3AE1C

Crystal structure of porcine heart mitochondrial complex ii bound with n-phenyl-2-(trifluoromethyl)-benzamide
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with N-Phenyl-2-(trifluoromethyl)-benzamide
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 47
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3ae1C01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3ae1C02
3AE9C 3AEDC 4YSXD 3ABVC 2FBWD 2WU5C 2H89D 3VR9C 1KFYC 1KTMA 3AE2D 2H88D 3AEAC 2WDRC 2ACZD 1KF6D 3AE4C 2WQYD 3AE3C 3AE1D 4KX6D 5C3JD 3VR8C 1NEND 4YT0C 3AECC 1NEKC 1E7PC 2WU2D 4YTMD 2WS3D 4YTND 3S9OA 3AEGC 2B76D 4YXDC 1L0VD 3VRBC 2WDVC 3AEFC 3P4PC 1K04A 5C2TC 2FBWC 2H89C 3AE6D 3AE2C 3VRAD 3AE5C 2WP9D 2H88C 3P4QD 2ACZC 1KF6C 4YSYD 1ZOYD 3SFED 3AE8C 2WQYC 3AE1C 4KX6C 3AEEC 2BS3C 3SFDC 1NENC 4YTPD 3AEBD 2WU2C 1OW6A 3P4SC 4YTMC 3P4RD 2B76C 1L0VC 3CIRC 1YQ4D 1YQ3D 3AEAD 2WDRD 4YSXC 1ZP0D 3AE3D 3AE6C 3VRAC 3AE7D 1OW8A 3P4QC 5C3JC 4YXDD 2G3AA 2BS4C 4YSZD 2WDQD 4YTPC 3AE9D 2WDVD 3AEBC 3AEDD 1QLBC 3AEFD 3ABVD 3P4PD 2WS3C 4YTNC 1K05A 2WU5D 5C2TD 3P4RC 3VR9D 1KFYD 3AE5D 1YQ4C 1PV3A 1YQ3C 3AE4D 1ZP0C 3AE8D 3VR8D 3AEED 2BS2C 4YT0D 3AECD 2WP9C 1NEKD 3SFDD 3VRBD 3AE7C 1OW7A 4YSYC 1ZOYC 3SFEC 3P4SD 3B71A 3AEGD 3CIRD 4YSZC 2WDQC
chains in the Genus database with same CATH superfamily
4KHXA 3CL3D 1L4AC 3IF4A 4LGDE 1KFMA 4H13D 2E42A 3H1KG 3BCCD 5B5EE 1PFIA 1L4AA 3RK2C 2QSIA 3H1KJ 2BASA 2B9BA 4PJ0E 2PGDA 2PAJA 2W27A 4WY4C 1IK9A 3SWKA 1L0LG 4LC1A 4Z1MH 1Y9BA 1NTKD 1OIPA 2WPVB 4M3LA 3CX5H 3T97A 4EI2A 5AW2B 4WY4A 4L76A 1L0LJ 2Y9ZA 2PP6A 3WMM0 2BCCG 4GKGA 5GTIH 1NWQA 1SQQD 1LTGC 1QVFO 1QX8A 1RE3C 2WSEH 1DD4A 2BCCJ 4N6JA 2G3AA 2RMZA 1HBWA 3GLMA 2W6BA 3M9QA 1NTMK 1S5LH 3H1JD 1QGKB 4I6MC 1PPJG 2M5AA 2J58A 3SFDD 3FXEA 3AE7C 1KFNA 5CCHD 3OJAB 5APWA 1Q2NA 1PL5A 2NPSA 3L70E 4QMAA 2FBWD 2KSEA 3B8EB 3GF7A 2O01N 2R5DA 3KDPB 1HGZA 1ZXGA 5KKZB 3GW6A 1YI2P 1N2DC 1URQD 2NZ2A 2ZAEB 2XNXA 3B5NB 1L0LD 1NTMJ 3MUDC 2IBZI 3EFGA 5C39A 4LDTA 2H7HA 2YMKA 1KN7A 3L4FA 1PGOA 2WPQA 3ZDMA 5KJ7C 3AE8C 5KLIC 2K9YA 1NOHA 3MUDA 1JMBA 4N3YB 2LKMA 2KYVA 1KQSO 3L73E 3NMDA 3QWOC 3A2AA 5KJ7A 3L72E 3RK3E 4PV1D 1WRGA 3HE5B 3USSA 1QLED 3CWBE 2ZVNB 3FWNA 1ZRTD 4I2LC 3PLNA 1XTCC 3P4PD 1X0TA 4B86A 2IBZD 1PPJD 5AVSB 3VR8D 3RGUA 3UIAA 1FZEA 2B87B 1IFMA 1EZVI 4XA4A 2WP9C 1FZGA 4H0LB 4YSYC 4XFJA 4RKUJ 2JWAA 4L75A 3D6YA 4H44B 2POHA 3AE9C 5AVZB 1VQ6P 1MFTA 2AEFA 1KFYC 3BASA 1NTMD 1YJNP 1X9VA 1KB9D 3TSIA 2N1TD 2HYNA 1KV4A 2LXCB 1MFZA 2WS3D 2YKOA 3VMAA 2GM4A 2B76D 4OGQD 2OYIB 1GL2A 4GDOA 5KKZC 3R4YA 4GIFA 1SQPD 1VDFA 4DZOA 3VOPA 3JCUH 4EDFA 1EZVD 3W67A 3VP8A 1YBKA 3B5NC 2L91A 3SWYA 4OWFA 1OW6A 2FFDB 3WU2E 1OZHA 4A7PA 2PFXA 4DCKA 2A45H 3B5NA 1KMIZ 1HJ0A 1S2EA 1VQOP 4R4MA 3H6PA 1PGPA 3H1IE 1KILA 5KAIH 3IFMA 2G8YA 1TFFA 3AEFD 3L37A 1JY3P 1M56D 4IL6E 3HE4B 2JDIH 2BS2C 3HE5A 2JP3A 5AVTB 3KQGA 2WDQC 3KHUA 1R8EA 1GTWA 4DT0A 3VR9C 1AJYA 4C7NB 3AE2D 2H88D 1BDCA 4DHIB 3H1KE 1DIPA 3KZIH 2B87A 5BVZA 3CCSP 3H32A 2D2CB 1N7SB 3L70G 1NTZK 2WSCJ 1AQTA 3L36A 1FZFA 3L70J 1KQLA 3AE1C 1OMIA 2OYIC 1P84H 1FOSF 5B66H 4PD4H 1AVYA 1Q86Q 2OYIA 3H1HE 1SFCB 2BEZF 2BCCE 1KYOE 3VRAC 3RK2D 2FFDC 1IZNB 1NTZG 3GF3A 5C3JC 3CCJP 1LTBC 2ZYDA 1S9KE 3L73G 2K3RA 3L72G 2RH0A 3OAKA 1JUNA 4ASVA 1FC2C 3P4RC 3IN6A 1LP1A 2FFDA 1NTZJ 3CWBG 5AW5B 4HYTB 1VL2A 2K37A 3L73J 3L72J 1IFNA 3FX0A 1IFPA 1FDOA 2Q1KA 1NGMB 3CWBJ 1VQ9P 3TDKA 1T3UA 4XE5B 4ZNCA 3M06A 3V4QA 2H89D 3NTNA 2KS1B 4JBZA 2WDRC 3Q5RA 1D7MA 2ACZD 2E75B 2JR8A 1FJKA 1FZAA 1IFDA 3PP5A 2A06G 4YXWH 3BVHA 4K3AA 3L70D 2OQQA 3S4RA 5AVYB 3II6A 3LW5H 2QJKB 3VRBC 1N7LA 2KK7A 1HJBA 3TK1A 3S1KA 2Y0CA 2D2CC 4WY4B 4C7NA 1N7SC 2GA1A 3Q3DA 3AEEC 3QH9A 2QG4A 2WWWA 3V2NA 