3AE1C

Crystal structure of porcine heart mitochondrial complex ii bound with n-phenyl-2-(trifluoromethyl)-benzamide
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
138
structure length
138
Chain Sequence
b'TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
molecule tags Oxidoreductase/oxidoreductase inhibitor
publication title Crystal structure of porcine heart mitochondrial complex II bound with N-Phenyl-2-(trifluoromethyl)-benzamide
rcsb
total genus 47
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3ae1C01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3ae1C02
3SFED 2WU5D 1NEKC 4YT0C 1ZP0D 3AEAC 1PV3A 2H88C 2WDQD 3AE5C 3VRAD 3AE2C 3P4SC 1NENC 3VRBC 3AEBD 5C2TD 2WQYC 1QLBC 4YTPC 2WDRC 3VR8D 4YTMC 1OW7A 1L0VC 3B71A 3VR9C 3CIRD 3AE9C 3S9OA 3AEGD 3AE4D 1K04A 2BS2C 4YSXD 2BS3C 1YQ4C 2WP9C 1ZOYC 3AEED 4YSZC 4YTND 4YTPD 3ABVC 2B76C 4KX6D 1OW8A 4YTMD 3AE7D 3P4QD 1YQ3C 3AE8D 2WS3C 3VR9D 3SFDD 1NEND 3VRBD 3AEAD 4YXDC 3AE3C 3P4PD 3P4RC 1YQ4D 3AEDD 2ACZC 4YSYC 3AECD 3SFEC 3AE5D 3AEGC 1KTMA 5C3JC 1KF6C 2B76D 2BS4C 3AEDC 3AE2D 4YSYD 2H88D 3AE9D 3AE1C 3AE8C 1K05A 1OW6A 5C2TC 2WQYD 2H89D 3VR8C 3VRAC 3P4SD 1ZOYD 3AE3D 3P4PC 4YTNC 3AEBC 3AE6C 2WU2C 3P4QC 2FBWD 3AEFC 2G3AA 1KFYD 1NEKD 4YT0D 3AE4C 2H89C 4YXDD 1KF6D 3AE7C 2WDVD 3AECC 1L0VD 2WS3D 3SFDC 2WU5C 3CIRC 2WDQC 1ZP0C 4YSXC 3AEFD 3P4RD 1KFYC 5C3JD 3AEEC 2WP9D 2WDRD 4YSZD 1E7PC 3AE6D 3ABVD 2WU2D 4KX6C 2WDVC 2ACZD 3AE1D 2FBWC 1YQ3D
chains in the Genus database with same CATH superfamily
1EZVE 2JKVA 4W7ZA 1SQPK 1X9VA 1DX7A 1JNMA 1GU4A 1T6AA 1L0ND 1QLBC 2WDRC 3D6YA 4L73A 3IR9A 2FYUK 2Q7CA 1Y9BA 1LWUB 3TGUJ 2O1KA 3H1HE 3LIEA 4H44B 4HH2A 2KNCA 1NWQA 1P84E 4DHZA 1S2EA 3H1JG 4OGQC 3CCEP 2KP8A 3CWBJ 2A06E 3A7OA 3FWNA 1NAYA 3CXHE 3L75E 2WS3C 1NEND 1YJWP 4TLFA 2ZAEB 3VYIA 1L2PA 3IF4A 3L71D 2A45I 5AVYB 1SQPE 5CBOA 4IL6E 3G9RA 1OW6A 2HG5D 4GODA 2QJKB 4KHXA 1NKZB 3BATA 2PAJA 1NTKG 1NO4A 3M9BA 2R5DA 3I56P 1OFCX 2FYUJ 3R2PA 1ZMEC 2BASA 3TNUA 1SQVJ 3GG2A 1YI2P 1J1DB 1LP1B 4U3FJ 1VQOP 1J1EB 1D7MA 2K1AA 2WDRD 3BASA 3OAKA 1FDMA 3WU2H 1NEKC 2B87A 3SWFA 3RBZA 1N73C 2FKWB 1NENC 3A0HE 2Z5HA 1BSHA 3B71A 5KTBA 1L0LJ 2V7QJ 1BCCD 1OIPA 3CWBD 4O9BA 1EDKA 3RK3B 3ABVC 1NTKK 4RJTA 4YTMD 3H1IG 3VR9D 5CJ0A 2XNXA 1JMMA 2OYHB 4GKGA 1MKMA 2QA4P 1DIPA 2YIUB 1CZQA 3B5ND 3JSVC 1VQ5P 5C3JC 3TYYA 1S1CX 2WSSH 5APYA 3A0BH 2C0WA 1BSNA 1J2JB 2O01N 1MZ9A 2HPCA 2Q9IA 1S9KD 4YTNC 1FJKA 5H2FH 1A02F 1JY2N 1W5CE 5AVWB 1FU1A 4YXDD 1L0LK 1OVVA 1JTHA 2H7HA 3M0AA 2WU5C 2OYIB 1NU1K 2WT7B 1VF5B 3H1JD 1R8EA 2WSCJ 1JEKA 3L72E 1SQPG 3H1ID 5AVQB 2WSCH 2QJYC 3EWKA 1YQ3D 3V6IA 1K73Q 4C7RA 2RN0A 3A2AA 1NTKE 1L0NE 4PJ0E 4EIJA 1KC8Q 3U1CA 4YTPC 1DD3A 3D70A 2KXPB 5AW3B 2PGDA 4HKZH 2UWJE 3CXHD 5GTIE 3I55P 2E76D 1YQ4C 5KLVE 2QM8A 