3AE1C

Crystal structure of porcine heart mitochondrial complex ii bound with n-phenyl-2-(trifluoromethyl)-benzamide
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of porcine heart mitochondrial complex II bound with N-Phenyl-2-(trifluoromethyl)-benzamide
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
total genus 47
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3ae1C01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3ae1C02
3ABVD 3AE6C 1OW6A 2G3AA 1K04A 4YTPC 3AE9C 1ZOYD 2WP9C 3S9OA 3AEBC 4YTND 2WDVC 1QLBC 3AEED 1K05A 3AEAC 3CIRC 2H89C 3AE6D 3AE5C 3SFED 3AE7D 1L0VC 3AEFC 3AECC 2WP9D 4YTNC 2WDRC 3AE9D 3P4QC 3SFDC 1KF6C 3AE2D 3VRAD 3AEDC 3AEDD 2BS4C 4YSXD 3AE4D 3AE3C 2ACZC 2BS3C 2WU2C 3AEGD 1KFYC 1YQ4D 2H88C 3B71A 2H88D 3P4PD 4YXDC 1ZP0D 3VR9C 2WDQD 2WDQC 3VRBD 5C2TD 4YSZC 3AE1C 1NENC 5C3JD 1YQ3D 4YTPD 4YSXC 4YTMD 4YSZD 1NEKD 4KX6C 3SFEC 2WQYD 2H89D 3VR9D 3VRAC 5C3JC 3VRBC 3AEFD 1NEND 1KF6D 1ZOYC 3P4RD 4YT0D 1NEKC 3ABVC 4YSYD 3P4SC 3P4RC 4YT0C 2WDVD 3AE1D 3SFDD 3P4QD 4YSYC 1L0VD 3AE5D 5C2TC 4YTMC 3AE7C 2WDRD 3AEGC 3AE8C 1PV3A 2B76D 2FBWD 3AEAD 3CIRD 3AE4C 2BS2C 2WU5C 3VR8D 2WU5D 1OW8A 1YQ3C 3VR8C 3P4SD 2WU2D 3AECD 2B76C 3AE8D 1KFYD 3AE2C 2WS3C 2WS3D 2FBWC 3P4PC 1OW7A 3AEEC 1ZP0C 1YQ4C 4YXDD 3AEBD 2ACZD 3AE3D 1KTMA 4KX6D 1E7PC 2WQYC
chains in the Genus database with same CATH superfamily
1ZN5A 1LTBC 1VQ6P 2YIUC 3RBZA 2N1TD 3V4WA 2GM4A 3M0DC 3TDKA 1SQBJ 1RE3A 2PAJA 3S4RA 3V6IA 3V2QA 1JCDA 1T2KC 4RJTA 5CCGD 1URQD 1EQ7A 2KZIA 2YKOA 3MGNA 1NTKG 1LP1B 5AVXB 5AW9B 3M91A 1IK9A 1NEND 1FZFA 1DD4A 4OVNF 1G2CB 1KB9I 1NU1E 3L73E 5AVYB 3II6A 2FYZA 3RL0g 2J58A 1IFPA 2WPQA 4YTMC 3AE7C 1NKZB 2BCCG 3CCJP 1NTMK 1SP4A 1SVFA 2ZFYA 1U7JA 3P32A 1G1IA 3MIWA 3AECD 3CXHI 2IFMA 2IDBA 3L71D 5APYA 4YXDD 5KAIE 4RKUJ 1KTMA 4LLHA 3BCCJ 4IL6H 2YKPA 1IFIA 4BRYB 4DZOA 5GTHH 1BE3E 3AE6D 1AQ5A 1JY3N 1U57A 2HPCB 4I6MC 3AEFC 3AECC 3RBXA 3H1LG 1NAYA 2XU6A 2WZ7A 3B5NB 2HODA 1S5LH 3G9RA 1SQBG 3EQ2A 1MFTA 2PGDA 2H88D 4PV1D 1J1DB 1ZP0D 1FZAA 1QL2A 1PGQA 1NOHA 2P58A 3OAKA 1UIXA 1KYOI 1GK4A 2K37A 2R3CA 1URQC 4EI2A 3PHLA 4PD4H 2LXBA 2Q9IA 1AA0A 1NEKC 1KQSO 1DH3A 4IFMA 2H7HA 1LNQA 3SFDD 3KYQA 4QMAA 2Q7CA 1JY3P 4HJGH 2GUSA 2FYNB 1EZVE 4FJVA 1NTZG 2FYNC 3KXDA 2FYUD 3HRNA 5KLVK 2FKWB 1NTKK 4JBZA 1YJ9P 2ZVNB 4DDGA 1YYCA 5L8RJ 2ZYAA 3EFGA 3U59A 1ZP0C 3ABVD 1OW6A 4H44C 1LWUA 1X0TA 1ZOYD 1PL5A 1N7SA 2JP3A 3AEED 1OFCX 1KQGB 1BE3D 1M1JB 2POHA 3I56P 2C9LY 2Q1KA 3CLQA 1OX3A 1M57D 4WBAA 5AW6B 2AXCA 2Q3IA 2HFED 3B5NC 2R5BA 2KIKA 2AXTE 2JDIH 2M3BA 1JTHA 1BCCJ 2CK3H 1L0LD 1HGZA 2XKMA 4IOIH 4PJ0E 2WDQC 4N3YB 1NTMD 3SWYA 1GU5A 2OGUA 4YSXC 1PP9D 2YO3A 3PP5A 1J1EB 1IJDB 2Z5HA 2WSEJ 2KK7A 3L70D 3A0HE 1HJ0A 2N1TB 4LDTA 4A7PA 2H8PD 3TSIA 3P4SC 2QG4A 2O01H 1JY2O 3USSA 4OGQC 1NTZE 1QX8A 1SQPJ 2ZJSE 2BEQD 1KILB 3U1AA 3HUSB 3P4SD 2Y0EA 2E74B 2WU2D 3L4FA 3BCCG 1J1EC 1AFOA 2ZXXA 5AVTB 4Y28J 3LIEA 1WT6A 4CPGA 1HWTC 3VMYA 1N73A 1R5SA 3V5BA 5GTIH 5TISE 2FXPA 2Y9YA 1HBWA 1BE3J 1NAFA 2BCCE 2P2UA 1H0TB 1CW5A 1L0ND 1BDCA 5CCGA 3P4QC 2W6BA 2WSFH 2YNYA 3H1KD 4JPZB 3AEDD 1VF5C 2FFDB 3IAOA 1RF0A 1SS1A 2R44A 3Q5PA 1ZLLA 2KOGA 2E75D 2E75B 4C7NB 2KNCA 3L75D 5KAFE 2E5TA 2QJKB 3M9BA 1KF6D 3P4RD 4UB6H 3E1RA 1NKNA 4ZKPA 1LGHB 3VMAA 4YSYC 3TGUE 4GT1A 2E75C 2WDRD 1GTWA 3B5ND 3FWNA 2ZFCA 1EDJA 5AW7B 3G4SP 4PV1B 1FZCC 1ZMEC 1DEBA 1H89A 2WPVB 4H44B 3L37A 2FFDC 2CPBA 1URQB 1SQQD 2FYUG 1M1KQ 2WMMA 2D2CD 2Y0CA 1SFCD 1S4XA 2QJYC 2H89C 3HE5A 3PTZA 3CL3D 3P7KA 2HPCA 5APUA 3I5CA 1YJNP 2WSCJ 3L36A 3W68A 1AV1A 4H0LB 1SQPG 3VP8A 1SQQE 4H0LD 3NTNA 1L0LG 1T2KD 5KLIB 1SQVK 3QH9A 3JCUH 2FYUJ 3A7OA 3FXEA 4GOEA 1PPJD 3VR9C 3VMXA 3CWBG 1EZVD 1YITP 3RL0D 2ITAA 3P8CE 2L5GB 