2QJPB 4C46A 1LTTC 5DJTB 4YTMC 1BSHA 4W80A 3CCVP 3RL0D 1L0VC 1N7SA 2KP8A 4RO0A 3CCEP 2QRXA 1OX3A 3VN0A 3L73D 1GK4A 3L72D 3N4XA 4YSZD 3RK3D 2O1JA 5KTBA 2I1JA 4YTNC 2WSFH 2WPRA 3CWBD 5GTHE 3P32A 4JYBA 1VPCA 2KI7B 1WMKA 2M5AB 4W7YA 3AE8D 4WBAA 3H1IG 1LT9A 1PIXA 1A02J 1Q90D 2NPSB 3AEDC 2UWJE 3H1IJ 4I1LA 4HJGH 3A0HH 1GDTA 4NPEA 3H25A 1YHQP 3HD7D 1PZQA 1MUUA 4NPFX 1OVRA 2XKMA 3AE3C 4EOTA 2Q7CA 5CBNA 1E7PC 4JPZB 2IZ0A 1L0NG 1AV1A 4YPCA 1VQMP 1H8AA 3RBZA 3L74G 1IK7A 2YXQB 3CXHE 2A45G 2HPCA 2E75C 2OYOA 2KUBA 3KYQA 1DH3A 1VQ5P 3AE5C 4ZKUA 2WP9D 5KAFE 1UIIA 3MD0A 1BSNA 2AXCA 1KF6C 1JY2O 4YSYD 2ZYAA 2KS1A 2K9JA 2WQYC 1T3JA 1GZLA 1T2KC 2QJKC 1NENC 3A3YB 2P1JA 3U1AA 2BEQD 5KLIB 4L73A 1SQXE 1NAFA 2FYNB 1H89A 2KOGA 1U57A 1H0TB 4JF7A 1ZP0D 1N73B 2QJPC 2I1KA 1K9MQ 4RESB 1Y47A 5AVRB 2HODB 3H1HG 4JQ0D 2C9NY 1YQ3C 2WVRA 3H1ID 1MZ9A 2OTKE 2P7JA 2V7QH 5AVVB 3B5ND 2ZJSE 3H1HJ 1ZOYC 1EDKA 3EQ2A 4U3FE 1PGQA 1EXJA 1S72P 1USDA 5AW8B 2XV5A 4N78E 4BXLA 3AE4C 3WUUA 1W2EA 3WUTA 2NPSC 2XDJA 3CX5E 2NRGA 4YT0C 2IFMA 3FWLA 2JKVA 2J59M 1NU1E 2OTLP 2CPBA 1GL2B 4DJGA 1LWUA 2M0BA 3CCMP 4GOFA 1RHZB 3OA7A 1JTHA 1U7MA 3H1KD 5GTIE 3TGUE 5AW4B 3KXDA 2HFED 3AE6D 2CK3H 1A02F 3D6ZA 3CCUP 3V2QA 1PP9G 1FS0E 2OYHB 4OH8B 1UIXA 5APUA 3WUVA 2QEXP 2E43A 1JCCA 1VQNP 4H0LD 1S5LE 1PP9J 4H44D 2KSJA 1KILB 1ZW0A 1JMMA 3P4QC 1DEBA 1GD2E 2FYNC 1NTZE 3H1HD 3AEBC 1EXIA 1QLBC 2HG5D 1N73C 3ABVD 2BCCD 1KYOD 4DOJA 2ZT9D 5CCGA 1YQ4C 1S9KD 1KB9I 1H0TA 3VP9A 3AECD 1N73A 2AXTH 1G2CA 3AEGD 3MTUE 1LJ2A 3HTKA 2IPPA 1JNMA 1QEXA 3CI9A 2WU5C 1OXZA 2HODA 2Q9IA 3PJSK 3LW5J 3M9BA 3H1LE 5C3JD 3H32B 2Z5IA 2ZXXA 3SSUA 1S4XA 1M7LA 2WU2D 2ZYGA 4LLHA 1NJIQ 2R3SA 2A06E 2H8PD 4AUWA 4D6TE 5KLVE 2Q5UA 1ZLLA 2FXPA 1VF5D 1Q82Q 4H13C 3Q5PA 1SQXK 3LIDA 1N86A 1GL2C 1T8ZA 1GK6A 1GU5A 3O8ZA 2W6AA 4YTPD 2P58A 5AW7B 5BU8B 2KB7P 1R5LA 1Q7YQ 2WDRD 4YSXC 1FU1A 3EWKA 2IFNA 4DDIA 2OYHC 2O01J 1SQBE 2J5UA 1BGYG 1SLQA 1M1JB 4PV1B 1ZV8A 1SQXG 1SS1A 4KJMA 2E74D 1LP1B 2HLOA 2OYHA 4UB8H 5H2FH 4U7JA 4RJTA 1KILC 1SVFA 1SQXJ 3AEED 3IAOA 1NEKD 2WTYA 1BE3G 2WSSH 1CSBA 3V2RA 4UB6H 2Q3EA 3K5BA 3MIWA 3CD6P 3M0DA 3L75E 1VQKP 1NU1K 4W7ZA 2QA4P 1K73Q 3F89A 1QVGO 1KILE 2W6JH 1BE3J 4KX6D 3JCUE 3BATA 1FDMA 1JY3N 4U3FG 5AVQB 5CCHC 1SFCD 4YTND 4IL6X 4YXDC 2N1TB 1L0NE 1K04A 3L74E 2FBWC 4U3FJ 4IFFA 3A0BH 2QM7A 3P8MC 5CCHA 2Y0EA 4OGQB 5TISH 2FXMA 3FGAD 3C1LA 1NU1G 3CXHD 3F5HA 2GUVA 1YTZI 5KAIE 1K8AQ 3TGUG 3PTZA 1NU1J 1AFOA 2QJYB 5E79H 2IYPA 1JY2P 5APXA 3M9HA 3AE3D 1WT6A 2FXOA 2P2UA 1URQA 3TGUJ 3CCRP 1J1EB 1SQXD 2OTJP 1E79H 2BS4C 4HB1A 2WSEJ 1L4AD 2KIKA 1K05A 3AE5D 1RQVA 1M1JC 4C7RA 1LT9B 4PV1C 2L5GB 3FXDA 1T2KD 1VQ8P 2WZ7A 3GMAA 3SFEC 3KZIE 2LR2A 3CMEP 2ITAA 1M1JA 2K88A 4WY4D 5M1BA 5CJ4A 2E76B 1IC2A 3D71A 1KTMA 1IFIA 5KLVK 5AVXB 2XZRA 4GT1A 3VR8C 4U3FD 2B89A 2O3JA 1YYCA 1P84E 2YKPA 3TNUB 1KB9H 1JB0J 2R5BA 5B66E 4PD4E 2HPCB 3G3ZA 1S1CX 2R32A 4N78D 3E7KA 5CBOA 2QE7H 4WB4A 3CX5D 1YJWP 3H1LG 1KZUB 2K9JB 1NU1D 1BCCE 1ZOYD 1T6AA 3O6QB 3CC7P 3VTPC 1KC8Q 2N1TC 1AVOA 5AW6B 4D6TG 1SQBK 5KLVG 2OGUA 3C9IA 3TGUD 1PP9E 3H1LJ 1LGHB 3P4SC 1HTLC 2B76C 3CIRC 4OGQC 2N1TA 4IOIH 4D6TJ 2NPSD 5KLVJ 1ZN5A 1M90Q 1FZCA 1J1DB 3AE7D 3SWFA 5APYA 2FY8A 1X22A 2JO1A 2QJYC 3P7KA 5DJUB 1DD3A 1USEA 1NO4A 2AEMA 4DHJA 3EFFK 1EDIA 1SQBG 1J1EC 5CMZA 1HUCA 3BCCG 4ASWA 1NTZD 3RBXA 5AVUB 1SQBJ 1W2BO 1LT9C 1GU4A 3CC2P 1HGVA 3V5BA 5KJ7D 1L0NK 1NTKG 5AW0B 3HUSB 4BWNA 2E5TA 1LWUB 4DHZA 4ZMDA 2E76C 1Q81Q 3L75G 1NVOA 3S9OA 1JTHB 1OWAA 2WDVC 3H1LD 1AA0A 1QL1A 1EC5A 3AE2C 2H88C 2FYZA 5B5EH 3L75J 1HH0A 2A06D 1W5CE 4D6TD 5KLVD 2Y9YA 4PJ0H 3TNUA 3L71E 2RN0A 1L0NJ 1HVVA 3RL0B 4KT0J 3L74J 1RE4C 1IO4A 1LTJB 1BGYE 1JOCA 3O6QA 3AE9D 1MKMA 1DX7A 1NYHA 1SQBD 