3OA7A 1EXIA 3JCUH 1A02J 3L75G 2W6AA 3M9QA 1LWUC 4H44C 1URQB 1FZCC 4Y99C 5KAFE 3H1HG 1M90Q 2CPBA 4D6TE 1KMIZ 2JWAA 3WUTA 1G1IA 2YKQA 2ZYGA 3AE9D 3CC4P 3TGUE 3HRNA 5CCGA 4D6TG 2LKMA 1CW5A 1N8RQ 4ZMDA 2GUVA 2P10A 1JM0A 4QMAA 3CX5H 3MIWA 2Q3EA 1VQ8P 5KAFH 1SQVD 1S4XA 5E79H 4N78D 1S72P 1MV8A 1LT1A 1L4AB 3HD7C 3VN0A 2J59M 2JO1A 3Q2YA 3P8CD 1GDTA 1P84I 5CCHC 1VQ9P 5E79E 3T97A 1P84H 3AE5C 3AE2C 3M06A 5C2TD 3E1RA 1L0NG 4JBZA 2FYUE 1OW7A 4IFMA 2RH0A 2BCCJ 5AW1B 1SQVE 4DHJA 1KFMA 2BS3C 2Z4EA 3AEED 1ZOYC 2B76C 1XTGB 2JDIH 3AE7D 2QRXA 1DEBA 2WTYA 1VF5C 3EFGA 1ZN5A 1R5LA 2GA1A 5DJTB 1ZRTD 2YMYA 5APSA 2AEMA 4DDGA 4N6JA 3L74G 3AE8C 3NXSA 1PGPA 1YYCA 2I1KA 1BGYG 4WVZA 3AE3D 1FZAA 3HD7D 3L71G 3VP9A 2N1TD 3VONA 2W90A 3C1LA 3PLNA 1FOSF 2WPRA 2Q6QA 5KLVD 2A45G 3D71A 1FZCA 3Q1MA 1KF6D 2J58A 3AE7C 3WUVA 3CMEP 5AW5B 4DCKA 1VF5D 1FC2C 3KHUA 1LNQA 2XKMA 5AW8B 4BWNA 1OMIA 3L70G 4LDTA 1SQBE 4UB8E 2ACZD 1CI6A 2CK3H 1N7SA 3CXHI 4ZKPA 1VQPP 3LIDA 3AEAC 4Y99B 1T2KC 3O8ZA 3H1KE 2XV5A 2VRSA 3L74J 4C46A 1AFOA 2K3RA 1NTZK 2WDQD 5AW2B 2WT7A 4GDOA 4R4MA 1BE3J 2W6BA 1RY3A 2FYNC 5KJ7C 2KS1B 4JF7A 2E76B 1SFCC 3SSUA 3NFQA 4D6TD 5AW0B 2WP9C 4YSZC 2IPPA 4HJGH 1FDOA 5C39A 1YIJP 3VRBD 1SQQE 4YXDC 3P4PD 2BCCG 4OGQD 5AVXB 1AQ5A 1L0NJ 3G3ZA 2ZVNB 2QSIA 1PGOA 4JPZB 3RL0g 2JR8A 1YJ9P 3CX5E 2YXQB 4IOIH 1IFIA 1OVUA 3JCUE 3EFFK 1IO4A 2ITAA 1W2EA 2KSJA 3I5CA 5BU5A 1ZV8A 1KYOE 5BVZA 1RHZB 1N7SC 5KLVK 3PP5A 4UB6H 1SQBG 1PP9D 2WDQC 3QH9A 1M57D 1Q7YQ 3A5TA 1FZBA 4KX6C 1OXZA 1SP4A 2QG4A 4D6TJ 1NJIQ 1VDFA 4I6LA 2WPVB 2BCCD 2E75B 4HYTB 3GF3A 3U1AA 4W80A 3H1HJ 2ZT9D 2YO2A 2FXMA 4GOFA 1SLQA 3C9IA 4YTMC 2A45H 3VMAA 1N73A 3L75J 3RL0D 3VR9C 2WSFH 2C0XA 3KDPB 1FJPA 2FXOA 2ZJSE 2JWDA 3TK1A 3P32A 2QIWA 3U59A 4LGDE 3P4QD 4H0LC 3Q3DA 3BCCE 1PPJD 1PGQA 3LW5J 1S3JA 2WWWA 3G6EP 3Q5RA 5APTA 1HGZA 1PP9G 2K37A 3RK3E 3MUDC 1FE6A 2R3SA 1KILA 4YSYD 1EZVI 3H25A 1AVOA 1M1JB 3F89A 1KFNA 3A0HH 1U57A 1PPJE 1IFPA 2M3EA 2IZ1A 4U3FE 2NZ2A 2FBWD 4WY4B 1DD4A 3L73D 2XDJA 3M0DA 5CCHA 1AVYA 2P2UA 3VP8A 1BCCJ 2E75C 2B87B 1H0TA 1USEA 2YXRB 3BCCG 5KLIC 4L74A 1EC5A 3AEEC 1L4AC 2GUSA 2YO3A 2WU2D 4JQ0D 1NTZG 2QEXP 1GMJA 1LTJA 5KAIE 2WU5D 2MKVA 1YHQP 1X0TA 1BGYD 2Y9ZA 1Q81Q 5CJ4A 1JY2O 4C7NB 1N73B 5GTHE 3BVHA 4H0LD 1NOHA 3P4SC 4YXWH 3V2NA 2WQYC 1SQQK 3VR8D 4L76A 3WMM0 1K04A 4L75A 1GL2B 2E74B 4XA4A 1H89A 2M0BA 1DH3A 4YTPD 2KYVA 5APVA 5AW6B 2K9JB 5AVSB 3KXDA 5GTHH 1FZEA 1L0LG 1YQ4D 2Y0EA 2NPSA 4I2LC 3L74E 3HTKA 2ZYAA 2QJYB 2BEQD 3G71P 3MD0A 1LT9A 4EDFA 1SS1A 2Y0CA 1AA0A 1USDA 1BE3E 2SPZA 1K8AQ 4Z1MH 1J1DC 3AE1C 4XE5B 3W68A 2WQYD 2H89D 3VR8C 1KYOD 3D6ZA 2OTKE 1PL5A 2AXTH 2YNYA 3GLMA 4U3FG 1SQVG 2KSEA 3E1IA 5KJ7D 3B5NC 2M8RA 3CCQP 5CCHD 1SFCD 4JYCA 2Q5UA 5EFWB 1NTKJ 4YSZD 1JY3N 1G2CA 4I7ZC 3L4FA 4N78E 2OYIA 1GZLA 1HGVA 