2ZYGA 2KYVA 2BCCJ 3RK3C 3R4YA 3VMZA 1LT9B 4NPDA 4HH2A 3A2AA 1T3JA 3TGUG 3MUDA 2DW3A 1IO4A 4EYYQ 4YT0C 2YKQA 1KB9D 2WDVD 1NO4A 3AE1D 1VQ7P 3W67A 2WWWA 3HD7A 4N78E 3WU2E 4C7NA 3AE4C 2WU5D 2XDJA 4I2LC 1P84H 3L74J 1SQVD 1PP9J 3H1KE 1X9VA 3H25A 2O1KA 2V7QJ 2A45H 3N7NA 1GW4A 3R2PA 1JCCA 3CX5D 1VQ9P 3H32A 1KB9H 3AE5C 5GTHE 3AE7D 3M0DA 1H88A 3UIAA 4YTNC 1IFJA 2W6AA 1KZUB 2WPRA 3CCMP 2K9JA 1E79H 3L74D 5BU5A 2E74C 4WY4D 2R32A 3HUSC 4WY4B 3VRBD 1YTZT 3F89A 3L70J 4H0LC 2N1TA 3TGUD 5C3JC 3SFEC 3CX5E 3L73D 5APWA 3M06A 3H1LE 1YTZI 4YXWH 1SQVE 1HVVA 3IN6A 3AE5D 1SQQK 5CBOA 5B5EH 4OH8B 1OMIA 2NZ2A 1JMMA 2A06G 1EDKA 3V4QA 3OJAB 4HKZH 1NTKE 1BCCG 2FBWC 2J5UA 3M9QA 3H1JE 3IF4A 4DT0A 2K88A 1QVFO 2A45I 1RF0C 1SQXE 3AE6C 1J2JB 2K9JB 1EDLA 2O01J 1JB0J 1KORA 3MTUE 4GIFA 2IBZE 3S9OA 2RH0A 2IBZD 2M5AB 5AW3B 1ZV8A 1M90Q 4JQ0D 4O9BA 2FFDA 2WT7B 5APQA 2B87A 3AE9D 3L75G 3ZDMA 3HE4B 1QEXA 3GMAA 3D71A 3CC7P 1LT9A 3H32B 1PIXA 1FC2C 2UWJE 1XTGB 1S9KD 2OTJP 4GDOA 3TNUB 1W5CE 1LT9C 2KSEA 1IFNA 2AEJA 3B71A 3KHUA 1FZEA 5AVRB 4DHJA 4YSZC 1P84I 1BSNA 3VN0A 2HG5D 1YQ3D 3E7KA 1GDTA 1SQXG 3VRAC 2H89D 3VR9D 5AW2B 2VRSA 3H1IE 3Q5RA 1MZ9A 3KDPB 3RGUA 1GL2B 5M1BA 3L72G 1URQA 1NWQA 3ITKA 2ZAEB 2LKMA 1RE3C 2E5YA 3VTPC 4TLFA 3V2RA 4W7ZA 3L75J 3SWKA 3H1JJ 4M3LA 3CI9A 2W6JH 2P10A 4HYTB 1Q90D 2WVRA 1NTMJ 1KQFB 2Y9ZA 1K73Q 1QLED 3L71G 3WUTA 3VONA 2OYHB 5AVZB 4NPEA 3LW5J 1VL2A 1RE4A 4KX6D 1DIPA 2QEXP 5KKZC 1N86A 3CCVP 2OTKE 4LGDE 3H1LJ 1VQLP 2WSEH 3O8ZA 1LP1A 2WDVC 3WMM0 1EXJA 3H1HE 5DJUB 1M8OB 3MZWB 1U7MA 5BVZA 1WMKA 3BCCD 2K1AA 1NU1J 4EOTA 1G2CA 3AE4D 2MKVA 5KAIH 3H1JD 2Q3EA 1NH4A 2KLUA 2FXMA 2R3SA 2M3EA 3AE1C 2JKVA 1SQBK 1NENC 1FS0E 2K3RA 3WUUA 1VDFA 2M5AA 4YTMD 4L75A 1LTJB 3PRJA 1KMIZ 1VQ5P 1ZOYC 2W83C 3A0HH 1TU3F 3ABVC 1L4AC 5AVSB 1AJYA 1W2EA 1FU1A 3CX5H 5GTIE 3CWBE 2HR3A 2E76B 4BRYA 2I1JA 1NTMG 1KILC 2Z4EA 2E76C 2E76D 2A06D 1MUUA 1N73B 5E79E 3BATA 1NTZD 3WU2H 4D6TE 4H13C 3TF5A 4RO0A 2N9YB 1SQXK 4PD4I 5DJTB 3HUSA 3M9HA 4H13D 1AVOA 3L74G 1X8YA 1YHQP 2G3AA 1DD3A 4UB8H 1K04A 3AE9C 1L0NG 1GK6A 2P7JA 2YMYA 1SFCC 1K05A 2PP6A 1NTZJ 3H1KG 3AEAC 1L0VC 1AVYA 2QSIA 4UB8E 1KF6C 1QVGO 3CXHE 3AE3C 2ACZC 1KFNA 4BWNA 3AEGD 3B8EB 4PJ0H 1FBMA 1X22A 1RE4C 5KJ7A 2ZVOB 3H1HG 3CXHH 5AVUB 3L73J 1LTSC 1KYOD 2KSJA 1RF1A 1FDMA 4KX6C 2M0BA 3EFFK 1TFFA 1KB9E 1ZRTE 2IZ1A 3H1JG 3CD6P 3TNUA 2L91A 1HUCA 5APSA 5APVA 4IL6E 1CZQA 3CCRP 1S5LX 2BS2C 1H0TA 1PGPA 1YQ3C 1SQQG 1PPJE 1L0LJ 1BGYD 5KLVD 4D6TD 2QA4P 1FJKA 3NFQA 4L74A 1S9KE 1KQLA 5KLIC 2ZXEB 1KILD 1FOSF 1JTHB 3VRAD 3GHGB 5AW0B 2A06E 4DDIA 4YTND 3CPWO 1BGYJ 3KPEA 5KLVJ 1VPCA 2KLVA 5KJ7D 2OARA 3GW6A 4PD4E 1L4AB 1IFMA 4Y99C 2V7QH 3OW2O 3CC4P 3D6YA 4ZNCA 4D6TJ 3L74E 1LTGC 1N7SB 1RQVA 2H88C 2AXTH 2WDQD 1WRGA 1SQPD 1NYHA 1VQOP 2OYOA 1MFZA 3AEFD 1GU4A 1AQTA 4LC1A 5H2FH 2OTLP 4YT0D 3CCUP 1RF1B 4ZKUA 2O3JA 3U1CA 1JY3O 3T97A 2NRGA 2HLOA 3GHGA 1RH5B 3AEGC 1HJBA 3Q1MA 2YXRB 1BDDA 5B66H 2O01N 2P1JA 4GODA 1OW7A 1VF5B 3S1KA 3AEBD 4AYCA 4H44D 2FYUK 4UB6E 1FDIA 2XNXA 2WITA 3NMDA 1ZR2A 3CIRC 3SWFA 1VQKP 1MKMA 3P8CD 5CCHD 4WB4A 2JEEA 3KZIE 2J59M 1JUNA 2RN0A 3AEDC 2QM7A 1GL2D 1KN7A 1KILE 2WU2C 4TT3H 2XNDH 4OWFA 1FZCB 1H8AA 1P84D 3H1IG 1YQ4D 1R5LA 3P4PD 1XTCC 2FY8A 2QJPC 1YJWP 3HTKB 3T97B 1USEA 2KS1B 3CWBD 3EWKA 4YSZD 1JMBA 1NEKD 3VRBC 3TYYA 1FAVA 3RL0B 2PFXA 3E1IA 1T8ZA 2N1TC 3L35A 2KI7B 1JO5A 2QJKC 3A0BE 3P4RC 3TGUJ 1GD2E 3MHVA 2A45G 4OGQD 2I1KA 1Y8AA 2JR8A 1LWUC 1KYOE 1FZGA 3A3YB 3JC22 2OYIB 2B76D 1BGYG 5KLVG 2QM8A 4EIJA 2W27A 1NTZK 3HE5B 2V4HA 1W2BO 1HGVA 1T3UA 4U3FE 1ZR4A 3RK3B 2KP8A 2Q5UA 1L0NK 3CXHD 3RK3D 1E7PC 2NPSB 4W80A 3V2PA 1GW3A 4ZMDA 1SQPK 4ASVA 2IBZI 2Z5IA 1SQVJ 3KQGA 3H1LD 3L75E 3WUVA 1PZQA 1BSHA 5EFWB 2JO1A 