2YO2A 1KFYD 1X8YA 1J1DC 1RE4A 3A0HE 3RK3B 1GL2D 1JCDA 3I56P 1M1KQ 1G2CB 1EDLA 3HTKB 3U1CA 2A45I 4WWIA 4YSXD 1BE3E 1VQ7P 4EYYQ 2MJZA 4O9BA 2YO3A 1JM0A 4IFMA 1IFJA 3HD7B 3L75D 2YIUB 2WSCH 2Z5HA 1KILD 3HUSC 5C2TC 1TU3F 2H89C 1LWUC 2WT7A 4I7ZB 3D70A 2FYUE 3M91A 2ACZC 1H88A 1RF0C 3M0AA 4H13B 2FKWB 1L0ND 3P8CE 5EFWB 3HUSA 3L74D 1KYOI 1RE3A 1NKNA 1G1JA 1CI6A 1RF0A 2QVAA 4OVNF 2QIWA 1BCCG 2Y0DA 2IBZG 2ZXEB 3PH0A 2C0WA 1VQPP 2YNYA 4AYCA 1G1IA 1L2PA 1QL2A 4YXDD 1SQPK 2WDQD 1BCCJ 1CW5A 2B88A 2E5YA 3JC22 3VR9D 3RL0C 3I5CA 1PV3A 1P84I 3E1IA 3NXSA 3C8VA 2W90A 2R3CA 4PD4I 1NTMG 1LTJC 3I55P 4MN4C 2ZFCA 1EDJA 5CCGC 1S5LX 4YSZC 3VMXA 3RK3C 1LTJA 2IDBA 1SQPG 3AEAC 1JO5A 5APQA 1HF9A 3AE1D 1MV8A 2YMYA 1FE6A 3KPEA 1SQVE 4K35A 1FAVA 1EZVG 3G6EP 1AQ5A 1SQPJ 3VMZA 2OARA 2N9YB 3CCQP 1FDIA 3HD7C 3VRAD 1P84D 4FJVA 1ZR4A 4NPDA 3TYYA 2YIUC 4PD4D 5AW1B 1GW4A 3SFED 3A7OA 1VQLP 2N9BA 2YKQA 3V2PA 2JEEA 3HD7A 3P4RD 4I7ZC 3OW2O 4I6LA 3GHGB 1OFCX 1BCCD 1BDDA 1URQB 3ITKA 2CPSA 3VMYA 2QM8A 1PP9D 1RQUA 2AXTE 1LTIC 3L71G 3WU2H 2KLVA 2I8DA 1RF1B 1ZP0C 3L71J 1IJDB 2WSFJ 3CPWO 2KXPB 5AVWB 2ZT9B 1OW7A 3NFQA 1J2JB 4L74A 3P4SD 2HR3A 3BCCE 3CIRD 3VRBD 1ZR2A 3MP7B 1BGYJ 1GMJA 3E1RA 5APTA 4IL6H 2D2CD 3M0DC 1N7SD 3G71P 1GW3A 3L35A 2IX7C 2KZJA 2WPSA 3Q5SA 3CXHI 1NTKE 2IZ1A 3CC4P 2FYUK 4YTMD 1EQ7A 4Y28J 1NAYA 1L0VD 1N8RQ 2O1KA 4CPGA 3W68A 1KORA 1OVVA 1X79B 1VF5B 2K1AA 1SQQE 3SFDC 5APVA 1LTAC 3TF5A 3MHVA 3Q2YA 1NH4A 1NKZB 1Y8AA 4UB8E 2ZVOB 5H2FE 1FZBA 3BRTB 2KZIA 2C9LY 2FYUG 3MGNA 2XU6A 1FZCB 1JEKA 1RH5B 4HKZH 3AE6C 3H1JE 5K5GB 4HH2A 2E76D 3L71D 2M3EA 3GHGC 2FYUJ 2GUSA 5TJHA 4UB6E 2WDVD 3AEDD 1URQC 4H0LC 1KYOH 4Y99B 2E74B 3GHGA 4EIJA 1BGYD 5APSA 4H44C 2IYOA 5AW9B 1JY2N 3G9RA 3B71A 3V6IA 3Q1MA 2V7QJ 1SQVK 2BS3C 2E75D 1RF1C 3ABVC 1M57D 3CX5I 3VYIA 1YITP 2ZT9C 4ZKPA 5AW3B 1L0LE 1KF6D 3A0BE 2WQYD 2JJLA 5TISE 1RY3A 4BRYB 3AECC 1RF1A 1NEND 1BE3D 1LT1A 2Z4EA 1M8OB 4AQRD 3CLQA 3AEGC 2VRSA 3A5TA 3P4PC 2Q6QA 5E79E 1SQVG 1ZMEC 4TLFA 2ZFYA 2KNCB 1FJPA 5BU5A 2WU2C 1ZRTE 2XNDH 1SQVJ 2M8RA 2FYUD 3R2PA 3IR9A 1YQ3D 1VF5C 5CHXA 1E5WA 3P8CD 1LTSC 5CJ0A 3G4SP 3RL0g 1OW8A 1YJ9P 1HWTC 2IBZE 1PPJE 3PHLA 4WVZA 1XTGB 3VONA 4YTPC 3N7NA 1FZCC 1KD1Q 2WS3C 5C2TD 1LNQA 3AE4D 1KQGB 1L4AB 2KLUA 4YT0D 4GOEA 2JWDA 3HE4A 1NTME 3B4SA 4DDGA 2DW3A 1VQ4P 1KB9E 2WITA 2M3BA 2W83C 3LIEA 4Y99C 4JYCA 1NTKK 3RK2B 2E74C 2V4HA 5GTHH 3U59A 2R44A 1U7JA 3T97B 5L8RJ 1R5SA 3PRJA 1OVUA 4TT3H 1SQPE 2AEJA 2RKLA 3V4WA 1NEKC 3CCLP 2SPZA 2YXRB 1S3JA 4R4LA 1EZVE 1Z56A 1SQQK 3AEFC 2WT7B 3BCCJ 1SQVD 3MZWB 3GG2A 3HRNA 2WMMA 1KQFB 3P4QD 5CCGD 4KX6C 2MKVA 4IFDK 2P67A 3CMAP 1YIJP 3AEBD 1CI6B 3JSVC 4BRYA 1SFCC 2LXBA 3CXHH 2O01H 1NTKJ 1YQ4D 3AEAD 1DEEG 5KAFH 1SP4A 4GODA 1SQQG 1JY3O 1SFCA 1FOSE 2W8ZA 2KNCA 1CZQA 2WU5D 1SQQJ 3BRVB 3H1JG 2C0XA 1YTZT 2H43A 2Q3IA 1FBMA 1NHLA 1L0LK 2P10A 3H1JJ 1PGJA 2PRRA
chains in the Genus database with same CATH topology
2E75D 2E74C 3AE9C 3AEDC 5M1BA 4YSXD 2IDBA 3ABVC 1R8EA 2FBWD 2WU5C 2E76B 4H13D 2H89D 1GMJA 3VR9C 3H25A 3D71A 1AJYA 1KFYC 3GF7A 1KTMA 3AE2D 3T97B 5L8RJ 2H88D 2ZT9C 3AEAC 2WDRC 2D2CD 3Q5RA 2ACZD 1KILE 1KF6D 3AE4C 3LW5J 2E75B 2WQYD 3AE3C 1HF9A 3AE1D 4TT3H 4KX6D 5C3JD 3VR8C 1DIPA 3Q5SA 1NEND 4YT0C 3AECC 1NEKC 4YSYC 1E7PC 2WU2D 2D2CB 2NZ2A 1JB0J 2QSIA 2OQQA 4YTMD 2E76C 2WS3D 4YTND 4Y28J 3S9OA 3AEGC 4IL6X 1S1CX 2B76D 4R4LA 1IK7A 4YXDC 1L0VD 4OGQD 4GDOA 2FXPA 1VF5D 3VRBC 2E75C 2WDVC 3AEFC 1KORA 5KKZC 3R4YA 3P4PC 1K04A 5C2TC 1TU3F 2FBWC 4Z1MH 1FDIA 1Y9BA 2H89C 4H13C 2WSCJ 3Q5PA 2YMKA 3AE2C 3AE6D 3AE5C 4I7ZB 3D70A 2WP9D 2H88C 3VRAD 2WPVB 4OGQB 1KQFB 2D2CC 1ZMEC 3D6ZA 2ACZC 3P4QD 1KF6C 1VF5B 2YIUC 1ZOYD 3FGAD 4YSYD 3AE8C 2WQYC 5KLIC 3SFED 2K9YA 3AE1C 