD 3H1IE 3R2PA 4DDIA 1BGYJ 1KQSO 2E76D 2WSEJ 3MP7B 3H1ID 2A06G 2KS1A 2BCCJ 2E75C 2YNYA 4Y28J 2N1TD 3EFFK 1JY2N 2HODA 2LXCB 2YXQB 3Q2YA 1M1JB 1N86A 1VQMP 2KP8A 1K8AQ 4YTNC 2FYZA 3L75G 1QX8A 1LNQA 4IFFA 1OW8A 1MFTA 3EQ2A 2FYUJ 1SQQJ 5CBOA 1S5LX 1SQBK 3PHLA 1L0LK 1SQVE 2J58A 1DIPA 3H1LJ 4L73A 2OYIB 1EDIA 2O1JA 2V4HA 3HTKA 1N7SA 2B9BA 3L73D 1PFIA 3VRBC 1SQBD 2IX7C 1EXIA 1L0LD 2B87A 5APYA 3IAOA 3JSVC 1HTLC 1NENC 1JOCA 3B5NC 2A45H 1CI6B 3AE8D 4JYCA 5APTA 3HD7A 3P8MC 1PPJD 4A7PA 1QVGO 5C3JD 1MKMA 2QA4P 2N9BA 1NEKC 3BRVB 1LTGC 4OGQB 1EDLA 4DZOA 2M8RA 1L0NE 3N7NA 2Y0DA 4PV1D 1LTAC 1EXJA 4GODA 1SQVJ 2M3BA 4YPCA 2L91A 3TNUA 1JO5A 1FZFA 1OW6A 1YQ4D 5AW2B 3AE5C 3AE6D 1S72P 3MD0A 3EFGA 2IYOA 1HJBA 1DD3A 2NPSA 1HF9A 3BCCJ 1KTMA 3AE1C 1LP1A 2DW3A 3Q1MA 1KFYD 1PP9J 1MZ9A 3FXDA 2CPBA 1FJKA 2FYNC 3H1JD 4C46A 1PGPA 1OXZA 4WWIA 1MUUA 2XNXA 1GL2A 2B89A 1JMMA 2H8PD 2WU5D 1Y47A 1ZOYC 4QMAA 1LWUB 2OYIA 3H1KE 3L36A 1KB9I 3H1KD 1SQPK 3MGNA 1J1DC 1L0NJ 2YO2A 1U57A 4L76A 1VQ8P 3PJSK 4GKGA 2KI7B 1FZBA 4AUWA 1SQPE 1G1JA 4M3LA 2AEFA 4EOTA 3TSIA 3SWFA 4U3FJ 1RY3A 1SQPD 1RQUA 4RO0A 2XNDH 2N9YB 3TGUJ 2IYPA 1JMBA 1SFCD 1FU1A 3VR9C 1P84D 5KLVG 4N78D 3IR9A 1FOSE 2K9JB 2WPRA 2BEZF 1RE3C 2N1TB 2FXOA 1ZW0A 3CX5E 3G9RA 2RN0A 4YXWH 4AQRD 1RF0A 3CX5H 3VTPC 3P4SC 3H1HG 1SQXJ 2WSSH 2B76D 1SS1A 4C7NB 5CCGA 1YJ9P 1AFOA 3HE5A 1BCCG 3L75E 4IL6E 3VMZA 4LGDE 1NKNA 3UIAA 3AEFD 4IL6H 5CJ0A 2QSIA 3Q5SA 1U7MA 5KJ7D 2IFNA 2O01H 3VRAD 2HPCA 3HE4A 2KUBA 2HFED 1UIIA 4NPEA 2WPVB 3K5BA 3ABVC 1SQQG 2P67A 5APSA 5L8RJ 3AE3C 3AE9D 3VR8D 4IFMA 1ZP0D 1OVRA 2GUVA 4C7RA 2OYOA 5AVQB 4IFDK 3HD7D 4OGQC 3AEDD 3CCRP 2WSFH 3L75J 3V2PA 1FDOA 2WU2D 4PV1B 3AECD 4W7ZA 3BRTB 1R8EA 2YO3A 2OTKE 3SWKA 1IFJA 1KFNA 4B86A 3B4SA 1M8OB 1NTZK 1T3UA 1G1IA 2ZJSE 4C7NA 3SFDC 3L35A 2E74D 1NU1K 3MUDC 3M0DC 3II6A 3BASA 3P8CD 3RL0D 1OX3A 3L71G 2K88A 1N73B 1NTZD 4YXDD 2SPZA 1LWUC 1NU1D 2WSFJ 3L74G 2Y9YA 3A3YB 4I2LC 3AEGC 4H13D 2XDJA 3V5BA 1AVYA 1FDMA 1LTBC 2ZAEB 3AEBC 3B71A 2GUSA 4HKZH 4UB6H 5CHXA 1VQ7P 1BE3D 3A5TA 1VQ9P 2UWJE 4CPGA 3C8VA 2VRSA 4RESB 1X8YA 1LTJA 3CC7P 4R4MA 3RBXA 3OW2O 5GTIE 3ITKA 4YSXC 1SFCB 3M0AA 2NRGA 3VONA 5GTIH 4YTMD 1JNMA 2R5DA 1X9VA 5APQA 1QGKB 2N1TC 3CXHI 2FFDA 2KS1B 1HH0A 1LTTC 5AW3B 3RK3E 1KF6D 2QE7H 1URQC 5DJUB 3CCJP 1LT1A 5C2TC 4ZKPA 3CCQP 1M7LA 3SFED 1QL1A 1IZNB 2WDVD 3H1HE 3JCUE 5CCGD 5B66E 3M06A 1BCCE 1NTKK 4RJTA 2PRRA 3JCUH 2BASA 3PP5A 3V2NA 5B66H 2BEQD 2BCCE 2HG5D 1BGYD 1T8ZA 2WSEH 1KN7A 1QL2A 3O6QA 3AE2C 1FDIA 3HTKB 1NTKD 1L4AD 4PJ0E 2OTLP 4PD4E 3P4RC 4PJ0H 1JCDA 2KSEA 1BSHA 4PD4H 2E42A 2FYUE 5KLVJ 3AE8C 1SQQE 1FZCC 3PH0A 2K37A 2ZFYA 1FC2C 1Q7YQ 2FYUD 4WY4D 3CIRC 5C3JC 1T6AA 1MV8A 3HD7B 4TT3H 3U59A 2I1JA 1J1EB 3H1LD 3H1HJ 3T97A 3L70G 2WPQA 5AVZB 3CCLP 2O01N 1BCCJ 1EZVD 3CCUP 1KILC 2JR8A 3KZIE 3AE6C 3P4PD 1ZR2A 3KZIH 