1U7JA 1H0TB 4PD4I 2IDBA 1SQQD 5AVUB 1SQPD 5KKZC 3V2RA 4GIFA 3AEBD 4H13D 3C8VA 3CC7P 3CCRP 3P8CE 3HE5A 1T8ZA 1PIXA 1EXJA 1M8OB 2B89A 3P7KA 2L5GB 1M1KQ 3K5BA 2V4HA 3CWBG 3H1JJ 3N4XA 3SWKA 1IC2A 1YQ3C 3HE4B 3MHVA 1YITP 1LJ2A 3TGUG 3VMZA 3AECD 5L8RJ 3AEGC 1KTMA 2D2CD 1URQC 1ZR4A 2KNCB 1RE3C 3AEDC 1VL2A 4M3LA 2JEEA 3RGUA 1M7LA 3HTKB 5BU8B 3H32B 1HTLC 1NTZJ 1X22A 5AVRB 3AE6C 1JCCA 2B9BA 4IFDK 1JO5A 4YT0D 3BCCJ 1ZLLA 1S5LX 1BCCG 3UIAA 2O01J 5KLIB 5APWA 3AEFD 2FYUD 1RQUA 2KS1A 3V2QA 3IAOA 4GOEA 1EDJA 3SFED 3RBXA 4PJ0H 1SFCB 1PV3A 2FFDA 3V4WA 3TGUD 4H0LB 2LXCB 1J1EC 1GL2D 2E74D 2LXBA 1PP9J 1JUNA 4WBAA 1MFZA 4EOTA 1NU1D 3F5HA 3E7KA 4AQRD 1BCCE 1VPCA 1SFCA 3AEGD 1Q90D 1HJ0A 1HWTC 3JC22 3L35A 3HUSC 4TT3H 1NH4A 1EDLA 2ZXXA 1GW3A 3H1LE 2A06G 3SFEC 4EYYQ 3AE5D 1N86A 3RK2D 3TDKA 3SWYA 3A0BE 3H32A 1OWAA 3FX0A 3V2PA 3TNUB 3IFMA 1NTZD 2KLUA 2XU6A 4FJVA 1N7SD 1ZOYD 3W67A 1JY3P 1RF1B 1Q82Q 1NTMG 2K9JA 4KT0J 3CMAP 2KB7P 3L72D 1DEEG 4OH8B 1SQBJ 1MFTA 2Q3IA 2WS3D 3CCVP 3H1KJ 2V7QH 3WU2E 4DZOA 1RE3A 2KIKA 2KZJA 1SQBK 2QVAA 2DW3A 3S4RA 3B8EB 2OQQA 3TF5A 1QL2A 1RH5B 4WY4A 3HUSB 4IFFA 2HR3A 2OYIC 1KQLA 2OTLP 1SQXG 5CMZA 2Y9YA 4I6MC 2YKOA 1SQQJ 2BS2C 5APXA 1KB9D 3CI9A 1QEXA 1GTWA 1RF0A 1VQ6P 5DJUB 3R4YA 2L91A 2HFED 1FAVA 2W6JH 1YJNP 4JYBA 3BRVB 1T2KD 3AEAD 4WB4A 4YSYC 1EZVD 2FYNB 3HE5B 3PHLA 3NTNA 2ZFCA 3CL3D 2J5UA 1BE3G 2O3JA 1VQLP 5K5GB 1YTZI 4ASVA 2BS4C 1P84D 3HD7A 1VQMP 1LP1A 2N1TA 2GM4A 1K05A 2OYHA 1SQXE 3RK3D 1NVOA 2E75D 3L70J 4K35A 1GU5A 1NYHA 3CD6P 1GD2E 5M1BA 3OW2O 1NEKD 1QX8A 5CHXA 2KZIA 2HODB 3CX5D 3H1IE 3KZIH 3VOPA 1H88A 2R5BA 4Y28J 1KFYC 1GK4A 2XNDH 1QLED 3L71J 3GMAA 4U3FD 3LW5H 1BGYJ 3MP7B 2QJPB 3FXEA 1EZVG 1NAFA 1JTHB 1NTZE 1NTME 3MTUE 1Z56A 2AEJA 5KKZB 3V5BA 1SQXD 2NPSB 1H8AA 1L4AA 5KLVG 2HLOA 2OARA 1EQ7A 3CCMP 2QM7A 1VQ7P 4EI2A 1HH0A 2PFXA 3QWOC 2BEZF 4KX6D 4ZNCA 2AEFA 4WWIA 1FZFA 1SVFA 3HUSA 1KN7A 3SFDD 3RK2B 3KYQA 3CCLP 4RKUJ 1IZNB 2KK7A 2C9LY 1M1JA 1LGHB 2ZVOB 2NRGA 2E43A 2AXTE 1JOCA 1KB9I 2HYNA 1JB0J 2FFDC 2B76D 5B66H 2H88D 1QVFO 1CSBA 1HVVA 2R3CA 1QVGO 1G2CB 1KILB 4I7ZB 3P4QC 2E76C 4U7JA 2IBZD 3H1KD 2H89C 1BDDA 3H1LJ 2WDVD 2Z5IA 4DJGA 3SFDC 2FY8A 1ZP0C 2IYPA 3O6QB 4A7PA 1RF1C 2QJKC 5B5EH 2H43A 2OGUA 2H88C 1QL1A 3L37A 3L75D 3S1KA 1YTZT 3CC2P 2HODA 4W7YA 2ZFYA 4YPCA 1PFIA 2N1TC 3USSA 3M9HA 1SQVK 3GHGB 1HBWA 1N7SB 1L4AD 4R4LA 5H2FE 3VMXA 3EQ2A 1FZGA 2D2CC 1LT9B 2LR2A 1RF1A 1KORA 1IFMA 1L0LD 3AEDD 1NU1J 3P8MC 1FOSE 4BRYA 2R44A 4DT0A 1R5SA 1N2DC 4N3YB 3H6PA 2Q1KA 4PV1C 1Q86Q 3AE2D 2R32A 5C2TC 3VRAC 1TFFA 3P4PC 1NHLA 3NMDA 3Q5PA 1SQPJ 3AEFC 2G3AA 5APQA 3TSIA 1KILE 1ZR2A 2RMZA 1LTAC 2PP6A 2PRRA 2HPCB 4BXLA 1NTMK 1G1JA 4CPGA 5B66E 2P67A 3CXHH 3ABVD 1VQNP 3AE1D 5TJHA 4B86A 1X79B 4NPEA 1FZCB 3KZIE 1T3JA 1PZQA 4OGQB 1KQSO 1LT9C 3VRAD 