1JY2N 3C9IA 1OVVA 1N7SC 1GL2C 2KUBA 2SPZA 3B4SA 1FDOA 4GOFA 3G71P 3Q3DA 2BS3C 1QGKB 4IL6X 4DOJA 2KXPB 1GL2A 1KFYC 3M0AA 1IZNB 4AUWA 1RQUA 3N4XA 1EC5A 5B5EE 4KHXA 1OVUA 1JEKA 3L73G 1FZCA 1CI6B 3PJSK 3F5HA 3O6QA 2ZT9D 2OYIA 2AEMA 2IFNA 3HTKA 3IFMA 3GHGC 5AW1B 2JWAA 2ZT9B 2N9BA 1KILA 3FX0A 1PFIA 4I7ZB 1OWAA 1D7MA 3GF7A 3RK2B 1N7LA 2ZT9C 3CX5I 4C7RA 3V2NA 3RK2D 4H13B 1E5WA 1FJPA 2QIWA 1VQNP 1L4AD 1BGYE 2XV5A 5KLVE 5K5GB 4I6LA 1GZLA 3RK3E 1N73C 3GLMA 2FBWD 2C0WA 2KS1A 2IPPA 1LTIC 2WU5C 1OW8A 3VR8C 3TK1A 1IK7A 3CCQP 3AE8D 2QVAA 4HB1A 2WS3D 2QJYB 1A02F 2KZJA 3FXDA 2P67A 2CPSA 4D6TG 2IBZG 2WQYC 3HD7B 3KZIH 2C9NY 5AW4B 4YTPC 1USDA 1JY2P 4KT0J 1Q82Q 1FOSE 1DX7A 1Q2NA 3H1HD 3P8MC 1S72P 2NPSC 1S1CX 1KD1Q 2IYOA 1OVRA 4WWIA 2QRXA 3L71J 2Q6QA 5APXA 3BVHA 4W7YA 2K9YA 4YXDC 1Q81Q 1IFDA 3VP9A 4R4LA 1LJ2A 2PRRA 1L4AA 3HE4A 3A5TA 1KV4A 5CBNA 5AVVB 1HH0A 1QL1A 3H1IJ 3OA7A 3RK2C 1PP9G 1YIJP 3GG2A 3CCEP 3C8VA 3L70E 5TISH 1N2DC 1SQPE 3MUDC 1KFMA 1PP9E 3PLNA 3NXSA 1ZW0A 1VQ8P 1NHLA 1PV3A 2BEZF 1NTME 3IR9A 2QJPB 5E79H 2YO2A 3O6QB 2W90A 1S5LE 4U3FJ 1KFYD 3JCUE 5KJ7C 2WSCH 1A02J 5BU8B 3FWLA 2ZYDA 4IFFA 3CCSP 2IYPA 1YI2P 3I55P 2OYHA 3MD0A 1KC8Q 1NJIQ 5KAFH 3JSVC 1SQXD 1M7LA 3AE2D 3LIDA 4OGQB 1JM0A 4MN4C 1OZHA 5CHXA 1SQQJ 4DJGA 1EZVG 5AVQB 3K5BA 3VYIA 4N78D 1NTKD 1NGMB 4R4MA 2FYUE 5CCHA 1NU1K 1NVOA 3CMEP 2IZ0A 5KTBA 1S3JA 3VOPA 2H43A 3PH0A 3BCCE 4JYBA 1OIPA 4Z1MH 1JOCA 1SLQA 5C39A 1FE6A 3D6ZA 1RHZB 1RF1C 1FZBA 3RL0C 1VF5D 1BCCD 1PPJG 2C0XA 3L71E 2OYHC 2BCCD 1VQPP 2G8YA 3P4QD 1L0VD 3FGAD 1K8AQ 1L0LK 4JF7A 4IFDK 4C46A 1M1JC 1P84E 2QE7H 3CIRD 2D2CB 1SFCB 2NPSA 5B66E 4B86A 2FXOA 1LTJC 2WPSA 4GKGA 4PV1C 4L73A 1Y9BA 1RY3A 2WSSH 3H1KJ 3A0BH 1NU1D 2B9BA 3CC2P 2WTYA 2HYNA 1NTKJ 3AEBC 2B89A 1CI6A 2RKLA 1LTJA 4WY4A 3SFED 1PGJA 5AW5B 4ASWA 2WDRC 5AVWB 1MV8A 2Y0DA 4KJMA 2BS4C 4YSXD 3G6EP 2W8ZA 2I8DA 5CJ4A 3H6PA 4U3FD 2RMZA 4L76A 5C2TD 4DHIB 1BE3G 5KKZB 2HODB 4U7JA 4YTPD 1K9MQ 2IX7C 4I1LA 2WQYD 3C1LA 1L2PA 3BRTB 1J1DC 4U3FG 3G3ZA 2YXQB 1LT1A 1DEEG 2GA1A 4K35A 5H2FE 2OQQA 2NPSD 1Z56A 3L72J 3LW5H 2KNCB 5AW8B 5C2TC 4NPFX 3CMAP 1SQXJ 3AE8C 1SQVG 1Y47A 1LWUB 1L0NJ 3VR8D 2R5DA 1T6AA 2B88A 2E42A 1NU1G 1UIIA 2WT7A 1JNMA 2M8RA 2B87B 2WS3C 3BRVB 3P4PC 5CJ0A 4I7ZC 1YQ4C 4PD4D 4Y99B 1IC2A 1L0NE 2LR2A 2JWDA 4BXLA 3B5NA 3CCLP 4WVZA 4DHZA 2WP9C 1S2EA 1PGOA 1QLBC 2KB7P 1BCCE 3D70A 1YBKA 4JYCA 5CMZA 5TJHA 2WP9D 1CSBA 4YPCA 3SFDC 2AEFA 2E74D 4WY4C 2BASA 4DCKA 1SQBD 1SFCA 3QWOC 1VQMP 4K3AA 2XZRA 2YMKA 4AQRD 2GUVA 2WSFJ 1LTAC 2D2CC 2YIUB 1EZVI 1HF9A 1KYOH 1ZXGA 1EXIA 2JJLA 1OXZA 5CCHC 1N7SD 1G1JA 4N6JA 3L72D 2LXCB 1M1JA 3CWBJ 3Q5SA 1N8RQ 1LTTC 3MP7B 2O1JA 3Q2YA 4XA4A 1HTLC 1ZRTD 4XE5B 4YSYD 3H1ID 2MJZA 5CCGC 1GMJA 3HD7D 4EDFA 4XFJA 3L72E 2E43A 1VQ4P 2OYIC 3HD7C 1L0LE 3AEAD 3L70G 3H1HJ 1M56D 1Q86Q 3SSUA 3BASA 4RESB 1EDIA 2B76C 3AE2C 1Q7YQ 3AEEC 3GF3A 1R8EA 1X79B 3AE3D 2ACZD 5APTA 5C3JD 1SQBE
chains in the Genus database with same CATH topology
5KKZC 3ABVD 3AE6C 1OW6A 2G3AA 4H44D 1DD3A 4H44C 1K04A 2O01J 3AE9C 1KORA 1JB0J 2YIUC 4YTPC 1ZOYD 1FDIA 2FXPA 3S9OA 1PL5A 3AEBC 2WSCJ 4KT0J 2WDVC 1QLBC 1EXJA 2JP3A 3AEED 1K05A 4YTND 1KQGB 3AEAC 3CIRC 3AE6D 3AE5C 3D70A 3SFED 3AE7D 4H0LB 1U57A 2QSIA 1L0VC 1WMKA 3AEFC 1MKMA 3AECC 2WP9D 4YTNC 2WDRC 2JO1A 3AE9D 3P4QC 2E74D 4H13D 3SFDC 1KF6C 4H0LD 1S1CX 3AE2D 3VRAD 3AEDC 3GMAA 3AEDD 4OGQB 2BS4C 4YSXD 1VF5C 3D71A 3AE4D 2MKVA 1PIXA 1FDOA 3AE3C 3Q3DA 2ACZC 1KILE 3D6YA 2BS3C 2WU2C 3AEGD 4IL6X 4TT3H 2K9YA 2YMKA 4GDOA 3IAOA 2E74C 3G9RA 1KFYC 2WSFJ 1RQVA 1YQ4D 3Q5PA 2H88C 1NGMB 3B71A 2D2CC 4PV1D 2H88D 3P4PD 4R4MA 4YXDC 1RQUA 1ZP0D 2QJPC 2WDQD 3VR9C 2WDQC 1HF9A 3VRBD 2E75D 5C2TD 4YSZC 3AE1C 1NENC 3T97B 4H0LC 4R4LA 4U7JA 