3Q3DA 3AEEC 4KX6C 1OMIA 2MKVA 4H13B 3SFDC 1UIXA 2QJKC 1NENC 4YTPD 3AEBD 2WU2C 1OW6A 1ZRTE 3P4SC 2BEQD 3Q2YA 4YTMC 3P4RD 2B76C 4I7ZC 1L0VC 3CIRC 4H0LD 4OGQC 1YQ4D 1YQ3D 3AEAD 2WDRD 1U57A 1VF5C 3RK3E 4YSXC 2QIWA 3EWKA 4PV1D 1ZP0D 2WDQC 2BEZF 3AE3D 1KMIZ 1HJ0A 2O01J 4H44D 3AE6C 3VRAC 2QJPC 3RL0g 2J5UA 3AE7D 1DD4A 4KT0J 1OW8A 3P4QC 4R4MA 1RQUA 2E76D 3GF3A 5C3JC 4PV1B 2JO1A 4YXDD 2FYNC 2G3AA 2BS4C 4YSZD 2WDQD 2G8YA 3GLMA 3O6QA 2QJYC 4YTPC 2E74D 2WSEJ 3AEBC 1EXIA 1QLBC 1DD3A 2WDVD 3ABVD 3AE9D 3AEDD 1MKMA 2WS3C 3AEFD 3P4PD 4YTNC 1K05A 2WU5D 5C2TD 3P4RC 1NYHA 3VR9D 1KFYD 4U7JA 3IN6A 2ZT9D 1WMKA 4H0LC 3AE5D 1YQ4C 1PV3A 1YQ3C 1RQVA 3AE4D 1VL2A 2E74B 3C8VA 1ZP0C 4PV1C 3AE8D 3VR8D 1KQGB 3AEED 2BS2C 2WSFJ 4YT0D 3IAOA 3AECD 2WP9C 4H44C 1NEKD 3SFDD 3VRBD 4H0LB 3AE7C 2ZT9B 1OW7A 1PIXA 2JP3A 1ZOYC 1FDOA 3G9RA 3GMAA 4XFJA 1S5LX 3SFEC 3P4SD 2P10A 4RKUJ 3B71A 1Q90D 3Q1MA 1NGMB 3AEGD 2V7QJ 3D6YA 1PL5A 3CIRD 4YSZC 4H44B 1EXJA 2BS3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AE9 C;  3AED C;  4YSX D;  3ABV C;  2FBW D;  2WU5 C;  2H89 D;  3VR9 C;  1KFY C;  1KTM A;  3AE2 D;  2H88 D;  3AEA C;  2WDR C;  2ACZ D;  1KF6 D;  3AE4 C;  2WQY D;  3AE3 C;  3AE1 D;  4KX6 D;  5C3J D;  3VR8 C;  1NEN D;  4YT0 C;  3AEC C;  1NEK C;  1E7P C;  2WU2 D;  4YTM D;  2WS3 D;  4YTN D;  3S9O A;  3AEG C;  2B76 D;  4YXD C;  1L0V D;  3VRB C;  2WDV C;  3AEF C;  3P4P C;  1K04 A;  5C2T C;  2FBW C;  2H89 C;  3AE6 D;  3AE2 C;  3VRA D;  3AE5 C;  2WP9 D;  2H88 C;  3P4Q D;  2ACZ C;  1KF6 C;  4YSY D;  1ZOY D;  3SFE D;  3AE8 C;  2WQY C;  3AE1 C;  4KX6 C;  3AEE C;  2BS3 C;  3SFD C;  1NEN C;  4YTP D;  3AEB D;  2WU2 C;  1OW6 A;  3P4S C;  4YTM C;  3P4R D;  2B76 C;  1L0V C;  3CIR C;  1YQ4 D;  1YQ3 D;  3AEA D;  2WDR D;  4YSX C;  1ZP0 D;  3AE3 D;  3AE6 C;  3VRA C;  3AE7 D;  1OW8 A;  3P4Q C;  5C3J C;  4YXD D;  2G3A A;  2BS4 C;  4YSZ D;  2WDQ D;  4YTP C;  3AE9 D;  2WDV D;  3AEB C;  3AED D;  1QLB C;  3AEF D;  3ABV D;  3P4P D;  2WS3 C;  4YTN C;  1K05 A;  2WU5 D;  5C2T D;  3P4R C;  3VR9 D;  1KFY D;  3AE5 D;  1YQ4 C;  1PV3 A;  1YQ3 C;  3AE4 D;  1ZP0 C;  3AE8 D;  3VR8 D;  3AEE D;  2BS2 C;  4YT0 D;  3AEC D;  2WP9 C;  1NEK D;  3SFD D;  3VRB D;  3AE7 C;  1OW7 A;  4YSY C;  1ZOY C;  3SFE C;  3P4S D;  3B71 A;  3AEG D;  3CIR D;  4YSZ C;  2WDQ C; 
#chains in the Genus database with same CATH topology
 4KHX A;  3CL3 D;  1L4A C;  3IF4 A;  4LGD E;  1KFM A;  4H13 D;  2E42 A;  3H1K G;  3BCC D;  5B5E E;  1PFI A;  1L4A A;  3RK2 C;  2QSI A;  3H1K J;  2BAS A;  2B9B A;  4PJ0 E;  2PGD A;  2PAJ A;  2W27 A;  4WY4 C;  1IK9 A;  3SWK A;  1L0L G;  4LC1 A;  4Z1M H;  1Y9B A;  1NTK D;  1OIP A;  2WPV B;  4M3L A;  3CX5 H;  3T97 A;  4EI2 A;  5AW2 B;  4WY4 A;  4L76 A;  1L0L J;  2Y9Z A;  2PP6 A;  3WMM 0;  2BCC G;  4GKG A;  5GTI H;  1NWQ A;  1SQQ D;  1LTG C;  1QVF O;  1QX8 A;  1RE3 C;  2WSE H;  1DD4 A;  2BCC J;  4N6J A;  2G3A A;  2RMZ A;  1HBW A;  3GLM A;  2W6B A;  3M9Q A;  1NTM K;  1S5L H;  3H1J D;  1QGK B;  4I6M C;  1PPJ G;  2M5A A;  2J58 A;  3SFD D;  3FXE A;  3AE7 C;  1KFN A;  5CCH D;  3OJA B;  5APW A;  1Q2N A;  1PL5 A;  2NPS A;  3L70 E;  4QMA A;  2FBW D;  2KSE A;  3B8E B;  3GF7 A;  2O01 N;  2R5D A;  3KDP B;  1HGZ A;  1ZXG A;  5KKZ B;  3GW6 A;  1YI2 P;  1N2D C;  1URQ D;  2NZ2 A;  2ZAE B;  2XNX A;  3B5N B;  1L0L D;  1NTM J;  3MUD C;  2IBZ I;  3EFG A;  5C39 A;  4LDT A;  2H7H A;  2YMK A;  1KN7 A;  3L4F A;  1PGO A;  2WPQ A;  3ZDM A;  5KJ7 C;  3AE8 C;  5KLI C;  2K9Y A;  1NOH A;  3MUD A;  1JMB A;  4N3Y B;  2LKM A;  2KYV A;  1KQS O;  3L73 E;  3NMD A;  3QWO C;  3A2A A;  5KJ7 A;  3L72 E;  3RK3 E;  4PV1 D;  1WRG A;  3HE5 B;  3USS A;  1QLE D;  3CWB E;  2ZVN B;  3FWN A;  1ZRT D;  4I2L