3II6A 1OZHA 2NPSC 1NU1G 1UIIA 3H1JE 4ASWA 1L0VC 3CIRD 3M91A 4NPFX 3S9OA 1JY2P 1VQ4P 1S5LH 1GL2C 2E74C 3H1IJ 2QJPC 4YTND 3G4SP 2IBZG 3AE8D 1W2BO 3L71E 3RK2C 4LLHA 3KQGA 3AE3C 4KJMA 4MN4C 2ACZC 3VTPC 2IBZE 3B4SA 1E79H 3L73E 1RE4C 3PTZA 2O01H 1UIXA 4H13C 5AVVB 1KF6C 1S5LE 2IX7C 1EDIA 1KD1Q 2OTJP 2W27A 2ZT9C 2K9YA 1Y8AA 4BRYB 3MZWB 1CI6B 1LTJC 2I1JA 3CPWO 1NTMD 3PJSK 1GW4A 1LTTC 2KI7B 1NTKD 2WITA 3L36A 1LTBC 1PPJG 3AECC 2WSEH 3H1LG 1PGJA 2P1JA 1N7LA 2FYUG 2YKPA 3OJAB 3HD7B 2RKLA 5B5EE 4K3AA 2N9YB 2FBWC 1PP9E 2WVRA 1WT6A 2IBZI 2KUBA 3VMYA 1K9MQ 5CBNA 4DHIB 3VRBC 2P7JA 1LTGC 1NGMB 4LC1A 3AE9C 3BCCD 1LTIC 4YSXD 3ZDMA 1RF0C 2KOGA 1Q2NA 3GF7A 1TU3F 2E42A 5APUA 4RO0A 2JP3A 3P4RC 5KLVJ 4OWFA 3GHGC 4PD4E 3RK3C 2C9NY 2D2CB 2K88A 1E5WA 3A3YB 2XZRA 3P4SD 1URQA 3RL0C 1HF9A 1AV1A 1KFYD 2N9BA 3AE4C 1AQTA 1YBKA 5CCGC 1XTCC 1RE4A 1NKNA 5AW9B 1KB9H 1NU1E 1AJYA 3P4RD 3CWBE 2YIUC 2OYOA 4NPDA 4IL6X 1T3UA 1LWUA 1RQVA 3ITKA 1GL2A 1IFJA 5AW7B 1FBMA 1OX3A 4HB1A 3L72G 1FS0E 4PV1D 1LTJB 3O6QA 3AE4D 1SQBD 3KPEA 3MGNA 1BE3D 4PD4D 1ZXGA 1GK6A 1IFNA 4UB6E 2BCCE 1BDCA 1VQKP 2WSEJ 3L74D 2WSFJ 1SQQG 3FWLA 2JJLA 4ZKUA 1KZUB 5KJ7A 1HJBA 2P58A 3CCSP 1SQXJ 2M3BA 3GW6A 3L70E 3PRJA 1L0NK 2CPSA 5CCGD 1OVRA 3H1HD 1KQFB 2ZT9B 3BRTB 3HE4A 1ZW0A 2IFNA 2O1JA 3AEBC 4DDIA 2N1TB 2WU2C 3CX5I 2KLVA 2POHA 3H1KG 1M56D 2AXCA 3L73G 4IL6H 2NPSD 3H1LD 1IJDB 4C7NA 5TISH 2FXPA 3CCUP 1L0LE 1L0VD 1BGYE 3CIRC 3L73J 1JY3O 2A06D 5C3JD 2WP9D 3AE6D 1NTMJ 5GTIH 2WDVC 4WY4D 4XFJA 4DOJA 4GT1A 2IYOA 3GHGA 2M5AA 4YT0C 1ZP0D 1URQD 3M0DC 4UB8H 1MUUA 2Y0DA 3FXDA 5TISE 2OYHC 1WRGA 1KB9E 1ZRTE 1Y47A 2B88A 5KAIH 1KILC 1JMBA 3PH0A 2I8DA 3V4QA 3CLQA 1HUCA 1LTSC 3WUUA 1OW8A 1KV4A 5AVTB 4PV1B 4AYCA 1IFDA 2FYZA 2WMMA 1IK7A 2MJZA 2WZ7A 2ZYDA 3FGAD 3N7NA 2W8ZA 5AVZB 1KYOH 5AW4B 4RESB 3L70D 3L72J 4I1LA 4H13B 1U7MA 1KYOI 2IZ0A 3B5NB 3MUDA 1WMKA 1JCDA 1KILD 2G8YA 2ZXEB 1X8YA 2E5TA 4WY4C 3CCJP 3T97B 2W83C 1QGKB 2H8PD 1S9KE 2WPSA 2FFDB 3B5NA 2E5YA 4PD4H 2M5AB 1M1JC 1KQGB 4H44D 4YSXC 2IFMA 2QE7H 1SQXK 4AUWA 3Q5SA 2YMKA 4OVNF 1E7PC 1FDIA 3RL0B 2WPQA 3IN6A 1IK9A
chains in the Genus database with same CATH topology
3SFED 2WU5D 2JO1A 2MKVA 3Q2YA 2OQQA 1NEKC 4YT0C 1RQVA 1ZP0D 2IDBA 3AEAC 1PV3A 2H88C 2WPVB 4OGQB 2E75B 3GF3A 4H0LB 2WDQD 3AE5C 4H0LD 2ZT9D 3AE2C 3VRAD 4GDOA 3P4SC 2E74D 5KKZC 1NENC 3VRBC 3AEBD 5C2TD 4R4MA 2WQYC 1NGMB 4YTPC 1QLBC 4H13D 3C8VA 3D6YA 2WDRC 1DD3A 1ZRTE 3VR8D 2FYNC 4YTMC 1OW7A 3D70A 1L0VC 4PV1D 3B71A 3O6QA 3VR9C 3CIRD 3AE9C 1Y9BA 3S9OA 1PIXA 1Q90D 2V7QJ 1EXJA 1HJ0A 4H44B 3AEGD 2E76B 1K04A 2BS2C 3AE4D 2E74B 4YSXD 2BS3C 2E76D 2E74C 2QJPC 1YQ4C 2WP9C 1ZOYC 3AEED 4R4LA 4YSZC 4YTND 4YTPD 4OGQC 2BEZF 3ABVC 2QIWA 2B76C 1OW8A 4TT3H 4KX6D 1FDOA 2D2CC 4PV1B 3R4YA 1EXIA 3AE7D 4YTMD 3P4QD 4H0LC 1YQ3C 3AE8D 