3TNUB 4KJMA 1OZHA 4YSZD 2ZVOB 3C1LA 2KNCB 3CPWO 3AE4D 2NPSB 1NYHA 4I6MC 4EYYQ 2E74B 3RL0B 1LP1B 1KYOE 1DD4A 3JC22 1N73C 1VPCA 1MFZA 2LR2A 5BVZA 3GW6A 2Q7CA 5H2FE 1SQVK 1KYOH 5KJ7A 4UB8E 2Q3EA 4LC1A 1AQTA 1NAFA 5H2FH 2Z5HA 1GL2B 4XA4A 4UB8H 1L2PA 2ZXXA 4H13B 2LXBA 1NJIQ 4Y99B 2QM8A 2QIWA 1SQVD 2C9LY 3L74E 1RF1C 4DT0A 3CD6P 3BCCE 1Z56A 2KB7P 3RBZA 2P1JA 2IBZG 1NH4A 1PP9E 3E1IA 1U7JA 5AVTB 1BDCA 2D2CC 2Q5UA 5AVVB 1LJ2A 2K1AA 1SFCC 2RH0A
chains in the Genus database with same CATH topology
4KT0J 3AEAC 1FDOA 1EXJA 4YTND 1E7PC 2OQQA 2BEZF 2WU2D 3EWKA 4PV1B 3AECD 4H0LD 2WP9C 3Q2YA 2NZ2A 3G9RA 1PV3A 1OW6A 1YQ4D 1AJYA 4YTNC 3AE5C 4H0LB 3Q5PA 1R8EA 2BS3C 1ZRTE 3AE6D 3VRBD 2WU2C 3AECC 4H44D 2BS4C 3VR8C 4KX6D 4H0LC 1DD3A 3GF7A 1HF9A 4RKUJ 1KTMA 4H44B 3P4SC 1OW8A 3AE1C 2MKVA 3AE6C 5KLIC 1HJ0A 3RK3E 2E76B 1KF6D 2B76D 2WS3C 3P4PD 4H44C 2WDRC 3SFDD 2WSCJ 2G3AA 4YSYD 3Q1MA 1KFYD 1PIXA 2E76C 3AE2D 3T97B 2BS2C 1S5LX 3P4QD 2ZT9D 1NEND 5C2TC 3AEDC 3D71A 4YSZD 1GMJA 3ABVD 4YT0D 2H88C 2FYNC 1Q90D 3AEBD 3SFDC 2ZT9B 3SFED 1YQ3C 4YTMC 2G8YA 4PV1C 1S1CX 1ZOYD 3AE4D 2E74D 2H89D 3AEFD 2WDVD 2ZT9C 3P4RD 1K04A 1DIPA 4YSZC 1NGMB 1NYHA 3IN6A 2YMKA 3R4YA 1L0VD 4YT0C 2QJPC 2QSIA 2FXPA 2E74B 4R4LA 3Q5SA 3RL0g 2IDBA 2WU5D 1Y9BA 1ZOYC 5M1BA 1KMIZ 1KILE 2K9YA 1YQ4C 1DD4A 1OMIA 3FGAD 2FBWD 2WDVC 4YXDD 3VRBC 3VRAD 3H25A 3AEGD 4KX6C 1NEKD 2BEQD 1RQVA 4GDOA 2YIUC 1EXIA 1VF5D 2D2CD 2FBWC 4YXDC 2WSFJ 1OW7A 1KORA 3IAOA 4OGQD 3VRAC 3CIRD 2B76C 1KF6C 2QJYC 1WMKA 3P4PC 4YSXD 3AEGC 2ACZD 2WPVB 4H13D 1VF5B 2D2CB 3D6YA 1PL5A 1KFYC 3AEED 4YSYC 3O6QA 3AE2C 3S9OA 1FDIA 2JP3A 3LW5J 1NENC 1VF5C 3P4QC 3AE3D 3AE7D 4YTPD 1UIXA 3ABVC 2J5UA 4H13B 1VL2A 1U57A 3AEAD 5KKZC 3AEBC 3B71A 2WDQD 3SFEC 3AEEC 2QIWA 3AE4C 3AEFC 5L8RJ 1ZMEC 2E74C 2H89C 3P4RC 3D6ZA 2WQYD 3AE3C 4YTPC 3AE8D 4Z1MH 3D70A 1JB0J 4U7JA 1L0VC 3C8VA 3AE5D 2WDQC 2O01J 2WU5C 3AE9D 3VR8D 4XFJA 1TU3F 4I7ZB 4R4MA 1ZP0D 2WQYC 3VR9D 1RQUA 3AE8C 5C3JD 4I7ZC 1MKMA 3GF3A 3P4SD 4IL6X 2QJKC 3AE1D 1QLBC 1NEKC 2WS3D 3GMAA 3AE9C 4OGQB 2WDRD 2JO1A 2E75D 3Q5RA 2D2CC 2E76D 1ZP0C 3VR9C 4OGQC 2WSEJ 3Q3DA 3CIRC 4YSXC 5C2TD 1K05A 1IK7A 3AEDD 5C3JC 2P10A 2E75B 2ACZC 1KQFB 4H13C 2H88D 1KQGB 2V7QJ 3GLMA 4YTMD 2WP9D 2E75C 4TT3H 1YQ3D 4Y28J 3AE7C 4PV1D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AEA C;  4YTN D;  1E7P C;  2WU2 D;  3AEC D;  2WP9 C;  1PV3 A;  1OW6 A;  1YQ4 D;  4YTN C;  3AE5 C;  3AE6 D;  2BS3 C;  3VRB D;  2WU2 C;  3AEC C;  2BS4 C;  3VR8 C;  4KX6 D;  1KTM A;  3P4S C;  1OW8 A;  3AE1 C;  3AE6 C;  2WS3 C;  2B76 D;  1KF6 D;  3P4P D;  2WDR C;  3SFD D;  2G3A A;  4YSY D;  1KFY D;  3AE2 D;  2BS2 C;  3P4Q D;  1NEN D;  5C2T C;  3AED C;  4YSZ D;  3ABV D;  4YT0 D;  2H88 C;  3AEB D;  3SFD C;  4YTM C;  3SFE D;  1YQ3 C;  3AE4 D;  3AEF D;  1ZOY D;  3P4R D;  2H89 D;  2WDV D;  