C;  3PLN A;  1XTC C;  3P4P D;  1X0T A;  4B86 A;  2IBZ D;  1PPJ D;  5AVS B;  3VR8 D;  3RGU A;  3UIA A;  1FZE A;  2B87 B;  1IFM A;  1EZV I;  4XA4 A;  2WP9 C;  1FZG A;  4H0L B;  4YSY C;  4XFJ A;  4RKU J;  2JWA A;  4L75 A;  3D6Y A;  4H44 B;  2POH A;  3AE9 C;  5AVZ B;  1VQ6 P;  1MFT A;  2AEF A;  1KFY C;  3BAS A;  1NTM D;  1YJN P;  1X9V A;  1KB9 D;  3TSI A;  2N1T D;  2HYN A;  1KV4 A;  2LXC B;  1MFZ A;  2WS3 D;  2YKO A;  3VMA A;  2GM4 A;  2B76 D;  4OGQ D;  2OYI B;  1GL2 A;  4GDO A;  5KKZ C;  3R4Y A;  4GIF A;  1SQP D;  1VDF A;  4DZO A;  3VOP A;  3JCU H;  4EDF A;  1EZV D;  3W67 A;  3VP8 A;  1YBK A;  3B5N C;  2L91 A;  3SWY A;  4OWF A;  1OW6 A;  2FFD B;  3WU2 E;  1OZH A;  4A7P A;  2PFX A;  4DCK A;  2A45 H;  3B5N A;  1KMI Z;  1HJ0 A;  1S2E A;  1VQO P;  4R4M A;  3H6P A;  1PGP A;  3H1I E;  1KIL A;  5KAI H;  3IFM A;  2G8Y A;  1TFF A;  3AEF D;  3L37 A;  1JY3 P;  1M56 D;  4IL6 E;  3HE4 B;  2JDI H;  2BS2 C;  3HE5 A;  2JP3 A;  5AVT B;  3KQG A;  2WDQ C;  3KHU A;  1R8E A;  1GTW A;  4DT0 A;  3VR9 C;  1AJY A;  4C7N B;  3AE2 D;  2H88 D;  1BDC A;  4DHI B;  3H1K E;  1DIP A;  3KZI H;  2B87 A;  5BVZ A;  3CCS P;  3H32 A;  2D2C B;  1N7S B;  3L70 G;  1NTZ K;  2WSC J;  1AQT A;  3L36 A;  1FZF A;  3L70 J;  1KQL A;  3AE1 C;  1OMI A;  2OYI C;  1P84 H;  1FOS F;  5B66 H;  4PD4 H;  1AVY A;  1Q86 Q;  2OYI A;  3H1H E;  1SFC B;  2BEZ F;  2BCC E;  1KYO E;  3VRA C;  3RK2 D;  2FFD C;  1IZN B;  1NTZ G;  3GF3 A;  5C3J C;  3CCJ P;  1LTB C;  2ZYD A;  1S9K E;  3L73 G;  2K3R A;  3L72 G;  2RH0 A;  3OAK A;  1JUN A;  4ASV A;  1FC2 C;  3P4R C;  3IN6 A;  1LP1 A;  2FFD A;  1NTZ J;  3CWB G;  5AW5 B;  4HYT B;  1VL2 A;  2K37 A;  3L73 J;  3L72 J;  1IFN A;  3FX0 A;  1IFP A;  1FDO A;  2Q1K A;  1NGM B;  3CWB J;  1VQ9 P;  3TDK A;  1T3U A;  4XE5 B;  4ZNC A;  3M06 A;  3V4Q A;  2H89 D;  3NTN A;  2KS1 B;  4JBZ A;  2WDR C;  3Q5R A;  1D7M A;  2ACZ D;  2E75 B;  2JR8 A;  1FJK A;  1FZA A;  1IFD A;  3PP5 A;  2A06 G;  4YXW H;  3BVH A;  4K3A A;  3L70 D;  2OQQ A;  3S4R A;  5AVY B;  3II6 A;  3LW5 H;  2QJK B;  3VRB C;  1N7L A;  2KK7 A;  1HJB A;  3TK1 A;  3S1K A;  2Y0C A;  2D2C C;  4WY4 B;  4C7N A;  1N7S C;  2GA1 A;  3Q3D A;  3AEE C;  3QH9 A;  2QG4 A;  2WWW A;  3V2N A;  2QJP B;  4C46 A;  1LTT C;  5DJT B;  4YTM C;  1BSH A;  4W80 A;  3CCV P;  3RL0 D;  1L0V C;  1N7S A;  2KP8 A;  4RO0 A;  3CCE P;  2QRX A;  1OX3 A;  3VN0 A;  3L73 D;  1GK4 A;  3L72 D;  3N4X A;  4YSZ D;  3RK3 D;  2O1J A;  5KTB A;  2I1J A;  4YTN C;  2WSF H;  2WPR A;  3CWB D;  5GTH E;  3P32 A;  4JYB A;  1VPC A;  2KI7 B;  1WMK A;  2M5A B;  4W7Y A;  3AE8 D;  4WBA A;  3H1I G;  1LT9 A;  1PIX A;  1A02 J;  1Q90 D;  2NPS B;  3AED C;  2UWJ E;  3H1I J;  4I1L A;  4HJG H;  3A0H H;  1GDT A;  4NPE A;  3H25 A;  1YHQ P;  3HD7 D;  1PZQ A;  1MUU A;  4NPF X;  1OVR A;  2XKM A;  3AE3 C;  4EOT A;  2Q7C A;  5CBN A;  1E7P C;  4JPZ B;  2IZ0 A;  1L0N G;  1AV1 A;  4YPC A;  1VQM P;  1H8A A;  3RBZ A;  3L74 G;  1IK7 A;  2YXQ B;  3CXH E;  2A45 G;  2HPC A;  2E75 C;  2OYO A;  2KUB A;  3KYQ A;  1DH3 A;  1VQ5 P;  3AE5 C;  4ZKU A;  2WP9 D;  5KAF E;  1UII A;  3MD0 A;  1BSN A;  2AXC A;  1KF6 C;  1JY2 O;  4YSY D;  2ZYA A;  2KS1 A;  2K9J A;  2WQY C;  1T3J A;  1GZL A;  1T2K C;  2QJK C;  1NEN C;  3A3Y B;  2P1J A;  3U1A A;  2BEQ D;  5KLI B;  4L73 A;  1SQX E;  1NAF A;  2FYN B;  1H89 A;  2KOG A;  1U57 A;  1H0T B;  4JF7 A;  1ZP0 D;  1N73 B;  2QJP C;  2I1K A;  1K9M Q;  4RES B;  1Y47 A;  5AVR B;  2HOD B;  3H1H G;  4JQ0 D;  2C9N Y;  1YQ3 C;  2WVR A;  3H1I D;  1MZ9 A;  2OTK E;  2P7J A;  2V7Q H;  5AVV B;  3B5N D;  2ZJS E;  3H1H J;  1ZOY C;  1EDK A;  3EQ2 A;  4U3F E;  1PGQ A;  1EXJ A;  1S72 P;  1USD A;  5AW8 B;  2XV5 A;  4N78 E;  4BXL A;  3AE4 