3Q3DA 2WS3C 3VR9D 3SFDD 1NEND 3VRBD 3GF7A 1KORA 2WSEJ 2WSFJ 1VF5C 4RKUJ 1TU3F 1IK7A 3AEAD 4YXDC 2JP3A 3LW5J 3AE3C 3P4PD 3P4RC 1MKMA 1DIPA 3FGAD 1YQ4D 2ACZC 3AEDD 4YSYC 3AECD 4OGQD 3SFEC 3Q5RA 5L8RJ 3AE5D 2J5UA 3AEGC 1KTMA 2D2CD 2BEQD 4H44C 2QSIA 3RL0g 1UIXA 3RK3E 4H13C 5C3JC 1JB0J 4H13B 1KF6C 1S1CX 2B76D 2BS4C 1KMIZ 4PV1C 3AEDC 3AE2D 4YSYD 4Z1MH 1KQFB 2H88D 3G9RA 3AE9D 2D2CB 1VL2A 3AE1C 1OW6A 1K05A 3AE8C 3H25A 5C2TC 2WQYD 2H89D 2ZT9B 3VR8C 2ZT9C 3VRAC 1WMKA 1U57A 3P4SD 1ZOYD 2K9YA 3AE3D 3P4PC 4YTNC 3D6ZA 3AEBC 2G8YA 2E75D 1PL5A 3AE6C 3Q5PA 2WU2C 4I7ZB 3P4QC 2NZ2A 1NYHA 4KT0J 1HF9A 2E76C 4U7JA 1DD4A 3AEFC 2G3AA 5M1BA 2FBWD 1KFYD 1KILE 2P10A 3T97B 3GLMA 1NEKD 3AE4C 2H89C 4YT0D 3D71A 4YXDD 3Q1MA 1KF6D 1ZMEC 3AE1D 3AE7C 1S5LX 2FXPA 3AECC 2WDVD 1L0VD 2WS3D 2O01J 2E75C 3SFDC 4IL6X 2WU5C 3CIRC 2WDQC 1VF5D 1ZP0C 5KLIC 1KQGB 4H44D 1VF5B 4XFJA 4Y28J 1R8EA 1AJYA 3AEFD 3P4RD 1KFYC 4YSXC 5C3JD 3AEEC 2WSCJ 2WDRD 2WP9D 4YSZD 3Q5SA 2YMKA 3IN6A 1E7PC 3AE6D 1FDIA 1RQUA 1OMIA 2WU2D 4I7ZC 3ABVD 2YIUC 4KX6C 2QJKC 2WDVC 2ACZD 3GMAA 1GMJA 2QJYC 3IAOA 2FBWC 3EWKA 1YQ3D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SFE D;  2WU5 D;  1NEK C;  4YT0 C;  1ZP0 D;  3AEA C;  1PV3 A;  2H88 C;  2WDQ D;  3AE5 C;  3VRA D;  3AE2 C;  3P4S C;  1NEN C;  3VRB C;  3AEB D;  5C2T D;  2WQY C;  1QLB C;  4YTP C;  2WDR C;  3VR8 D;  4YTM C;  1OW7 A;  1L0V C;  3B71 A;  3VR9 C;  3CIR D;  3AE9 C;  3S9O A;  3AEG D;  3AE4 D;  1K04 A;  2BS2 C;  4YSX D;  2BS3 C;  1YQ4 C;  2WP9 C;  1ZOY C;  3AEE D;  4YSZ C;  4YTN D;  4YTP D;  3ABV C;  2B76 C;  4KX6 D;  1OW8 A;  4YTM D;  3AE7 D;  3P4Q D;  1YQ3 C;  3AE8 D;  2WS3 C;  3VR9 D;  3SFD D;  1NEN D;  3VRB D;  3AEA D;  4YXD C;  3AE3 C;  3P4P D;  3P4R C;  1YQ4 D;  3AED D;  2ACZ C;  4YSY C;  3AEC D;  3SFE C;  3AE5 D;  3AEG C;  1KTM A;  5C3J C;  1KF6 C;  2B76 D;  2BS4 C;  3AED C;  3AE2 D;  4YSY D;  2H88 D;  3AE9 D;  3AE1 C;  3AE8 C;  1K05 A;  1OW6 A;  5C2T C;  2WQY D;  2H89 D;  3VR8 C;  3VRA C;  3P4S D;  1ZOY D;  3AE3 D;  3P4P C;  4YTN C;  3AEB C;  3AE6 C;  2WU2 C;  3P4Q C;  2FBW D;  3AEF C;  2G3A A;  1KFY D;  1NEK D;  4YT0 D;  3AE4 C;  2H89 C;  4YXD D;  1KF6 D;  3AE7 C;  2WDV D;  3AEC C;  1L0V D;  2WS3 D;  3SFD C;  2WU5 C;  3CIR C;  2WDQ C;  1ZP0 C;  4YSX C;  3AEF D;  3P4R D;  1KFY C;  5C3J D;  3AEE C;  2WP9 D;  2WDR D;  4YSZ D;  1E7P C;  3AE6 D;  3ABV D;  2WU2 D;  4KX6 C;  2WDV C;  2ACZ D;  3AE1 D;  2FBW C;  1YQ3 D; 
#chains in the Genus database with same CATH topology