1K04 A;  4YSZ C;  1L0V D;  4YT0 C;  2WU5 D;  1ZOY C;  2WDV C;  2FBW D;  1YQ4 C;  4YXD D;  3VRB C;  3VRA D;  3AEG D;  4KX6 C;  1NEK D;  2FBW C;  4YXD C;  1OW7 A;  3VRA C;  3CIR D;  2B76 C;  1KF6 C;  3P4P C;  4YSX D;  3AEG C;  2ACZ D;  3AEE D;  4YSY C;  1KFY C;  3AE2 C;  3S9O A;  3P4Q C;  1NEN C;  3AE3 D;  3AE7 D;  4YTP D;  3ABV C;  3AEA D;  3AEB C;  3B71 A;  2WDQ D;  3SFE C;  3AEE C;  3AE4 C;  3AEF C;  3P4R C;  2H89 C;  2WQY D;  3AE3 C;  4YTP C;  3AE8 D;  1L0V C;  3AE5 D;  2WDQ C;  2WU5 C;  3AE9 D;  3VR8 D;  3VR9 D;  1ZP0 D;  2WQY C;  3AE8 C;  5C3J D;  3P4S D;  3AE1 D;  1QLB C;  1NEK C;  2WS3 D;  3AE9 C;  2WDR D;  3VR9 C;  1ZP0 C;  3CIR C;  4YSX C;  5C2T D;  1K05 A;  3AED D;  5C3J C;  2ACZ C;  2H88 D;  4YTM D;  2WP9 D;  1YQ3 D;  3AE7 C; 
#chains in the Genus database with same CATH topology
 4W80 A;  3AEA C;  4HYT B;  1BSN A;  4H0L D;  1M1K Q;  1YTZ T;  2K3R A;  1L0N K;  4DOJ A;  1K9M Q;  4JPZ B;  4H44 D;  2BS4 C;  2OAR A;  4KX6 D;  2QRX A;  3H32 B;  1P84 I;  1NTM G;  2WS3 C;  2WDR C;  4YSY D;  3L71 J;  2ZT9 D;  1GMJ A;  3E1R A;  3TDK A;  4YT0 D;  1RE4 A;  1L0N D;  5E79 E;  2H43 A;  2H7H A;  3PLN A;  4JYB A;  1H88 A;  4U3F E;  1KV4 A;  1L0V D;  5E79 H;  2KNC A;  3L74 J;  1RH5 B;  3TGU E;  5KTB A;  4WVZ A;  1KMI Z;  1KIL E;  1M57 D;  4U3F D;  3HE5 B;  2CK3 H;  3TGU D;  1G2C A;  2KK7 A;  3VRA C;  3AEE D;  3A0B E;  2O1K A;  3M9B A;  1N8R Q;  3P4Q C;  1T3J A;  1NTZ G;  1UIX A;  1GK6 A;  3S4R A;  4IOI H;  1N7S C;  3A0B H;  3W67 A;  4AYC A;  3M9H A;  1IK9 A;  1S2E A;  1L4A B;  2HPC B;  3HE4 B;  1FZG A;  4BRY A;  4BWN A;  3D70 A;  4U7J A;  5CCH A;  1NU1 G;  2WWW A;  1SQX E;  2E43 A;  2GM4 A;  1LT9 A;  1S9K E;  2IBZ I;  3AE9 C;  3HUS B;  1ZP0 C;  4I6L A;  2ACZ C;  3GHG B;  1K73 Q;  3HD7 C;  1OVV A;  3S1K A;  1NAY A;  1LGH B;  1FZE A;  3CWB G;  1D7M A;  1J1E C;  2M0B A;  1HUC A;  4JBZ A;  1ZRT E;  3VRB D;  1JM0 A;  2WU2 C;  3AEC C;  1M90 Q;  2ITA A;  3L72 G;  4RKU J;  2AXC A;  2MKV A;  2E76 B;  2I8D A;  3H32 A;  3L70 E;  1PIX A;  3A0H E;  1NEN D;  2PGD A;  3IFM A;  1JCC A;  2H88 C;  3A0H H;  1YQ3 C;  3B5N D;  1W2B O;  1K04 A;  2KIK A;  3H1J J;  1M1J C;  2A06 E;  2NPS C;  3CX5 D;  4OH8 B;  2QVA A;  2ZYA A;  4GT1 A;  3V2R A;  2FBW D;  3MIW A;  2AEM A;  2A06 D;  4K3A A;  1NEK D;  1RQV A;  1IJD B;  2QJK B;  4YXD C;  4GOE A;  1IFI A;  4ZMD A;  1WMK A;  1PL5 A;  3KPE A;  5EFW B;  1GL2 C;  3LW5 J;  2WT7 B;  1ZN5 A;  3L75 D;  5AW1 B;  1IO4 A;  1ZME C;  2OYI C;  2H89 C;  3FX0 A;  4Z1M H;  3AE5 D;  1L4A A;  1HVV A;  3I55 P;  1GK4 A;  3AE1 D;  1NTK G;  1QLB C;  1Q86 Q;  4EI2 A;  4JF7 A;  3L70 J;  3HUS A;  1KB9 E;  2V7Q J;  1W2E A;  4NPF X;  2WP9 D;  1PGO A;  1LTJ B;  3AE7 C;  2W27 A;  3MTU E;  3GHG A;  3P32 A;  1KB9 H;  1OFC X;  4WY4 A;  2OYH A;  1KB9 D;  2E5Y A;  3WUT A;  3A2A