C;  3WUU A;  1W2E A;  3WUT A;  2NPS C;  2XDJ A;  3CX5 E;  2NRG A;  4YT0 C;  2IFM A;  3FWL A;  2JKV A;  2J59 M;  1NU1 E;  2OTL P;  2CPB A;  1GL2 B;  4DJG A;  1LWU A;  2M0B A;  3CCM P;  4GOF A;  1RHZ B;  3OA7 A;  1JTH A;  1U7M A;  3H1K D;  5GTI E;  3TGU E;  5AW4 B;  3KXD A;  2HFE D;  3AE6 D;  2CK3 H;  1A02 F;  3D6Z A;  3CCU P;  3V2Q A;  1PP9 G;  1FS0 E;  2OYH B;  4OH8 B;  1UIX A;  5APU A;  3WUV A;  2QEX P;  2E43 A;  1JCC A;  1VQN P;  4H0L D;  1S5L E;  1PP9 J;  4H44 D;  2KSJ A;  1KIL B;  1ZW0 A;  1JMM A;  3P4Q C;  1DEB A;  1GD2 E;  2FYN C;  1NTZ E;  3H1H D;  3AEB C;  1EXI A;  1QLB C;  2HG5 D;  1N73 C;  3ABV D;  2BCC D;  1KYO D;  4DOJ A;  2ZT9 D;  5CCG A;  1YQ4 C;  1S9K D;  1KB9 I;  1H0T A;  3VP9 A;  3AEC D;  1N73 A;  2AXT H;  1G2C A;  3AEG D;  3MTU E;  1LJ2 A;  3HTK A;  2IPP A;  1JNM A;  1QEX A;  3CI9 A;  2WU5 C;  1OXZ A;  2HOD A;  2Q9I A;  3PJS K;  3LW5 J;  3M9B A;  3H1L E;  5C3J D;  3H32 B;  2Z5I A;  2ZXX A;  3SSU A;  1S4X A;  1M7L A;  2WU2 D;  2ZYG A;  4LLH A;  1NJI Q;  2R3S A;  2A06 E;  2H8P D;  4AUW A;  4D6T E;  5KLV E;  2Q5U A;  1ZLL A;  2FXP A;  1VF5 D;  1Q82 Q;  4H13 C;  3Q5P A;  1SQX K;  3LID A;  1N86 A;  1GL2 C;  1T8Z A;  1GK6 A;  1GU5 A;  3O8Z A;  2W6A A;  4YTP D;  2P58 A;  5AW7 B;  5BU8 B;  2KB7 P;  1R5L A;  1Q7Y Q;  2WDR D;  4YSX C;  1FU1 A;  3EWK A;  2IFN A;  4DDI A;  2OYH C;  2O01 J;  1SQB E;  2J5U A;  1BGY G;  1SLQ A;  1M1J B;  4PV1 B;  1ZV8 A;  1SQX G;  1SS1 A;  4KJM A;  2E74 D;  1LP1 B;  2HLO A;  2OYH A;  4UB8 H;  5H2F H;  4U7J A;  4RJT A;  1KIL C;  1SVF A;  1SQX J;  3AEE D;  3IAO A;  1NEK D;  2WTY A;  1BE3 G;  2WSS H;  1CSB A;  3V2R A;  4UB6 H;  2Q3E A;  3K5B A;  3MIW A;  3CD6 P;  3M0D A;  3L75 E;  1VQK P;  1NU1 K;  4W7Z A;  2QA4 P;  1K73 Q;  3F89 A;  1QVG O;  1KIL E;  2W6J H;  1BE3 J;  4KX6 D;  3JCU E;  3BAT A;  1FDM A;  1JY3 N;  4U3F G;  5AVQ B;  5CCH C;  1SFC D;  4YTN D;  4IL6 X;  4YXD C;  2N1T B;  1L0N E;  1K04 A;  3L74 E;  2FBW C;  4U3F J;  4IFF A;  3A0B H;  2QM7 A;  3P8M C;  5CCH A;  2Y0E A;  4OGQ B;  5TIS H;  2FXM A;  3FGA D;  3C1L A;  1NU1 G;  3CXH D;  3F5H A;  2GUV A;  1YTZ I;  5KAI E;  1K8A Q;  3TGU G;  3PTZ A;  1NU1 J;  1AFO A;  2QJY B;  5E79 H;  2IYP A;  1JY2 P;  5APX A;  3M9H A;  3AE3 D;  1WT6 A;  2FXO A;  2P2U A;  1URQ A;  3TGU J;  3CCR P;  1J1E B;  1SQX D;  2OTJ P;  1E79 H;  2BS4 C;  4HB1 A;  2WSE J;  1L4A D;  2KIK A;  1K05 A;  3AE5 D;  1RQV A;  1M1J C;  4C7R A;  1LT9 B;  4PV1 C;  2L5G B;  3FXD A;  1T2K D;  1VQ8 P;  2WZ7 A;  3GMA A;  3SFE C;  3KZI E;  2LR2 A;  3CME P;  2ITA A;  1M1J A;  2K88 A;  4WY4 D;  5M1B A;  5CJ4 A;  2E76 B;  1IC2 A;  3D71 A;  1KTM A;  1IFI A;  5KLV K;  5AVX B;  2XZR A;  4GT1 A;  3VR8 C;  4U3F D;  2B89 A;  2O3J A;  1YYC A;  1P84 E;  2YKP A;  3TNU B;  1KB9 H;  1JB0 J;  2R5B A;  5B66 E;  4PD4 E;  2HPC B;  3G3Z A;  1S1C X;  2R32 A;  4N78 D;  3E7K A;  5CBO A;  2QE7 H;  4WB4 A;  3CX5 D;  1YJW P;  3H1L G;  1KZU B;  2K9J B;  1NU1 D;  1BCC E;  1ZOY D;  1T6A A;  3O6Q B;  3CC7 P;  3VTP C;  1KC8 Q;  2N1T C;  1AVO A;  5AW6 B;  4D6T G;  1SQB K;  5KLV G;  2OGU A;  3C9I A;  3TGU D;  1PP9 E;  3H1L J;  1LGH B;  3P4S C;  1HTL C;  2B76 C;  3CIR C;  4OGQ C;  2N1T A;  4IOI H;  4D6T J;  2NPS D;  5KLV J;  1ZN5 A;  1M90 Q;  1FZC A;  1J1D B;  3AE7 D;  3SWF A;  5APY A;  2FY8 A;  1X22 A;  2JO1 A;  2QJY C;  3P7K A;  5DJU B;  1DD3 A;  1USE A;  1NO4 A;  2AEM A;  4DHJ A;  3EFF K;  1EDI A;  1SQB G;  1J1E C;  5CMZ A;  1HUC A;  3BCC G;  4ASW A;  1NTZ D;  3RBX A;  5AVU B;  1SQB J;  1W2B O;  1LT9 C;  1GU4 A;  3CC2 P;  1HGV A;  3V5B A;  5KJ7 D;  1L0N K;  1NTK G;  5AW0 B;  3HUS B;  4BWN A;  2E5T A;  1LWU B;  4DHZ A;  4ZMD A;  2E76 C;  1Q81 Q;  3L75 G;  