 1EZV E;  2JKV A;  4W7Z A;  1SQP K;  1X9V A;  1DX7 A;  1JNM A;  1GU4 A;  1T6A A;  1L0N D;  1QLB C;  2WDR C;  3D6Y A;  4L73 A;  3IR9 A;  2FYU K;  2Q7C A;  1Y9B A;  1LWU B;  3TGU J;  2O1K A;  3H1H E;  3LIE A;  4H44 B;  4HH2 A;  2KNC A;  1NWQ A;  1P84 E;  4DHZ A;  1S2E A;  3H1J G;  4OGQ C;  3CCE P;  2KP8 A;  3CWB J;  2A06 E;  3A7O A;  3FWN A;  1NAY A;  3CXH E;  3L75 E;  2WS3 C;  1NEN D;  1YJW P;  4TLF A;  2ZAE B;  3VYI A;  1L2P A;  3IF4 A;  3L71 D;  2A45 I;  5AVY B;  1SQP E;  5CBO A;  4IL6 E;  3G9R A;  1OW6 A;  2HG5 D;  4GOD A;  2QJK B;  4KHX A;  1NKZ B;  3BAT A;  2PAJ A;  1NTK G;  1NO4 A;  3M9B A;  2R5D A;  3I56 P;  1OFC X;  2FYU J;  3R2P A;  1ZME C;  2BAS A;  3TNU A;  1SQV J;  3GG2 A;  1YI2 P;  1J1D B;  1LP1 B;  4U3F J;  1VQO P;  1J1E B;  1D7M A;  2K1A A;  2WDR D;  3BAS A;  3OAK A;  1FDM A;  3WU2 H;  1NEK C;  2B87 A;  3SWF A;  3RBZ A;  1N73 C;  2FKW B;  1NEN C;  3A0H E;  2Z5H A;  1BSH A;  3B71 A;  5KTB A;  1L0L J;  2V7Q J;  1BCC D;  1OIP A;  3CWB D;  4O9B A;  1EDK A;  3RK3 B;  3ABV C;  1NTK K;  4RJT A;  4YTM D;  3H1I G;  3VR9 D;  5CJ0 A;  2XNX A;  1JMM A;  2OYH B;  4GKG A;  1MKM A;  2QA4 P;  1DIP A;  2YIU B;  1CZQ A;  3B5N D;  3JSV C;  1VQ5 P;  5C3J C;  3TYY A;  1S1C X;  2WSS H;  5APY A;  3A0B H;  2C0W A;  1BSN A;  1J2J B;  2O01 N;  1MZ9 A;  2HPC A;  2Q9I A;  1S9K D;  4YTN C;  1FJK A;  5H2F H;  1A02 F;  1JY2 N;  1W5C E;  5AVW B;  1FU1 A;  4YXD D;  1L0L K;  1OVV A;  1JTH A;  2H7H A;  3M0A A;  2WU5 C;  2OYI B;  1NU1 K;  2WT7 B;  1VF5 B;  3H1J D;  1R8E A;  2WSC J;  1JEK A;  3L72 E;  1SQP G;  3H1I D;  5AVQ B;  2WSC H;  2QJY C;  3EWK A;  1YQ3 D;  3V6I A;  1K73 Q;  4C7R A;  2RN0 A;  3A2A A;  1NTK E;  1L0N E;  4PJ0 E;  4EIJ A;  1KC8 Q;  3U1C A;  4YTP C;  1DD3 A;  3D70 A;  2KXP B;  5AW3 B;  2PGD A;  4HKZ H;  2UWJ E;  3CXH D;  5GTI E;  3I55 P;  2E76 D;  1YQ4 C;  5KLV E;  2QM8 A;  3OA7 A;  1EXI A;  3JCU H;  1A02 J;  3L75 G;  2W6A A;  3M9Q A;  1LWU C;  4H44 C;  1URQ B;  1FZC C;  4Y99 C;  5KAF E;  3H1H G;  1M90 Q;  2CPB A;  4D6T E;  1KMI Z;  2JWA A;  3WUT A;  1G1I A;  2YKQ A;  2ZYG A;  3AE9 D;  3CC4 P;  3TGU E;  3HRN A;  5CCG A;  4D6T G;  2LKM A;  1CW5 A;  1N8R Q;  4ZMD A;  2GUV A;  2P10 A;  1JM0 A;  4QMA A;  3CX5 H;  3MIW A;  2Q3E A;  1VQ8 P;  5KAF H;  1SQV D;  1S4X A;  5E79 H;  4N78 D;  1S72 P;  1MV8 A;  1LT1 A;  1L4A B;  3HD7 C;  3VN0 A;  2J59 M;  2JO1 A;  3Q2Y A;  3P8C D;  1GDT A;  1P84 I;  5CCH C;  1VQ9 P;  5E79 E;  3T97 A;  1P84 H;  3AE5 C;  3AE2 C;  3M06 A;  5C2T D;  3E1R A;  1L0N G;  4JBZ A;  2FYU E;  1OW7 A;  4IFM A;  2RH0 A;  2BCC J;  5AW1 B;  1SQV E;  4DHJ A;  1KFM A;  2BS3 C;  2Z4E A;  3AEE D;  1ZOY C;  2B76 C;  1XTG B;  2JDI H;  3AE7 D;  2QRX A;  1DEB A;  2WTY A;  1VF5 C;  3EFG A;  1ZN5 A;  1R5L A;  2GA1 A;  5DJT B;  1ZRT D;  2YMY A;  5APS A;  2AEM A;  4DDG A;  4N6J A;  3L74 G;  3AE8 C;  3NXS A;  1PGP A;  1YYC A;  2I1K A;  1BGY G;  4WVZ A;  3AE3 D;  1FZA A;  3HD7 D;  3L71 G;  3VP9 A;  2N1T D;  3VON A;  2W90 A;  3C1L A;  3PLN A;  1FOS F;  2WPR A;  2Q6Q A;  5KLV D;  2A45 G;  3D71 