A;  1IFM A;  1A02 F;  4H0L B;  1SVF A;  5AW9 B;  2IZ0 A;  3PTZ A;  4H44 B;  3W68 A;  4D6T G;  2ZVN B;  1GW4 A;  2BS2 C;  3VMA A;  3M91 A;  3P7K A;  1AV1 A;  1Q90 D;  2ZT9 B;  1EZV G;  1NO4 A;  3V4W A;  3OAK A;  2FFD B;  1RF0 C;  1NTM E;  3H1I G;  1X0T A;  2O3J A;  2WDV C;  2GA1 A;  3V4Q A;  3SWY A;  5CCG C;  5KAF E;  5APU A;  1VF5 D;  5KAF H;  4ZNC A;  3F5H A;  4YTP D;  5AVW B;  1H0T A;  2WT7 A;  4DHZ A;  2WQY D;  1QVF O;  5BU5 A;  1LTI C;  3O6Q B;  3FWL A;  3P4S D;  1DEB A;  3KHU A;  3G4S P;  2R3C A;  1GD2 E;  4UB6 E;  3ZDM A;  3RK2 D;  5CCH D;  4DDG A;  3L73 G;  3CLQ A;  1SQB G;  2OGU A;  3VYI A;  3NFQ A;  1L0L G;  1FJP A;  2OQQ A;  1NTM J;  4JQ0 D;  1H8A A;  1N2D C;  5APV A;  1JEK A;  3GF7 A;  3C9I A;  3VMY A;  2A45 G;  3CC2 P;  1T2K D;  3CWB E;  1PPJ G;  2E76 C;  3T97 B;  3ABV D;  1GU5 A;  2W6A A;  3NXS A;  1FZA A;  1EZV I;  4YSZ C;  3B5N B;  2JWA A;  5KLV E;  1PGJ A;  2K9Y A;  2XKM A;  3TF5 A;  1NTZ J;  2QJY B;  4OGQ D;  5BU8 B;  3RK3 D;  2JKV A;  1NU1 J;  2FY8 A;  4FJV A;  3N4X A;  3HRN A;  2ZYD A;  3H1H D;  2B88 A;  1Q2N A;  3M9Q A;  2P7J A;  3H1J G;  1JUN A;  4N6J A;  1KFM A;  1BCC D;  1VDF A;  1NVO A;  3KDP B;  1TFF A;  2AEJ A;  2JO1 A;  2FKW B;  1IC2 A;  3Q5R A;  3CWB J;  2BCC D;  2YXR B;  2KZJ A;  2WIT A;  3LIE A;  1IK7 A;  2KLU A;  1XTG B;  2FYU K;  1JY3 O;  1SQQ K;  4KT0 J;  1AQ5 A;  2FYN B;  1LTJ C;  1E7P C;  3L72 J;  3H1K G;  4PD4 D;  4DCK A;  2W6J H;  1JTH B;  5AVR B;  2IZ1 A;  2Y0C A;  5CBN A;  2JJL A;  3VP9 A;  2BS3 C;  4H0L C;  1QEX A;  1SQQ D;  2M3E A;  2A45 I;  4H44 C;  1VQ5 P;  1RF1 A;  1SQP G;  3D71 A;  4K35 A;  2KSJ A;  3AEB D;  1QLE D;  4PV1 C;  2ZT9 C;  4YT0 C;  1DH3 A;  2FFD C;  2FXP A;  3RL0 g;  4EDF A;  1M56 D;  3B5N A;  1HBW A;  3O8Z A;  1YQ4 C;  3L4F A;  3H25 A;  1NKZ B;  3CXH E;  2PFX A;  2KOG A;  5AW6 B;  4GDO A;  1LTS C;  4GIF A;  4EIJ A;  3VN0 A;  4DHI B;  3CXH H;  2MJZ A;  4YSX D;  1JY2 O;  3B8E B;  1VF5 B;  1KFY C;  3S9O A;  2J5U A;  2WDQ D;  3AEE C;  1NTK J;  2ZFC A;  1G2C B;  1VQL P;  1XTC C;  1JB0 J;  3VOP A;  1YTZ I;  2R5B A;  3KYQ A;  2YKO A;  2WU5 C;  5AW7 B;  3OA7 A;  1KYO D;  3F89 A;  1OVU A;  3L71 E;  3GMA A;  1URQ D;  1SLQ A;  5CMZ A;  2RMZ A;  1YIT P;  2LKM A;  2PP6 A;  2QG4 A;  5C2T D;  3L71 D;  4BRY B;  3FXE A;  1KQF B;  1KQG B;  3RK2 B;  1KZU B;  3GLM A;  2Q3I A;  1KD1 Q;  1S5L E;  5TIS E;  3CI9 A;  3WMM 0;  2PAJ A;  1S5L H;  1LT9 B;  2I1K A;  4D6T J;  4DHJ A;  5TIS H;  3L74 D;  1PV3 A;  3L73 E;  3BCC D;  1JTH A;  1X22 A;  1SQB E;  3E7K A;  1OIP A;  1PP9 D;  1L0L E;  3PRJ A;  1VQP P;  3H1I J;  3AE2 D;  1NHL A;  4NPD A;  2G8Y A;  3L37 A;  3P4R D;  1WT6 A;  2WVR A;  2W90 A;  1E5W A;  4R4L A;  2JDI H;  1PPJ E;  1HGV A;  1OMI A;  2P58 A;  5APW A;  3NMD A;  5AW5 B;  2M5A B;  4OVN F;  2Z5I A;  2FBW C;  2JWD