1NVO A;  3S9O A;  1JTH B;  1OWA A;  2WDV C;  3H1L D;  1AA0 A;  1QL1 A;  1EC5 A;  3AE2 C;  2H88 C;  2FYZ A;  5B5E H;  3L75 J;  1HH0 A;  2A06 D;  1W5C E;  4D6T D;  5KLV D;  2Y9Y A;  4PJ0 H;  3TNU A;  3L71 E;  2RN0 A;  1L0N J;  1HVV A;  3RL0 B;  4KT0 J;  3L74 J;  1RE4 C;  1IO4 A;  1LTJ B;  1BGY E;  1JOC A;  3O6Q A;  3AE9 D;  1MKM A;  1DX7 A;  1NYH A;  1SQB D;  2YO2 A;  1KFY D;  1X8Y A;  1J1D C;  1RE4 A;  3A0H E;  3RK3 B;  1GL2 D;  1JCD A;  3I56 P;  1M1K Q;  1G2C B;  1EDL A;  3HTK B;  3U1C A;  2A45 I;  4WWI A;  4YSX D;  1BE3 E;  1VQ7 P;  4EYY Q;  2MJZ A;  4O9B A;  2YO3 A;  1JM0 A;  4IFM A;  1IFJ A;  3HD7 B;  3L75 D;  2YIU B;  2WSC H;  2Z5H A;  1KIL D;  3HUS C;  5C2T C;  1TU3 F;  2H89 C;  1LWU C;  2WT7 A;  4I7Z B;  3D70 A;  2FYU E;  3M91 A;  2ACZ C;  1H88 A;  1RF0 C;  3M0A A;  4H13 B;  2FKW B;  1L0N D;  3P8C E;  5EFW B;  3HUS A;  3L74 D;  1KYO I;  1RE3 A;  1NKN A;  1G1J A;  1CI6 A;  1RF0 A;  2QVA A;  4OVN F;  2QIW A;  1BCC G;  2Y0D A;  2IBZ G;  2ZXE B;  3PH0 A;  2C0W A;  1VQP P;  2YNY A;  4AYC A;  1G1I A;  1L2P A;  1QL2 A;  4YXD D;  1SQP K;  2WDQ D;  1BCC J;  1CW5 A;  2B88 A;  2E5Y A;  3JC2 2;  3VR9 D;  3RL0 C;  3I5C A;  1PV3 A;  1P84 I;  3E1I A;  3NXS A;  3C8V A;  2W90 A;  2R3C A;  4PD4 I;  1NTM G;  1LTJ C;  3I55 P;  4MN4 C;  2ZFC A;  1EDJ A;  5CCG C;  1S5L X;  4YSZ C;  3VMX A;  3RK3 C;  1LTJ A;  2IDB A;  1SQP G;  3AEA C;  1JO5 A;  5APQ A;  1HF9 A;  3AE1 D;  1MV8 A;  2YMY A;  1FE6 A;  3KPE A;  1SQV E;  4K35 A;  1FAV A;  1EZV G;  3G6E P;  1AQ5 A;  1SQP J;  3VMZ A;  2OAR A;  2N9Y B;  3CCQ P;  1FDI A;  3HD7 C;  3VRA D;  1P84 D;  4FJV A;  1ZR4 A;  4NPD A;  3TYY A;  2YIU C;  4PD4 D;  5AW1 B;  1GW4 A;  3SFE D;  3A7O A;  1VQL P;  2N9B A;  2YKQ A;  3V2P A;  2JEE A;  3HD7 A;  3P4R D;  4I7Z C;  3OW2 O;  4I6L A;  3GHG B;  1OFC X;  1BCC D;  1BDD A;  1URQ B;  3ITK A;  2CPS A;  3VMY A;  2QM8 A;  1PP9 D;  1RQU A;  2AXT E;  1LTI C;  3L71 G;  3WU2 H;  2KLV A;  2I8D A;  1RF1 B;  1ZP0 C;  3L71 J;  1IJD B;  2WSF J;  3CPW O;  2KXP B;  5AVW B;  2ZT9 B;  1OW7 A;  3NFQ A;  1J2J B;  4L74 A;  3P4S D;  2HR3 A;  3BCC E;  3CIR D;  3VRB D;  1ZR2 A;  3MP7 B;  1BGY J;  1GMJ A;  3E1R A;  5APT A;  4IL6 H;  2D2C D;  3M0D C;  1N7S D;  3G71 P;  1GW3 A;  3L35 A;  2IX7 C;  2KZJ A;  2WPS A;  3Q5S A;  3CXH I;  1NTK E;  2IZ1 A;  3CC4 P;  2FYU K;  4YTM D;  1EQ7 A;  4Y28 J;  1NAY A;  1L0V D;  1N8R Q;  2O1K A;  4CPG A;  3W68 A;  1KOR A;  1OVV A;  1X79 B;  1VF5 B;  2K1A A;  1SQQ E;  3SFD C;  5APV A;  1LTA C;  3TF5 A;  3MHV A;  3Q2Y A;  1NH4 A;  1NKZ B;  1Y8A A;  4UB8 E;  2ZVO B;  5H2F E;  1FZB A;  3BRT B;  2KZI A;  2C9L Y;  2FYU G;  3MGN A;  2XU6 A;  1FZC B;  1JEK A;  1RH5 B;  4HKZ H;  3AE6 C;  3H1J E;  5K5G B;  4HH2 A;  2E76 D;  3L71 D;  2M3E A;  3GHG C;  2FYU J;  2GUS A;  5TJH A;  4UB6 E;  2WDV D;  3AED D;  1URQ C;  4H0L C;  1KYO H;  4Y99 B;  2E74 B;  3GHG A;  4EIJ A;  1BGY D;  5APS A;  4H44 C;  2IYO A;  5AW9 B;  1JY2 N;  3G9R A;  3B71 A;  3V6I A;  3Q1M A;  2V7Q J;  1SQV K;  2BS3 C;  2E75 D;  1RF1 C;  3ABV C;  1M57 D;  3CX5 I;  3VYI A;  1YIT P;  2ZT9 C;  4ZKP A;  5AW3 B;  1L0L E;  1KF6 D;  3A0B E;  2WQY D;  2JJL A;  5TIS E;  1RY3 A;  4BRY B;  3AEC C;  1RF1 A;  1NEN D;  1BE3 D;  1LT1 A;  2Z4E A;  1M8O B;  4AQR D;  3CLQ A;  3AEG C;  2VRS A;  3A5T A;  3P4P C;  2Q6Q A;  5E79 E;  1SQV G;  1ZME C;  4TLF A;  2ZFY A;  2KNC B;  1FJP A;  5BU5 A;  2WU2 C;  1ZRT E;  2XND H;  1SQV J;  2M8R A;  2FYU D;  3R2P A;  3IR9 A;  1YQ3 D;  1VF5 C;  5CHX A;  1E5W A;  3P8C D;  1LTS C;  5CJ0 A;  3G4S P;  3RL0 g;  1OW8 A;  1YJ9 P;  1HWT C;  2IBZ E;  1PPJ E;  3PHL A;  4WVZ A;  1XTG B;  3VON A;  4YTP C;  3N7N A;  1FZC C;  1KD1 Q;  2WS3 C;  5C2T D;  