5C3JD 1EXIA 2E75B 1NYHA 1YQ3D 4YTPD 1UIXA 4Z1MH 4YSXC 4YTMD 3EWKA 4YSZD 1NEKD 3R4YA 4KX6C 3SFEC 2H89D 2WQYD 3VR9D 3VRAC 5C3JC 3VRBC 1KMIZ 3O6QA 2ZT9D 3AEFD 3Q5RA 3Q5SA 1NEND 1ZRTE 2WSEJ 1KF6D 1ZOYC 5M1BA 3Q2YA 3P4RD 4YT0D 2ZT9B 1DD4A 3D6ZA 1NEKC 1HJ0A 4I7ZB 3GF7A 1TU3F 3ABVC 4YSYD 2ZT9C 1AJYA 3P4SC 1VF5D 3RL0g 3C8VA 4KX6D 1GMJA 2QJKC 1DIPA 2OQQA 3P4RC 4YT0C 4H13B 2WDVD 3AE1D 3P4PC 3SFDD 2G8YA 2E76B 3P4QD 2QIWA 4XFJA 4YSYC 4OGQD 4OGQC 3IN6A 2P10A 2E76C 2E76D 1L0VD 3AE5D 2E75C 1S5LX 3AE7C 3FGAD 4YTMC 5C2TC 2WDRD 1Q90D 3AEGC 3RK3E 3AE8C 1PV3A 2B76D 2BEZF 2BEQD 2WP9C 1KQFB 3Q1MA 3GLMA 2FYNC 2FBWD 1OMIA 2NZ2A 3AEAD 3CIRD 3AE4C 2BS2C 2WU5C 2D2CB 2WU5D 1OW8A 1YQ3C 3VR8D 3P4SD 3VR8C 4PV1B 2WQYC 2E74B 2WU2D 1IK7A 1ZMEC 3AECD 2WPVB 4H13C 4H44B 2B76C 3AE8D 1KFYD 3AE2C 2WS3C 2IDBA 5KLIC 2FBWC 2J5UA 4Y28J 3LW5J 4PV1C 1VL2A 5L8RJ 1OW7A 2WS3D 1VF5B 3AEEC 1ZP0C 1YQ4C 3GF3A 4I7ZC 1R8EA 1Y9BA 4YXDD 3AEBD 2D2CD 3H25A 2ACZD 4RKUJ 3AE3D 1KTMA 2V7QJ 2QJYC 1E7PC 2H89C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ABV D;  3AE6 C;  1OW6 A;  2G3A A;  1K04 A;  4YTP C;  3AE9 C;  1ZOY D;  2WP9 C;  3S9O A;  3AEB C;  4YTN D;  2WDV C;  1QLB C;  3AEE D;  1K05 A;  3AEA C;  3CIR C;  2H89 C;  3AE6 D;  3AE5 C;  3SFE D;  3AE7 D;  1L0V C;  3AEF C;  3AEC C;  2WP9 D;  4YTN C;  2WDR C;  3AE9 D;  3P4Q C;  3SFD C;  1KF6 C;  3AE2 D;  3VRA D;  3AED C;  3AED D;  2BS4 C;  4YSX D;  3AE4 D;  3AE3 C;  2ACZ C;  2BS3 C;  2WU2 C;  3AEG D;  1KFY C;  1YQ4 D;  2H88 C;  3B71 A;  2H88 D;  3P4P D;  4YXD C;  1ZP0 D;  3VR9 C;  2WDQ D;  2WDQ C;  3VRB D;  5C2T D;  4YSZ C;  3AE1 C;  1NEN C;  5C3J D;  1YQ3 D;  4YTP D;  4YSX C;  4YTM D;  4YSZ D;  1NEK D;  4KX6 C;  3SFE C;  2WQY D;  2H89 D;  3VR9 D;  3VRA C;  5C3J C;  3VRB C;  3AEF D;  1NEN D;  1KF6 D;  1ZOY C;  3P4R D;  4YT0 D;  1NEK C;  3ABV C;  4YSY D;  3P4S C;  3P4R C;  4YT0 C;  2WDV D;  3AE1 D;  3SFD D;  3P4Q D;  4YSY C;  1L0V D;  3AE5 D;  5C2T C;  4YTM C;  3AE7 C;  2WDR D;  3AEG C;  3AE8 C;  1PV3 A;  2B76 D;  2FBW D;  3AEA D;  3CIR D;  3AE4 C;  2BS2 C;  2WU5 C;  3VR8 D;  2WU5 D;  1OW8 A;  1YQ3 C;  3VR8 C;  3P4S D;  2WU2 D;  3AEC D;  2B76 C;  3AE8 D;  1KFY D;  3AE2 C;  2WS3 C;  2WS3 D;  2FBW C;  3P4P C;  1OW7 A;  3AEE C;  1ZP0 C;  1YQ4 C;  4YXD D;  3AEB D;  2ACZ D;  3AE3 D;  1KTM A;  4KX6 D;  1E7P C;  2WQY C; 
#chains in the Genus database with same CATH topology
 1ZN5 A;  1LTB C;  1VQ6 P;  2YIU C;  3RBZ A;  2N1T D;  3V4W A;  2GM4 A;  3M0D C;  3TDK A;  1SQB J;  1RE3 A;  2PAJ A;  3S4R A;  3V6I A;  3V2Q A;  1JCD A;  1T2K C;  4RJT A;  5CCG D;  1URQ D;  1EQ7 A;  2KZI A;  2YKO A;  3MGN A;  1NTK G;  1LP1 B;  5AVX B;  5AW9 B;  3M91 A;  1IK9 A;  1NEN D;  1FZF A;  1DD4 A;  4OVN F;  1G2C B;  1KB9 I;  1NU1 E;  3L73 E;  5AVY B;  3II6 A;  2FYZ A;  3RL0 g;  2J58 A;  1IFP A;  2WPQ A;  4YTM C;  3AE7 C;  1NKZ B;  2BCC G;  3CCJ P;  1NTM K;  1SP4 A;  1SVF A;  2ZFY A;  1U7J A;  3P32 A;  1G1I A;  3MIW A;  3AEC D;  3CXH I;  2IFM A;  2IDB A;  3L71 D;  5APY A;  4YXD D;  5KAI E;  4RKU J;  1KTM A;  4LLH A;  3BCC J;  4IL6 H;  2YKP A;  1IFI A;  4BRY B;  4DZO A;  5GTH H;  1BE3 E;  3AE6 D;  1AQ5 A;  1JY3 N;  1U57 A;  2HPC B;  4I6M C;  3AEF C;  3AEC C;  3RBX A;  3H1L G;  1NAY A;  2XU6 A;  2WZ7 A;  3B5N B;  2HOD A;  1S5L H;  3G9R A;  1SQB G;  3EQ2 A;  1MFT A;  2PGD A;  2H88 D;  4PV1 D;  1J1D B;  1ZP0 D;  1FZA A;  1QL2 A;  1PGQ A;  1NOH A;  2P58 A;  3OAK A;  1UIX A;  1KYO I;  1GK4 A;  2K37 A;  2R3C A;  1URQ C;  4EI2 A;  3PHL A;  4PD4 H;  2LXB A;  2Q9I A;  1AA0 A;  1NEK C;  1KQS O;  1DH3 A;  4IFM A;  2H7H A;  1LNQ A;  3SFD D;  3KYQ A;  4QMA A;  2Q7C A;  1JY3 P;  4HJG H;  2GUS A;  2FYN B;  1EZV E;  4FJV A;  1NTZ G;  