A;  3CIR D;  2B76 C;  2QJY C;  5KAI E;  5KKZ B;  3RK3 B;  1H89 A;  2C0X A;  3I5C A;  5KAI H;  2XZR A;  3CX5 I;  4N3Y B;  3AEF C;  1NWQ A;  2YKQ A;  4ASW A;  5KJ7 C;  3L73 J;  1W5C E;  1RE3 A;  1KIL D;  1SQB J;  4LDT A;  1M1J A;  1L0L J;  1HWT C;  2Q9I A;  2E75 D;  2IFM A;  1SQX K;  3A7O A;  3H1J E;  1R5L A;  1USD A;  4YTN D;  2WP9 C;  2C9N Y;  2ZYG A;  2XV5 A;  1Q82 Q;  2Q1K A;  3VR8 C;  1SQX D;  1A02 J;  3VMX A;  5K5G B;  2R3S A;  1BE3 G;  2Y9Z A;  1S9K D;  1DX7 A;  2XU6 A;  4WY4 B;  4HJG H;  2OYH B;  3AED C;  3LW5 H;  1IFN A;  3CCE P;  2R44 A;  2QJP B;  1AA0 A;  3CCM P;  3IN6 A;  3R4Y A;  1ZRT D;  2YIU B;  1CI6 A;  4W7Y A;  1R5S A;  1RE4 C;  2D2C D;  2M5A A;  2E5T A;  4WB4 A;  3MZW B;  3D6Y A;  1P84 E;  3L70 D;  2V7Q H;  4HH2 A;  1CZQ A;  1N7L A;  2JP3 A;  1VF5 C;  2L5G B;  5TJH A;  3AEA D;  1VL2 A;  4N78 E;  1VQ4 P;  1P84 H;  3CME P;  2E74 C;  3U1A A;  1X79 B;  4YTP C;  3RL0 C;  2WTY A;  4L74 A;  4XFJ A;  1TU3 F;  4I7Z B;  1JY3 P;  4O9B A;  2WQY C;  4IL6 X;  2WS3 D;  2WDR D;  1H0T B;  3H1K J;  5APX A;  1YIJ P;  1AVO A;  1URQ B;  2P10 A;  1CSB A;  3KQG A;  4H13 C;  4Y99 C;  1PZQ A;  1FBM A;  3RK2 C;  3WUU A;  5CCH C;  1RHZ B;  1BGY G;  2IPP A;  1IFD A;  2OTJ P;  1LT9 C;  1FS0 E;  2BCC G;  1AJY A;  1SQP J;  3M0D A;  3MUD A;  3CC4 P;  1S3J A;  1ZLL A;  5KLI B;  1Q81 Q;  1CW5 A;  1FE6 A;  2G3A A;  4MN4 C;  1LWU A;  3P4Q D;  2IBZ E;  3U1C A;  1BDD A;  5AVY B;  1OWA A;  2YMY A;  1T2K C;  1VQO P;  4YTM C;  1N7S D;  1DEE G;  1ZOY D;  2IBZ D;  3G3Z A;  1NGM B;  2FYU G;  2YMK A;  1JY2 P;  1VQN P;  2HLO A;  2IDB A;  3CL3 D;  3RGU A;  2KZI A;  3FGA D;  1NOH A;  1SP4 A;  3H1L G;  2W8Z A;  1FZC B;  1NTM K;  1KF6 C;  2ACZ D;  4TLF A;  1KC8 Q;  2WSC H;  3IF4 A;  1YJW P;  5KKZ C;  3RK3 C;  4KHX A;  3SFE C;  5GTH E;  4HB1 A;  3G71 P;  2ZXE B;  3CCV P;  1NTM D;  1GU4 A;  3MHV A;  5GTH H;  2O01 J;  1ZV8 A;  3VR9 D;  2K9J A;  2WMM A;  2Z4E A;  2N1T A;  3GF3 A;  4L75 A;  1KIL B;  2KXP B;  2W83 C;  3VP8 A;  2AXT E;  5AW8 B;  1VQ6 P;  2E75 B;  2H88 D;  4OWF A;  2CPS A;  4ZKU A;  1YQ3 D;  2AXT H;  1URQ A;  1EDK A;  3QH9 A;  1L4A C;  1ZXG A;  4XE5 B;  4GOF A;  4LLH A;  3P8C E;  2WZ7 A;  2NPS D;  3EWK A;  1EQ7 A;  1NTZ E;  5DJT B;  1FAV A;  2P2U A;  3HUS C;  1SQV G;  1NU1 E;  4BXL A;  3WUV A;  2WSC J;  1S4X A;  3GHG C;  4WY4 C;  2OYH C;  1GL2 D;  4PD4 I;  3BCC G;  1S1C X;  2H89 D;  5CJ4 A;  1BE3 E;  2WPS A;  1GTW A;  5C39 A;  1PP9 G;  2QJP C;  1YBK A;  3FWN A;  1EDJ A;  1RF1 B;  5M1B A;  3LID A;  1E79 H;  1GZL A;  3NTN A;  2YIU C;  5KLV K;  3P4P C;  1USE A;  3CWB D;  2RKL A;  1FZC A;  2D2C B;  3L72 E;  3AE3 D;  3AE7 D;  5AVU B;  1FOS F;  3KXD A;  3GG2 A;  3BVH A;  3AE4 C;  3L72 D;  1EC5 A;  3D6Z A;  3BAT A;  5AVX B;  5KLV D;  2WDQ C;  1L0N G;  5AW0 B;  2C0W A;  1VQK P;  4I7Z C;  