1LNQ A;  3AE4 D;  1KQG B;  1L4A B;  2KLU A;  4YT0 D;  4GOE A;  2JWD A;  3HE4 A;  1NTM E;  3B4S A;  4DDG A;  2DW3 A;  1VQ4 P;  1KB9 E;  2WIT A;  2M3B A;  2W83 C;  3LIE A;  4Y99 C;  4JYC A;  1NTK K;  3RK2 B;  2E74 C;  2V4H A;  5GTH H;  3U59 A;  2R44 A;  1U7J A;  3T97 B;  5L8R J;  1R5S A;  3PRJ A;  1OVU A;  4TT3 H;  1SQP E;  2AEJ A;  2RKL A;  3V4W A;  1NEK C;  3CCL P;  2SPZ A;  2YXR B;  1S3J A;  4R4L A;  1EZV E;  1Z56 A;  1SQQ K;  3AEF C;  2WT7 B;  3BCC J;  1SQV D;  3MZW B;  3GG2 A;  3HRN A;  2WMM A;  1KQF B;  3P4Q D;  5CCG D;  4KX6 C;  2MKV A;  4IFD K;  2P67 A;  3CMA P;  1YIJ P;  3AEB D;  1CI6 B;  3JSV C;  4BRY A;  1SFC C;  2LXB A;  3CXH H;  2O01 H;  1NTK J;  1YQ4 D;  3AEA D;  1DEE G;  5KAF H;  1SP4 A;  4GOD A;  1SQQ G;  1JY3 O;  1SFC A;  1FOS E;  2W8Z A;  2KNC A;  1CZQ A;  2WU5 D;  1SQQ J;  3BRV B;  3H1J G;  2C0X A;  1YTZ T;  2H43 A;  2Q3I A;  1FBM A;  1NHL A;  1L0L K;  2P10 A;  3H1J J;  1PGJ A;  2PRR A; 
#chains in the Genus database with same CATH homology
 2E75 D;  2E74 C;  3AE9 C;  3AED C;  5M1B A;  4YSX D;  2IDB A;  3ABV C;  1R8E A;  2FBW D;  2WU5 C;  2E76 B;  4H13 D;  2H89 D;  1GMJ A;  3VR9 C;  3H25 A;  3D71 A;  1AJY A;  1KFY C;  3GF7 A;  1KTM A;  3AE2 D;  3T97 B;  5L8R J;  2H88 D;  2ZT9 C;  3AEA C;  2WDR C;  2D2C D;  3Q5R A;  2ACZ D;  1KIL E;  1KF6 D;  3AE4 C;  3LW5 J;  2E75 B;  2WQY D;  3AE3 C;  1HF9 A;  3AE1 D;  4TT3 H;  4KX6 D;  5C3J D;  3VR8 C;  1DIP A;  3Q5S A;  1NEN D;  4YT0 C;  3AEC C;  1NEK C;  4YSY C;  1E7P C;  2WU2 D;  2D2C B;  2NZ2 A;  1JB0 J;  2QSI A;  2OQQ A;  4YTM D;  2E76 C;  2WS3 D;  4YTN D;  4Y28 J;  3S9O A;  3AEG C;  4IL6 X;  1S1C X;  2B76 D;  4R4L A;  1IK7 A;  4YXD C;  1L0V D;  4OGQ D;  4GDO A;  2FXP A;  1VF5 D;  3VRB C;  2E75 C;  2WDV C;  3AEF C;  1KOR A;  5KKZ C;  3R4Y A;  3P4P C;  1K04 A;  5C2T C;  1TU3 F;  2FBW C;  4Z1M H;  1FDI A;  1Y9B A;  2H89 C;  4H13 C;  2WSC J;  3Q5P A;  2YMK A;  3AE2 C;  3AE6 D;  3AE5 C;  4I7Z B;  3D70 A;  2WP9 D;  2H88 C;  3VRA D;  2WPV B;  4OGQ B;  1KQF B;  2D2C C;  1ZME C;  3D6Z A;  2ACZ C;  3P4Q D;  1KF6 C;  1VF5 B;  2YIU C;  1ZOY D;  3FGA D;  4YSY D;  3AE8 C;  2WQY C;  5KLI C;  3SFE D;  2K9Y A;  3AE1 C;  3Q3D A;  3AEE C;  4KX6 C;  1OMI A;  2MKV A;  4H13 B;  3SFD C;  1UIX A;  2QJK C;  1NEN C;  4YTP D;  3AEB D;  2WU2 C;  1OW6 A;  1ZRT E;  3P4S C;  2BEQ D;  3Q2Y A;  4YTM C;  3P4R D;  2B76 C;  4I7Z C;  1L0V C;  3CIR C;  4H0L D;  4OGQ C;  1YQ4 D;  1YQ3 D;  3AEA D;  2WDR D;  1U57 A;  1VF5 C;  3RK3 E;  4YSX C;  2QIW A;  3EWK A;  4PV1 D;  1ZP0 D;  2WDQ C;  2BEZ F;  3AE3 D;  1KMI Z;  1HJ0 A;  2O01 J;  4H44 D;  3AE6 C;  3VRA C;  2QJP C;  3RL0 g;  2J5U A;  3AE7 D;  1DD4 A;  4KT0 J;  1OW8 A;  3P4Q C;  4R4M A;  1RQU A;  2E76 D;  3GF3 A;  5C3J C;  4PV1 B;  2JO1 A;  4YXD D;  2FYN C;  2G3A A;  2BS4 C;  4YSZ D;  2WDQ D;  2G8Y A;  3GLM A;  3O6Q A;  2QJY C;  4YTP C;  2E74 D;  2WSE J;  3AEB C;  1EXI A;  1QLB C;  1DD3 A;  2WDV D;  3ABV D;  3AE9 D;  3AED D;  1MKM A;  2WS3 C;  3AEF D;  3P4P D;  4YTN C;  1K05 A;  2WU5 D;  5C2T D;  3P4R C;  1NYH A;  3VR9 D;  1KFY D;  4U7J A;  3IN6 A;  2ZT9 D;  1WMK A;  4H0L C;  3AE5 D;  1YQ4 C;  1PV3 A;  1YQ3 C;  1RQV A;  3AE4 D;  1VL2 A;  2E74 B;  3C8V A;  1ZP0 C;  4PV1 C;  3AE8 D;  3VR8 D;  1KQG B;  3AEE D;  2BS2 C;  2WSF J;  4YT0 D;  3IAO A;  3AEC D;  2WP9 C;  4H44 C;  1NEK D;  3SFD D;  3VRB D;  4H0L B;  3AE7 C;  2ZT9 B;  1OW7 A;  1PIX A;  2JP3 A;  1ZOY C;  1FDO A;  3G9R A;  3GMA A;  4XFJ A;  1S5L X;  3SFE C;  3P4S D;  2P10 A;  4RKU J;  3B71 A;  1Q90 D;  3Q1M A;  1NGM B;  3AEG D;  2V7Q J;  3D6Y A;  1PL5 A;  3CIR D;  4YSZ C;  4H44 B;  1EXJ A;  2BS3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...