2FYN C;  3KXD A;  2FYU D;  3HRN A;  5KLV K;  2FKW B;  1NTK K;  4JBZ A;  1YJ9 P;  2ZVN B;  4DDG A;  1YYC A;  5L8R J;  2ZYA A;  3EFG A;  3U59 A;  1ZP0 C;  3ABV D;  1OW6 A;  4H44 C;  1LWU A;  1X0T A;  1ZOY D;  1PL5 A;  1N7S A;  2JP3 A;  3AEE D;  1OFC X;  1KQG B;  1BE3 D;  1M1J B;  2POH A;  3I56 P;  2C9L Y;  2Q1K A;  3CLQ A;  1OX3 A;  1M57 D;  4WBA A;  5AW6 B;  2AXC A;  2Q3I A;  2HFE D;  3B5N C;  2R5B A;  2KIK A;  2AXT E;  2JDI H;  2M3B A;  1JTH A;  1BCC J;  2CK3 H;  1L0L D;  1HGZ A;  2XKM A;  4IOI H;  4PJ0 E;  2WDQ C;  4N3Y B;  1NTM D;  3SWY A;  1GU5 A;  2OGU A;  4YSX C;  1PP9 D;  2YO3 A;  3PP5 A;  1J1E B;  1IJD B;  2Z5H A;  2WSE J;  2KK7 A;  3L70 D;  3A0H E;  1HJ0 A;  2N1T B;  4LDT A;  4A7P A;  2H8P D;  3TSI A;  3P4S C;  2QG4 A;  2O01 H;  1JY2 O;  3USS A;  4OGQ C;  1NTZ E;  1QX8 A;  1SQP J;  2ZJS E;  2BEQ D;  1KIL B;  3U1A A;  3HUS B;  3P4S D;  2Y0E A;  2E74 B;  2WU2 D;  3L4F A;  3BCC G;  1J1E C;  1AFO A;  2ZXX A;  5AVT B;  4Y28 J;  3LIE A;  1WT6 A;  4CPG A;  1HWT C;  3VMY A;  1N73 A;  1R5S A;  3V5B A;  5GTI H;  5TIS E;  2FXP A;  2Y9Y A;  1HBW A;  1BE3 J;  1NAF A;  2BCC E;  2P2U A;  1H0T B;  1CW5 A;  1L0N D;  1BDC A;  5CCG A;  3P4Q C;  2W6B A;  2WSF H;  2YNY A;  3H1K D;  4JPZ B;  3AED D;  1VF5 C;  2FFD B;  3IAO A;  1RF0 A;  1SS1 A;  2R44 A;  3Q5P A;  1ZLL A;  2KOG A;  2E75 D;  2E75 B;  4C7N B;  2KNC A;  3L75 D;  5KAF E;  2E5T A;  2QJK B;  3M9B A;  1KF6 D;  3P4R D;  4UB6 H;  3E1R A;  1NKN A;  4ZKP A;  1LGH B;  3VMA A;  4YSY C;  3TGU E;  4GT1 A;  2E75 C;  2WDR D;  1GTW A;  3B5N D;  3FWN A;  2ZFC A;  1EDJ A;  5AW7 B;  3G4S P;  4PV1 B;  1FZC C;  1ZME C;  1DEB A;  1H89 A;  2WPV B;  4H44 B;  3L37 A;  2FFD C;  2CPB A;  1URQ B;  1SQQ D;  2FYU G;  1M1K Q;  2WMM A;  2D2C D;  2Y0C A;  1SFC D;  1S4X A;  2QJY C;  2H89 C;  3HE5 A;  3PTZ A;  3CL3 D;  3P7K A;  2HPC A;  5APU A;  3I5C A;  1YJN P;  2WSC J;  3L36 A;  3W68 A;  1AV1 A;  4H0L B;  1SQP G;  3VP8 A;  1SQQ E;  4H0L D;  3NTN A;  1L0L G;  1T2K D;  5KLI B;  1SQV K;  3QH9 A;  3JCU H;  2FYU J;  3A7O A;  3FXE A;  4GOE A;  1PPJ D;  3VR9 C;  3VMX A;  3CWB G;  1EZV D;  1YIT P;  3RL0 D;  2ITA A;  3P8C E;  2L5G B;  2ZYG A;  2KYV A;  2BCC J;  3RK3 C;  3R4Y A;  3VMZ A;  1LT9 B;  4NPD A;  4HH2 A;  3A2A A;  1T3J A;  3TGU G;  3MUD A;  2DW3 A;  1IO4 A;  4EYY Q;  4YT0 C;  2YKQ A;  1KB9 D;  2WDV D;  1NO4 A;  3AE1 D;  1VQ7 P;  3W67 A;  2WWW A;  3HD7 A;  4N78 E;  3WU2 E;  4C7N A;  3AE4 C;  2WU5 D;  2XDJ A;  4I2L C;  1P84 H;  3L74 J;  1SQV D;  1PP9 J;  3H1K E;  1X9V A;  3H25 A;  2O1K A;  2V7Q J;  2A45 H;  3N7N A;  1GW4 A;  3R2P A;  1JCC A;  3CX5 D;  1VQ9 P;  3H32 A;  1KB9 H;  3AE5 C;  5GTH E;  3AE7 D;  3M0D A;  1H88 A;  3UIA A;  4YTN C;  1IFJ A;  2W6A A;  1KZU B;  2WPR A;  3CCM P;  2K9J A;  1E79 H;  3L74 D;  5BU5 A;  2E74 C;  4WY4 D;  2R32 A;  3HUS C;  4WY4 B;  3VRB D;  1YTZ T;  3F89 A;  3L70 J;  4H0L C;  2N1T A;  3TGU D;  5C3J C;  3SFE C;  3CX5 E;  3L73 D;  5APW A;  3M06 A;  3H1L E;  1YTZ I;  4YXW H;  1SQV E;  1HVV A;  3IN6 A;  3AE5 D;  1SQQ K;  5CBO A;  5B5E H;  4OH8 B;  1OMI A;  2NZ2 A;  1JMM A;  2A06 G;  1EDK A;  3V4Q A;  3OJA B;  4HKZ H;  1NTK E;  1BCC G;  2FBW C;  2J5U A;  3M9Q A;  3H1J E;  3IF4 A;  4DT0 A;  2K88 A;  1QVF O;  2A45 I;  1RF0 C;  1SQX E;  3AE6 C;  1J2J B;  2K9J B;  1EDL A;  2O01 J;  1JB0 J;  1KOR A;  3MTU E;  4GIF A;  2IBZ E;  3S9O A;  2RH0 A;  2IBZ D;  2M5A B;  5AW3 B;  1ZV8 A;  1M90 Q;  4JQ0 D;  4O9B A;  2FFD A;  2WT7 B;  5APQ A;  2B87 A;  3AE9 D;  3L75 G;  3ZDM A;  3HE4 B;  1QEX A;  3GMA A;  3D71 A;  3CC7 P;  1LT9 A;  3H32 B;  1PIX A;  1FC2 C;  2UWJ E;  1XTG B;  1S9K D;  2OTJ P;  4GDO A;  3TNU B;  1W5C E;  1LT9 C;  2KSE A;  1IFN A;  2AEJ A;  