2QJK C;  2Q6Q A;  3V2Q A;  3Q3D A;  1KIL A;  1J2J B;  1K05 A;  4U3F G;  2HOD B;  3TGU G;  2R32 A;  3TYY A;  3USS A;  1KYO I;  1BE3 J;  2W6B A;  2NZ2 A;  4ASV A;  3Q5P A;  2JEE A;  1ZR4 A;  2YKP A;  3SSU A;  2FXM A;  5KLI C;  1BGY E;  1HJ0 A;  1N73 A;  3CMA P;  3SFD D;  3OJA B;  1Y8A A;  3TK1 A;  1NTK E;  2POH A;  1KQL A;  1SQX G;  5AW4 B;  1N7S B;  2J59 M;  1YJN P;  1YHQ P;  4DJG A;  1YI2 P;  1Y9B A;  1JY3 N;  2KYV A;  3AEG D;  2B87 B;  4KX6 C;  3QWO C;  1OW7 A;  1KOR A;  1YYC A;  1GDT A;  1J1D B;  3V6I A;  2QM7 A;  5B5E E;  4YSY C;  4I1L A;  2HYN A;  4D6T E;  3I56 P;  3G6E P;  2Y0E A;  3WU2 E;  5B5E H;  2HR3 A;  2QEX P;  3H1L E;  1IFP A;  1SFC A;  3CCS P;  1WRG A;  3WU2 H;  5AVS B;  1L0V C;  4D6T D;  1GW3 A;  2KLV A;  1EZV E;  1HGZ A;  3H6P A;  1PGQ A;  4WBA A;  3CXH D;  3H1I E;  3R2P A;  4DDI A;  1BGY J;  1KQS O;  2E76 D;  2WSE J;  3MP7 B;  3H1I D;  2A06 G;  2KS1 A;  2BCC J;  2E75 C;  2YNY A;  4Y28 J;  2N1T D;  3EFF K;  1JY2 N;  2HOD A;  2LXC B;  2YXQ B;  3Q2Y A;  1M1J B;  1N86 A;  1VQM P;  2KP8 A;  1K8A Q;  4YTN C;  2FYZ A;  3L75 G;  1QX8 A;  1LNQ A;  4IFF A;  1OW8 A;  1MFT A;  3EQ2 A;  2FYU J;  1SQQ J;  5CBO A;  1S5L X;  1SQB K;  3PHL A;  1L0L K;  1SQV E;  2J58 A;  1DIP A;  3H1L J;  4L73 A;  2OYI B;  1EDI A;  2O1J A;  2V4H A;  3HTK A;  1N7S A;  2B9B A;  3L73 D;  1PFI A;  3VRB C;  1SQB D;  2IX7 C;  1EXI A;  1L0L D;  2B87 A;  5APY A;  3IAO A;  3JSV C;  1HTL C;  1NEN C;  1JOC A;  3B5N C;  2A45 H;  1CI6 B;  3AE8 D;  4JYC A;  5APT A;  3HD7 A;  3P8M C;  1PPJ D;  4A7P A;  1QVG O;  5C3J D;  1MKM A;  2QA4 P;  2N9B A;  1NEK C;  3BRV B;  1LTG C;  4OGQ B;  1EDL A;  4DZO A;  2M8R A;  1L0N E;  3N7N A;  2Y0D A;  4PV1 D;  1LTA C;  1EXJ A;  4GOD A;  1SQV J;  2M3B A;  4YPC A;  2L91 A;  3TNU A;  1JO5 A;  1FZF A;  1OW6 A;  1YQ4 D;  5AW2 B;  3AE5 C;  3AE6 D;  1S72 P;  3MD0 A;  3EFG A;  2IYO A;  1HJB A;  1DD3 A;  2NPS A;  1HF9 A;  3BCC J;  1KTM A;  3AE1 C;  1LP1 A;  2DW3 A;  3Q1M A;  1KFY D;  1PP9 J;  1MZ9 A;  3FXD A;  2CPB A;  1FJK A;  2FYN C;  3H1J D;  4C46 A;  1PGP A;  1OXZ A;  4WWI A;  1MUU A;  2XNX A;  1GL2 A;  2B89 A;  1JMM A;  2H8P D;  2WU5 D;  1Y47 A;  1ZOY C;  4QMA A;  1LWU B;  2OYI A;  3H1K E;  3L36 A;  1KB9 I;  3H1K D;  1SQP K;  3MGN A;  1J1D C;  1L0N J;  2YO2 A;  1U57 A;  4L76 A;  1VQ8 P;  3PJS K;  4GKG A;  2KI7 B;  1FZB A;  4AUW A;  1SQP E;  1G1J A;  4M3L A;  2AEF A;  4EOT A;  3TSI A;  3SWF A;  4U3F J;  1RY3 A;  1SQP D;  1RQU A;  4RO0 A;  2XND H;  2N9Y B;  3TGU J;  2IYP A;  1JMB A;  1SFC D;  1FU1 A;  3VR9 C;  1P84 D;  5KLV G;  4N78 D;  3IR9 A;  1FOS E;  2K9J B;  2WPR A;  2BEZ F;  1RE3 C;  2N1T B;  2FXO A;  1ZW0 A;  3CX5 E;  3G9R A;  2RN0 A;  4YXW H;  4AQR D;  1RF0 A;  3CX5 H;  3VTP C;  3P4S C;  3H1H G;  1SQX J;  2WSS H;  2B76 D;  1SS1 A;  4C7N B;  5CCG A;  