A;  1FZC A;  3Q1M A;  1KF6 D;  2J58 A;  3AE7 C;  3WUV A;  3CME P;  5AW5 B;  4DCK A;  1VF5 D;  1FC2 C;  3KHU A;  1LNQ A;  2XKM A;  5AW8 B;  4BWN A;  1OMI A;  3L70 G;  4LDT A;  1SQB E;  4UB8 E;  2ACZ D;  1CI6 A;  2CK3 H;  1N7S A;  3CXH I;  4ZKP A;  1VQP P;  3LID A;  3AEA C;  4Y99 B;  1T2K C;  3O8Z A;  3H1K E;  2XV5 A;  2VRS A;  3L74 J;  4C46 A;  1AFO A;  2K3R A;  1NTZ K;  2WDQ D;  5AW2 B;  2WT7 A;  4GDO A;  4R4M A;  1BE3 J;  2W6B A;  1RY3 A;  2FYN C;  5KJ7 C;  2KS1 B;  4JF7 A;  2E76 B;  1SFC C;  3SSU A;  3NFQ A;  4D6T D;  5AW0 B;  2WP9 C;  4YSZ C;  2IPP A;  4HJG H;  1FDO A;  5C39 A;  1YIJ P;  3VRB D;  1SQQ E;  4YXD C;  3P4P D;  2BCC G;  4OGQ D;  5AVX B;  1AQ5 A;  1L0N J;  3G3Z A;  2ZVN B;  2QSI A;  1PGO A;  4JPZ B;  3RL0 g;  2JR8 A;  1YJ9 P;  3CX5 E;  2YXQ B;  4IOI H;  1IFI A;  1OVU A;  3JCU E;  3EFF K;  1IO4 A;  2ITA A;  1W2E A;  2KSJ A;  3I5C A;  5BU5 A;  1ZV8 A;  1KYO E;  5BVZ A;  1RHZ B;  1N7S C;  5KLV K;  3PP5 A;  4UB6 H;  1SQB G;  1PP9 D;  2WDQ C;  3QH9 A;  1M57 D;  1Q7Y Q;  3A5T A;  1FZB A;  4KX6 C;  1OXZ A;  1SP4 A;  2QG4 A;  4D6T J;  1NJI Q;  1VDF A;  4I6L A;  2WPV B;  2BCC D;  2E75 B;  4HYT B;  3GF3 A;  3U1A A;  4W80 A;  3H1H J;  2ZT9 D;  2YO2 A;  2FXM A;  4GOF A;  1SLQ A;  3C9I A;  4YTM C;  2A45 H;  3VMA A;  1N73 A;  3L75 J;  3RL0 D;  3VR9 C;  2WSF H;  2C0X A;  3KDP B;  1FJP A;  2FXO A;  2ZJS E;  2JWD A;  3TK1 A;  3P32 A;  2QIW A;  3U59 A;  4LGD E;  3P4Q D;  4H0L C;  3Q3D A;  3BCC E;  1PPJ D;  1PGQ A;  3LW5 J;  1S3J A;  2WWW A;  3G6E P;  3Q5R A;  5APT A;  1HGZ A;  1PP9 G;  2K37 A;  3RK3 E;  3MUD C;  1FE6 A;  2R3S A;  1KIL A;  4YSY D;  1EZV I;  3H25 A;  1AVO A;  1M1J B;  3F89 A;  1KFN A;  3A0H H;  1U57 A;  1PPJ E;  1IFP A;  2M3E A;  2IZ1 A;  4U3F E;  2NZ2 A;  2FBW D;  4WY4 B;  1DD4 A;  3L73 D;  2XDJ A;  3M0D A;  5CCH A;  1AVY A;  2P2U A;  3VP8 A;  1BCC J;  2E75 C;  2B87 B;  1H0T A;  1USE A;  2YXR B;  3BCC G;  5KLI C;  4L74 A;  1EC5 A;  3AEE C;  1L4A C;  2GUS A;  2YO3 A;  2WU2 D;  4JQ0 D;  1NTZ G;  2QEX P;  1GMJ A;  1LTJ A;  5KAI E;  2WU5 D;  2MKV A;  1YHQ P;  1X0T A;  1BGY D;  2Y9Z A;  1Q81 Q;  5CJ4 A;  1JY2 O;  4C7N B;  1N73 B;  5GTH E;  3BVH A;  4H0L D;  1NOH A;  3P4S C;  4YXW H;  3V2N A;  2WQY C;  1SQQ K;  3VR8 D;  4L76 A;  3WMM 0;  1K04 A;  4L75 A;  1GL2 B;  2E74 B;  4XA4 A;  1H89 A;  2M0B A;  1DH3 A;  4YTP D;  2KYV A;  5APV A;  5AW6 B;  2K9J B;  5AVS B;  3KXD A;  5GTH H;  1FZE A;  1L0L G;  1YQ4 D;  2Y0E A;  2NPS A;  4I2L C;  3L74 E;  3HTK A;  2ZYA A;  2QJY B;  2BEQ D;  3G71 P;  3MD0 A;  1LT9 A;  4EDF A;  1SS1 A;  2Y0C A;  1AA0 A;  1USD A;  1BE3 E;  2SPZ A;  1K8A Q;  4Z1M H;  1J1D C;  3AE1 C;  4XE5 B;  3W68 A;  2WQY D;  2H89 D;  3VR8 C;  1KYO D;  3D6Z A;  2OTK E;  1PL5 A;  2AXT H;  2YNY A;  3GLM A;  4U3F G;  