3B71 A;  3KHU A;  1FZE A;  5AVR B;  4DHJ A;  4YSZ C;  1P84 I;  1BSN A;  3VN0 A;  2HG5 D;  1YQ3 D;  3E7K A;  1GDT A;  1SQX G;  3VRA C;  2H89 D;  3VR9 D;  5AW2 B;  2VRS A;  3H1I E;  3Q5R A;  1MZ9 A;  3KDP B;  3RGU A;  1GL2 B;  5M1B A;  3L72 G;  1URQ A;  1NWQ A;  3ITK A;  2ZAE B;  2LKM A;  1RE3 C;  2E5Y A;  3VTP C;  4TLF A;  3V2R A;  4W7Z A;  3L75 J;  3SWK A;  3H1J J;  4M3L A;  3CI9 A;  2W6J H;  2P10 A;  4HYT B;  1Q90 D;  2WVR A;  1NTM J;  1KQF B;  2Y9Z A;  1K73 Q;  1QLE D;  3L71 G;  3WUT A;  3VON A;  2OYH B;  5AVZ B;  4NPE A;  3LW5 J;  1VL2 A;  1RE4 A;  4KX6 D;  1DIP A;  2QEX P;  5KKZ C;  1N86 A;  3CCV P;  2OTK E;  4LGD E;  3H1L J;  1VQL P;  2WSE H;  3O8Z A;  1LP1 A;  2WDV C;  3WMM 0;  1EXJ A;  3H1H E;  5DJU B;  1M8O B;  3MZW B;  1U7M A;  5BVZ A;  1WMK A;  3BCC D;  2K1A A;  1NU1 J;  4EOT A;  1G2C A;  3AE4 D;  2MKV A;  5KAI H;  3H1J D;  2Q3E A;  1NH4 A;  2KLU A;  2FXM A;  2R3S A;  2M3E A;  3AE1 C;  2JKV A;  1SQB K;  1NEN C;  1FS0 E;  2K3R A;  3WUU A;  1VDF A;  2M5A A;  4YTM D;  4L75 A;  1LTJ B;  3PRJ A;  1KMI Z;  1VQ5 P;  1ZOY C;  2W83 C;  3A0H H;  1TU3 F;  3ABV C;  1L4A C;  5AVS B;  1AJY A;  1W2E A;  1FU1 A;  3CX5 H;  5GTI E;  3CWB E;  2HR3 A;  2E76 B;  4BRY A;  2I1J A;  1NTM G;  1KIL C;  2Z4E A;  2E76 C;  2E76 D;  2A06 D;  1MUU A;  1N73 B;  5E79 E;  3BAT A;  1NTZ D;  3WU2 H;  4D6T E;  4H13 C;  3TF5 A;  4RO0 A;  2N9Y B;  1SQX K;  4PD4 I;  5DJT B;  3HUS A;  3M9H A;  4H13 D;  1AVO A;  3L74 G;  1X8Y A;  1YHQ P;  2G3A A;  1DD3 A;  4UB8 H;  1K04 A;  3AE9 C;  1L0N G;  1GK6 A;  2P7J A;  2YMY A;  1SFC C;  1K05 A;  2PP6 A;  1NTZ J;  3H1K G;  3AEA C;  1L0V C;  1AVY A;  2QSI A;  4UB8 E;  1KF6 C;  1QVG O;  3CXH E;  3AE3 C;  2ACZ C;  1KFN A;  4BWN A;  3AEG D;  3B8E B;  4PJ0 H;  1FBM A;  1X22 A;  1RE4 C;  5KJ7 A;  2ZVO B;  3H1H G;  3CXH H;  5AVU B;  3L73 J;  1LTS C;  1KYO D;  2KSJ A;  1RF1 A;  1FDM A;  4KX6 C;  2M0B A;  3EFF K;  1TFF A;  1KB9 E;  1ZRT E;  2IZ1 A;  3H1J G;  3CD6 P;  3TNU A;  2L91 A;  1HUC A;  5APS A;  5APV A;  4IL6 E;  1CZQ A;  3CCR P;  1S5L X;  2BS2 C;  1H0T A;  1PGP A;  1YQ3 C;  1SQQ G;  1PPJ E;  1L0L J;  1BGY D;  5KLV D;  4D6T D;  2QA4 P;  1FJK A;  3NFQ A;  4L74 A;  1S9K E;  1KQL A;  5KLI C;  2ZXE B;  1KIL D;  1FOS F;  1JTH B;  3VRA D;  3GHG B;  5AW0 B;  2A06 E;  4DDI A;  4YTN D;  3CPW O;  1BGY J;  3KPE A;  5KLV J;  1VPC A;  2KLV A;  5KJ7 D;  2OAR A;  3GW6 A;  4PD4 E;  1L4A B;  1IFM A;  4Y99 C;  2V7Q H;  3OW2 O;  3CC4 P;  3D6Y A;  4ZNC A;  4D6T J;  3L74 E;  1LTG C;  1N7S B;  1RQV A;  2H88 C;  2AXT H;  2WDQ D;  1WRG A;  1SQP D;  1NYH A;  1VQO P;  2OYO A;  1MFZ A;  3AEF D;  1GU4 A;  1AQT A;  4LC1 A;  5H2F H;  2OTL P;  4YT0 D;  3CCU P;  1RF1 B;  4ZKU A;  2O3J A;  3U1C A;  1JY3 O;  3T97 A;  2NRG A;  2HLO A;  3GHG A;  1RH5 B;  3AEG C;  1HJB A;  3Q1M A;  2YXR B;  1BDD A;  5B66 H;  2O01 N;  2P1J A;  4GOD A;  1OW7 A;  1VF5 B;  3S1K A;  3AEB D;  4AYC A;  4H44 D;  2FYU K;  4UB6 E;  1FDI A;  2XNX A;  2WIT A;  3NMD A;  1ZR2 A;  3CIR C;  3SWF A;  1VQK P;  1MKM A;  3P8C D;  5CCH D;  4WB4 A;  2JEE A;  3KZI E;  2J59 M;  1JUN A;  2RN0 A;  3AED C;  2QM7 A;  1GL2 D;  1KN7 A;  1KIL E;  2WU2 C;  4TT3 H;  2XND H;  4OWF A;  1FZC B;  1H8A A;  1P84 D;  3H1I G;  1YQ4 D;  1R5L A;  3P4P D;  1XTC C;  2FY8 A;  2QJP C;  1YJW P;  3HTK B;  3T97 B;  1USE A;  2KS1 B;  3CWB D;  3EWK A;  4YSZ D;  1JMB A;  1NEK D;  3VRB C;  3TYY A;  1FAV A;  3RL0 B;  2PFX A;  3E1I A;  1T8Z A;  2N1T C;  3L35 A;  2KI7 B;  1JO5 A;  2QJK C;  3A0B E;  3P4R C;  3TGU J;  1GD2 E;  3MHV A;  2A45 G;  4OGQ D;  2I1K A;  1Y8A A;  2JR8 A;  1LWU C;  1KYO E;  1FZG A;  3A3Y B;  3JC2 2;  2OYI B;  2B76 D;  1BGY G;  5KLV G;  2QM8 A;  4EIJ A;  2W27 