1YJ9 P;  1AFO A;  3HE5 A;  1BCC G;  3L75 E;  4IL6 E;  3VMZ A;  4LGD E;  1NKN A;  3UIA A;  3AEF D;  4IL6 H;  5CJ0 A;  2QSI A;  3Q5S A;  1U7M A;  5KJ7 D;  2IFN A;  2O01 H;  3VRA D;  2HPC A;  3HE4 A;  2KUB A;  2HFE D;  1UII A;  4NPE A;  2WPV B;  3K5B A;  3ABV C;  1SQQ G;  2P67 A;  5APS A;  5L8R J;  3AE3 C;  3AE9 D;  3VR8 D;  4IFM A;  1ZP0 D;  1OVR A;  2GUV A;  4C7R A;  2OYO A;  5AVQ B;  4IFD K;  3HD7 D;  4OGQ C;  3AED D;  3CCR P;  2WSF H;  3L75 J;  3V2P A;  1FDO A;  2WU2 D;  4PV1 B;  3AEC D;  4W7Z A;  3BRT B;  1R8E A;  2YO3 A;  2OTK E;  3SWK A;  1IFJ A;  1KFN A;  4B86 A;  3B4S A;  1M8O B;  1NTZ K;  1T3U A;  1G1I A;  2ZJS E;  4C7N A;  3SFD C;  3L35 A;  2E74 D;  1NU1 K;  3MUD C;  3M0D C;  3II6 A;  3BAS A;  3P8C D;  3RL0 D;  1OX3 A;  3L71 G;  2K88 A;  1N73 B;  1NTZ D;  4YXD D;  2SPZ A;  1LWU C;  1NU1 D;  2WSF J;  3L74 G;  2Y9Y A;  3A3Y B;  4I2L C;  3AEG C;  4H13 D;  2XDJ A;  3V5B A;  1AVY A;  1FDM A;  1LTB C;  2ZAE B;  3AEB C;  3B71 A;  2GUS A;  4HKZ H;  4UB6 H;  5CHX A;  1VQ7 P;  1BE3 D;  3A5T A;  1VQ9 P;  2UWJ E;  4CPG A;  3C8V A;  2VRS A;  4RES B;  1X8Y A;  1LTJ A;  3CC7 P;  4R4M A;  3RBX A;  3OW2 O;  5GTI E;  3ITK A;  4YSX C;  1SFC B;  3M0A A;  2NRG A;  3VON A;  5GTI H;  4YTM D;  1JNM A;  2R5D A;  1X9V A;  5APQ A;  1QGK B;  2N1T C;  3CXH I;  2FFD A;  2KS1 B;  1HH0 A;  1LTT C;  5AW3 B;  3RK3 E;  1KF6 D;  2QE7 H;  1URQ C;  5DJU B;  3CCJ P;  1LT1 A;  5C2T C;  4ZKP A;  3CCQ P;  1M7L A;  3SFE D;  1QL1 A;  1IZN B;  2WDV D;  3H1H E;  3JCU E;  5CCG D;  5B66 E;  3M06 A;  1BCC E;  1NTK K;  4RJT A;  2PRR A;  3JCU H;  2BAS A;  3PP5 A;  3V2N A;  5B66 H;  2BEQ D;  2BCC E;  2HG5 D;  1BGY D;  1T8Z A;  2WSE H;  1KN7 A;  1QL2 A;  3O6Q A;  3AE2 C;  1FDI A;  3HTK B;  1NTK D;  1L4A D;  4PJ0 E;  2OTL P;  4PD4 E;  3P4R C;  4PJ0 H;  1JCD A;  2KSE A;  1BSH A;  4PD4 H;  2E42 A;  2FYU E;  5KLV J;  3AE8 C;  1SQQ E;  1FZC C;  3PH0 A;  2K37 A;  2ZFY A;  1FC2 C;  1Q7Y Q;  2FYU D;  4WY4 D;  3CIR C;  5C3J C;  1T6A A;  1MV8 A;  3HD7 B;  4TT3 H;  3U59 A;  2I1J A;  1J1E B;  3H1L D;  3H1H J;  3T97 A;  3L70 G;  2WPQ A;  5AVZ B;  3CCL P;  2O01 N;  1BCC J;  1EZV D;  3CCU P;  1KIL C;  2JR8 A;  3KZI E;  3AE6 C;  3P4P D;  1ZR2 A;  3KZI H;  3TNU B;  4KJM A;  1OZH A;  4YSZ D;  2ZVO B;  3C1L A;  2KNC B;  3CPW O;  3AE4 D;  2NPS B;  1NYH A;  4I6M C;  4EYY Q;  2E74 B;  3RL0 B;  1LP1 B;  1KYO E;  1DD4 A;  3JC2 2;  1N73 C;  1VPC A;  1MFZ A;  2LR2 A;  5BVZ A;  3GW6 A;  2Q7C A;  5H2F E;  1SQV K;  1KYO H;  5KJ7 A;  4UB8 E;  2Q3E A;  4LC1 A;  1AQT A;  1NAF A;  5H2F H;  2Z5H A;  1GL2 B;  4XA4 A;  4UB8 H;  1L2P A;  2ZXX A;  4H13 B;  2LXB A;  1NJI Q;  4Y99 B;  2QM8 A;  2QIW A;  1SQV D;  2C9L Y;  3L74 E;  1RF1 C;  4DT0 A;  3CD6 P;  3BCC E;  1Z56 A;  2KB7 P;  3RBZ A;  2P1J A;  2IBZ G;  1NH4 A;  1PP9 E;  3E1I A;  1U7J A;  5AVT B;  1BDC A;  2D2C C;  2Q5U A;  5AVV B;  1LJ2 A;  2K1A A;  1SFC C;  2RH0 A; 