A;  1NTZ K;  3HE5 B;  2V4H A;  1W2B O;  1HGV A;  1T3U A;  4U3F E;  1ZR4 A;  3RK3 B;  2KP8 A;  2Q5U A;  1L0N K;  3CXH D;  3RK3 D;  1E7P C;  2NPS B;  4W80 A;  3V2P A;  1GW3 A;  4ZMD A;  1SQP K;  4ASV A;  2IBZ I;  2Z5I A;  1SQV J;  3KQG A;  3H1L D;  3L75 E;  3WUV A;  1PZQ A;  1BSH A;  5EFW B;  2JO1 A;  1JY2 N;  3C9I A;  1OVV A;  1N7S C;  1GL2 C;  2KUB A;  2SPZ A;  3B4S A;  1FDO A;  4GOF A;  3G71 P;  3Q3D A;  2BS3 C;  1QGK B;  4IL6 X;  4DOJ A;  2KXP B;  1GL2 A;  1KFY C;  3M0A A;  1IZN B;  4AUW A;  1RQU A;  3N4X A;  1EC5 A;  5B5E E;  4KHX A;  1OVU A;  1JEK A;  3L73 G;  1FZC A;  1CI6 B;  3PJS K;  3F5H A;  3O6Q A;  2ZT9 D;  2OYI A;  2AEM A;  2IFN A;  3HTK A;  3IFM A;  3GHG C;  5AW1 B;  2JWA A;  2ZT9 B;  2N9B A;  1KIL A;  3FX0 A;  1PFI A;  4I7Z B;  1OWA A;  1D7M A;  3GF7 A;  3RK2 B;  1N7L A;  2ZT9 C;  3CX5 I;  4C7R A;  3V2N A;  3RK2 D;  4H13 B;  1E5W A;  1FJP A;  2QIW A;  1VQN P;  1L4A D;  1BGY E;  2XV5 A;  5KLV E;  5K5G B;  4I6L A;  1GZL A;  3RK3 E;  1N73 C;  3GLM A;  2FBW D;  2C0W A;  2KS1 A;  2IPP A;  1LTI C;  2WU5 C;  1OW8 A;  3VR8 C;  3TK1 A;  1IK7 A;  3CCQ P;  3AE8 D;  2QVA A;  4HB1 A;  2WS3 D;  2QJY B;  1A02 F;  2KZJ A;  3FXD A;  2P67 A;  2CPS A;  4D6T G;  2IBZ G;  2WQY C;  3HD7 B;  3KZI H;  2C9N Y;  5AW4 B;  4YTP C;  1USD A;  1JY2 P;  4KT0 J;  1Q82 Q;  1FOS E;  1DX7 A;  1Q2N A;  3H1H D;  3P8M C;  1S72 P;  2NPS C;  1S1C X;  1KD1 Q;  2IYO A;  1OVR A;  4WWI A;  2QRX A;  3L71 J;  2Q6Q A;  5APX A;  3BVH A;  4W7Y A;  2K9Y A;  4YXD C;  1Q81 Q;  1IFD A;  3VP9 A;  4R4L A;  1LJ2 A;  2PRR A;  1L4A A;  3HE4 A;  3A5T A;  1KV4 A;  5CBN A;  5AVV B;  1HH0 A;  1QL1 A;  3H1I J;  3OA7 A;  3RK2 C;  1PP9 G;  1YIJ P;  3GG2 A;  3CCE P;  3C8V A;  3L70 E;  5TIS H;  1N2D C;  1SQP E;  3MUD C;  1KFM A;  1PP9 E;  3PLN A;  3NXS A;  1ZW0 A;  1VQ8 P;  1NHL A;  1PV3 A;  2BEZ F;  1NTM E;  3IR9 A;  2QJP B;  5E79 H;  2YO2 A;  3O6Q B;  2W90 A;  1S5L E;  4U3F J;  1KFY D;  3JCU E;  5KJ7 C;  2WSC H;  1A02 J;  5BU8 B;  3FWL A;  2ZYD A;  4IFF A;  3CCS P;  2IYP A;  1YI2 P;  3I55 P;  2OYH A;  3MD0 A;  1KC8 Q;  1NJI Q;  5KAF H;  3JSV C;  1SQX D;  1M7L A;  3AE2 D;  3LID A;  4OGQ B;  1JM0 A;  4MN4 C;  1OZH A;  5CHX A;  1SQQ J;  4DJG A;  1EZV G;  5AVQ B;  3K5B A;  3VYI A;  4N78 D;  1NTK D;  1NGM B;  4R4M A;  2FYU E;  5CCH A;  1NU1 K;  1NVO A;  3CME P;  2IZ0 A;  5KTB A;  1S3J A;  3VOP A;  2H43 A;  3PH0 A;  3BCC E;  4JYB A;  1OIP A;  4Z1M H;  1JOC A;  1SLQ A;  5C39 A;  1FE6 A;  3D6Z A;  1RHZ B;  1RF1 C;  1FZB A;  3RL0 C;  1VF5 D;  1BCC D;  1PPJ G;  2C0X A;  3L71 E;  2OYH C;  2BCC D;  1VQP P;  2G8Y A;  3P4Q D;  1L0V D;  3FGA D;  1K8A Q;  1L0L K;  4JF7 A;  4IFD K;  4C46 A;  1M1J C;  1P84 E;  2QE7 H;  3CIR D;  2D2C B;  1SFC B;  2NPS A;  5B66 E;  4B86 A;  2FXO A;  1LTJ C;  2WPS A;  4GKG A;  4PV1 C;  4L73 A;  1Y9B A;  1RY3 A;  2WSS H;  3H1K J;  3A0B H;  1NU1 D;  2B9B A;  3CC2 P;  2WTY A;  2HYN A;  1NTK J;  3AEB C;  2B89 A;  1CI6 A;  2RKL A;  1LTJ A;  4WY4 A;  3SFE D;  1PGJ A;  5AW5 B;  4ASW A;  2WDR C;  5AVW B;  1MV8 A;  2Y0D A;  4KJM A;  2BS4 C;  4YSX D;  3G6E P;  2W8Z A;  2I8D A;  5CJ4 A;  3H6P A;  4U3F D;  2RMZ A;  4L76 A;  5C2T D;  4DHI B;  1BE3 G;  5KKZ B;  2HOD B;  4U7J A;  4YTP D;  1K9M Q;  2IX7 C;  4I1L A;  2WQY D;  3C1L A;  1L2P A;  3BRT B;  1J1D C;  4U3F G;  3G3Z A;  2YXQ B;  1LT1 A;  1DEE G;  2GA1 A;  4K35 A;  5H2F E;  2OQQ A;  2NPS D;  1Z56 A;  3L72 J;  3LW5 H;  2KNC B;  5AW8 B;  5C2T C;  4NPF X;  3CMA P;  1SQX J;  3AE8 C;  1SQV G;  1Y47 A;  1LWU B;  1L0N J;  3VR8 D;  2R5D A;  1T6A A;  2B88 A;  2E42 A;  1NU1 G;  1UII A;  2WT7 A;  1JNM A;  2M8R A;  2B87 B;  2WS3 C;  3BRV B;  3P4P C;  5CJ0 A;  4I7Z C;  1YQ4 C;  4PD4 D;  4Y99 B;  1IC2 A;  1L0N E;  2LR2 A;  2JWD A;  4BXL A;  3B5N A;  3CCL P;  4WVZ A;  4DHZ A;  2WP9 C;  1S2E A;  1PGO A;  1QLB C;  2KB7 P;  1BCC E;  3D70 A;  1YBK A;  4JYC A;  5CMZ A;  5TJH A;  2WP9 D;  1CSB A;  4YPC A;  3SFD C;  2AEF A;  2E74 D;  4WY4 C;  2BAS A;  4DCK A;  1SQB D;  1SFC A;  3QWO C;  1VQM P;  4K3A A;  2XZR A;  2YMK A;  4AQR D;  2GUV A;  2WSF J;  1LTA C;  2D2C C;  2YIU B;  1EZV I;  1HF9 A;  1KYO H;  1ZXG A;  1EXI A;  2JJL A;  1OXZ A;  5CCH C;  1N7S D;  1G1J A;  4N6J A;  3L72 D;  2LXC B;  1M1J A;  3CWB J;  3Q5S A;  1N8R Q;  1LTT C;  3MP7 B;  2O1J A;  3Q2Y A;  4XA4 A;  1HTL C;  1ZRT D;  4XE5 B;  4YSY D;  3H1I D;  2MJZ A;  5CCG C;  1GMJ A;  3HD7 D;  4EDF A;  4XFJ A;  3L72 E;  2E43 A;  1VQ4 P;  2OYI C;  3HD7 C;  1L0L E;  3AEA D;  3L70 G;  3H1H J;  1M56 D;  1Q86 Q;  3SSU A;  3BAS A;  4RES B;  1EDI A;  2B76 C;  3AE2 C;  1Q7Y Q;  3AEE C;  3GF3 A;  1R8E A;  1X79 B;  3AE3 D;  2ACZ D;  5APT A;  5C3J D;  1SQB E; 
#chains in the Genus database with same CATH homology
 5KKZ C;  3ABV D;  3AE6 C;  1OW6 A;  2G3A A;  4H44 D;  1DD3 A;  4H44 C;  1K04 A;  2O01 J;  3AE9 C;  1KOR A;  1JB0 J;  2YIU C;  4YTP C;  1ZOY D;  1FDI A;  2FXP A;  3S9O A;  1PL5 A;  3AEB C;  2WSC J;  4KT0 J;  2WDV C;  1QLB C;  1EXJ A;  2JP3 A;  3AEE D;  1K05 A;  4YTN D;  1KQG B;  3AEA C;  3CIR C;  3AE6 D;  3AE5 C;  3D70 A;  3SFE D;  3AE7 D;  4H0L B;  1U57 A;  2QSI A;  1L0V C;  1WMK A;  3AEF C;  1MKM A;  3AEC C;  2WP9 D;  4YTN C;  2WDR C;  2JO1 A;  3AE9 D;  3P4Q C;  2E74 D;  4H13 D;  3SFD C;  1KF6 C;  4H0L D;  1S1C X;  3AE2 D;  3VRA D;  3AED C;  3GMA A;  3AED D;  4OGQ B;  2BS4 C;  4YSX D;  1VF5 C;  3D71 A;  3AE4 D;  2MKV A;  1PIX A;  1FDO A;  3AE3 C;  3Q3D A;  2ACZ C;  1KIL E;  3D6Y A;  2BS3 C;  2WU2 C;  3AEG D;  4IL6 X;  4TT3 H;  2K9Y A;  2YMK A;  4GDO A;  3IAO A;  2E74 C;  3G9R A;  1KFY C;  2WSF J;  1RQV A;  1YQ4 D;  3Q5P A;  2H88 C;  1NGM B;  3B71 A;  2D2C C;  4PV1 D;  2H88 D;  3P4P D;  4R4M A;  4YXD C;  1RQU A;  1ZP0 D;  2QJP C;  2WDQ D;  3VR9 C;  2WDQ C;  1HF9 A;  3VRB D;  2E75 D;  5C2T D;  4YSZ C;  3AE1 C;  1NEN C;  3T97 B;  4H0L C;  4R4L A;  4U7J A;  5C3J D;  1EXI A;  2E75 B;  1NYH A;  1YQ3 D;  4YTP D;  1UIX A;  4Z1M H;  4YSX C;  4YTM D;  3EWK A;  4YSZ D;  1NEK D;  3R4Y A;  4KX6 C;  3SFE C;  2H89 D;  2WQY D;  3VR9 D;  3VRA C;  5C3J C;  3VRB C;  1KMI Z;  3O6Q A;  2ZT9 D;  3AEF D;  3Q5R A;  3Q5S A;  1NEN D;  1ZRT E;  2WSE J;  1KF6 D;  1ZOY C;  5M1B A;  3Q2Y A;  3P4R D;  4YT0 D;  2ZT9 B;  1DD4 A;  3D6Z A;  1NEK C;  1HJ0 A;  4I7Z B;  3GF7 A;  1TU3 F;  3ABV C;  4YSY D;  2ZT9 C;  1AJY A;  3P4S C;  1VF5 D;  3RL0 g;  3C8V A;  4KX6 D;  1GMJ A;  2QJK C;  1DIP A;  2OQQ A;  3P4R C;  4YT0 C;  4H13 B;  2WDV D;  3AE1 D;  3P4P C;  3SFD D;  2G8Y A;  2E76 B;  3P4Q D;  2QIW A;  4XFJ A;  4YSY C;  4OGQ D;  4OGQ C;  3IN6 A;  2P10 A;  2E76 C;  2E76 D;  1L0V D;  3AE5 D;  2E75 C;  1S5L X;  3AE7 C;  3FGA D;  4YTM C;  5C2T C;  2WDR D;  1Q90 D;  3AEG C;  3RK3 E;  3AE8 C;  1PV3 A;  2B76 D;  2BEZ F;  2BEQ D;  2WP9 C;  1KQF B;  3Q1M A;  3GLM A;  2FYN C;  2FBW D;  1OMI A;  2NZ2 A;  3AEA D;  3CIR D;  3AE4 C;  2BS2 C;  2WU5 C;  2D2C B;  2WU5 D;  1OW8 A;  1YQ3 C;  3VR8 D;  3P4S D;  3VR8 C;  4PV1 B;  2WQY C;  2E74 B;  2WU2 D;  1IK7 A;  1ZME C;  3AEC D;  2WPV B;  4H13 C;  4H44 B;  2B76 C;  3AE8 D;  1KFY D;  3AE2 C;  2WS3 C;  2IDB A;  5KLI C;  2FBW C;  2J5U A;  4Y28 J;  3LW5 J;  4PV1 C;  1VL2 A;  5L8R J;  1OW7 A;  2WS3 D;  1VF5 B;  3AEE C;  1ZP0 C;  1YQ4 C;  3GF3 A;  4I7Z C;  1R8E A;  1Y9B A;  4YXD D;  3AEB D;  2D2C D;  3H25 A;  2ACZ D;  4RKU J;  3AE3 D;  1KTM A;  2V7Q J;  2QJY C;  1E7P C;  2H89 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...