#chains in the Genus database with same CATH homology
 4KT0 J;  3AEA C;  1FDO A;  1EXJ A;  4YTN D;  1E7P C;  2OQQ A;  2BEZ F;  2WU2 D;  3EWK A;  4PV1 B;  3AEC D;  4H0L D;  2WP9 C;  3Q2Y A;  2NZ2 A;  3G9R A;  1PV3 A;  1OW6 A;  1YQ4 D;  1AJY A;  4YTN C;  3AE5 C;  4H0L B;  3Q5P A;  1R8E A;  2BS3 C;  1ZRT E;  3AE6 D;  3VRB D;  2WU2 C;  3AEC C;  4H44 D;  2BS4 C;  3VR8 C;  4KX6 D;  4H0L C;  1DD3 A;  3GF7 A;  1HF9 A;  4RKU J;  1KTM A;  4H44 B;  3P4S C;  1OW8 A;  3AE1 C;  2MKV A;  3AE6 C;  5KLI C;  1HJ0 A;  3RK3 E;  2E76 B;  1KF6 D;  2B76 D;  2WS3 C;  3P4P D;  4H44 C;  2WDR C;  3SFD D;  2WSC J;  2G3A A;  4YSY D;  3Q1M A;  1KFY D;  1PIX A;  2E76 C;  3AE2 D;  3T97 B;  2BS2 C;  1S5L X;  3P4Q D;  2ZT9 D;  1NEN D;  5C2T C;  3AED C;  3D71 A;  4YSZ D;  1GMJ A;  3ABV D;  4YT0 D;  2H88 C;  2FYN C;  1Q90 D;  3AEB D;  3SFD C;  2ZT9 B;  3SFE D;  1YQ3 C;  4YTM C;  2G8Y A;  4PV1 C;  1S1C X;  1ZOY D;  3AE4 D;  2E74 D;  2H89 D;  3AEF D;  2WDV D;  2ZT9 C;  3P4R D;  1K04 A;  1DIP A;  4YSZ C;  1NGM B;  1NYH A;  3IN6 A;  2YMK A;  3R4Y A;  1L0V D;  4YT0 C;  2QJP C;  2QSI A;  2FXP A;  2E74 B;  4R4L A;  3Q5S A;  3RL0 g;  2IDB A;  2WU5 D;  1Y9B A;  1ZOY C;  5M1B A;  1KMI Z;  1KIL E;  2K9Y A;  1YQ4 C;  1DD4 A;  1OMI A;  3FGA D;  2FBW D;  2WDV C;  4YXD D;  3VRB C;  3VRA D;  3H25 A;  3AEG D;  4KX6 C;  1NEK D;  2BEQ D;  1RQV A;  4GDO A;  2YIU C;  1EXI A;  1VF5 D;  2D2C D;  2FBW C;  4YXD C;  2WSF J;  1OW7 A;  1KOR A;  3IAO A;  4OGQ D;  3VRA C;  3CIR D;  2B76 C;  1KF6 C;  2QJY C;  1WMK A;  3P4P C;  4YSX D;  3AEG C;  2ACZ D;  2WPV B;  4H13 D;  1VF5 B;  2D2C B;  3D6Y A;  1PL5 A;  1KFY C;  3AEE D;  4YSY C;  3O6Q A;  3AE2 C;  3S9O A;  1FDI A;  2JP3 A;  3LW5 J;  1NEN C;  1VF5 C;  3P4Q C;  3AE3 D;  3AE7 D;  4YTP D;  1UIX A;  3ABV C;  2J5U A;  4H13 B;  1VL2 A;  1U57 A;  3AEA D;  5KKZ C;  3AEB C;  3B71 A;  2WDQ D;  3SFE C;  3AEE C;  2QIW A;  3AE4 C;  3AEF C;  5L8R J;  1ZME C;  2E74 C;  2H89 C;  3P4R C;  3D6Z A;  2WQY D;  3AE3 C;  4YTP C;  3AE8 D;  4Z1M H;  3D70 A;  1JB0 J;  4U7J A;  1L0V C;  3C8V A;  3AE5 D;  2WDQ C;  2O01 J;  2WU5 C;  3AE9 D;  3VR8 D;  4XFJ A;  1TU3 F;  4I7Z B;  4R4M A;  1ZP0 D;  2WQY C;  3VR9 D;  1RQU A;  3AE8 C;  5C3J D;  4I7Z C;  1MKM A;  3GF3 A;  3P4S D;  4IL6 X;  2QJK C;  3AE1 D;  1QLB C;  1NEK C;  2WS3 D;  3GMA A;  3AE9 C;  4OGQ B;  2WDR D;  2JO1 A;  2E75 D;  3Q5R A;  2D2C C;  2E76 D;  1ZP0 C;  3VR9 C;  4OGQ C;  2WSE J;  3Q3D A;  3CIR C;  4YSX C;  5C2T D;  1K05 A;  1IK7 A;  3AED D;  5C3J C;  2P10 A;  2E75 B;  2ACZ C;  1KQF B;  4H13 C;  2H88 D;  1KQG B;  2V7Q J;  3GLM A;  4YTM D;  2WP9 D;  2E75 C;  4TT3 H;  1YQ3 D;  4Y28 J;  3AE7 C;  4PV1 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...