1SQV G;  2KSE A;  3E1I A;  5KJ7 D;  3B5N C;  2M8R A;  3CCQ P;  5CCH D;  1SFC D;  4JYC A;  2Q5U A;  5EFW B;  1NTK J;  4YSZ D;  1JY3 N;  1G2C A;  4I7Z C;  3L4F A;  4N78 E;  2OYI A;  1GZL A;  1HGV A;  1U7J A;  1H0T B;  4PD4 I;  2IDB A;  1SQQ D;  5AVU B;  1SQP D;  5KKZ C;  3V2R A;  4GIF A;  3AEB D;  4H13 D;  3C8V A;  3CC7 P;  3CCR P;  3P8C E;  3HE5 A;  1T8Z A;  1PIX A;  1EXJ A;  1M8O B;  2B89 A;  3P7K A;  2L5G B;  1M1K Q;  3K5B A;  2V4H A;  3CWB G;  3H1J J;  3N4X A;  3SWK A;  1IC2 A;  1YQ3 C;  3HE4 B;  3MHV A;  1YIT P;  1LJ2 A;  3TGU G;  3VMZ A;  3AEC D;  5L8R J;  3AEG C;  1KTM A;  2D2C D;  1URQ C;  1ZR4 A;  2KNC B;  1RE3 C;  3AED C;  1VL2 A;  4M3L A;  2JEE A;  3RGU A;  1M7L A;  3HTK B;  5BU8 B;  3H32 B;  1HTL C;  1NTZ J;  1X22 A;  5AVR B;  3AE6 C;  1JCC A;  2B9B A;  4IFD K;  1JO5 A;  4YT0 D;  3BCC J;  1ZLL A;  1S5L X;  1BCC G;  3UIA A;  2O01 J;  5KLI B;  5APW A;  3AEF D;  2FYU D;  1RQU A;  2KS1 A;  3V2Q A;  3IAO A;  4GOE A;  1EDJ A;  3SFE D;  3RBX A;  4PJ0 H;  1SFC B;  1PV3 A;  2FFD A;  3V4W A;  3TGU D;  4H0L B;  2LXC B;  1J1E C;  1GL2 D;  2E74 D;  2LXB A;  1PP9 J;  1JUN A;  4WBA A;  1MFZ A;  4EOT A;  1NU1 D;  3F5H A;  3E7K A;  4AQR D;  1BCC E;  1VPC A;  1SFC A;  3AEG D;  1Q90 D;  1HJ0 A;  1HWT C;  3JC2 2;  3L35 A;  3HUS C;  4TT3 H;  1NH4 A;  1EDL A;  2ZXX A;  1GW3 A;  3H1L E;  2A06 G;  3SFE C;  4EYY Q;  3AE5 D;  1N86 A;  3RK2 D;  3TDK A;  3SWY A;  3A0B E;  3H32 A;  1OWA A;  3FX0 A;  3V2P A;  3TNU B;  3IFM A;  1NTZ D;  2KLU A;  2XU6 A;  4FJV A;  1N7S D;  1ZOY D;  3W67 A;  1JY3 P;  1RF1 B;  1Q82 Q;  1NTM G;  2K9J A;  4KT0 J;  3CMA P;  2KB7 P;  3L72 D;  1DEE G;  4OH8 B;  1SQB J;  1MFT A;  2Q3I A;  2WS3 D;  3CCV P;  3H1K J;  2V7Q H;  3WU2 E;  4DZO A;  1RE3 A;  2KIK A;  2KZJ A;  1SQB K;  2QVA A;  2DW3 A;  3S4R A;  3B8E B;  2OQQ A;  3TF5 A;  1QL2 A;  1RH5 B;  4WY4 A;  3HUS B;  4IFF A;  2HR3 A;  2OYI C;  1KQL A;  2OTL P;  1SQX G;  5CMZ A;  2Y9Y A;  4I6M C;  2YKO A;  1SQQ J;  2BS2 C;  5APX A;  1KB9 D;  3CI9 A;  1QEX A;  1GTW A;  1RF0 A;  1VQ6 P;  5DJU B;  3R4Y A;  2L91 A;  2HFE D;  1FAV A;  2W6J H;  1YJN P;  4JYB A;  3BRV B;  1T2K D;  3AEA D;  4WB4 A;  4YSY C;  1EZV D;  2FYN B;  3HE5 B;  3PHL A;  3NTN A;  2ZFC A;  3CL3 D;  2J5U A;  1BE3 G;  2O3J A;  1VQL P;  5K5G B;  1YTZ I;  4ASV A;  2BS4 C;  1P84 D;  3HD7 A;  1VQM P;  1LP1 A;  2N1T A;  2GM4 A;  1K05 A;  2OYH A;  1SQX E;  3RK3 D;  1NVO A;  2E75 D;  3L70 J;  4K35 A;  1GU5 A;  1NYH A;  3CD6 P;  1GD2 E;  5M1B A;  3OW2 O;  1NEK D;  1QX8 A;  5CHX A;  2KZI A;  2HOD B;  3CX5 D;  3H1I E;  3KZI H;  3VOP A;  1H88 A;  2R5B A;  4Y28 J;  1KFY C;  1GK4 A;  2XND H;  1QLE D;  3L71 J;  3GMA A;  4U3F D;  3LW5 H;  1BGY J;  3MP7 B;  2QJP B;  3FXE A;  1EZV G;  1NAF A;  1JTH B;  1NTZ E;  1NTM E;  3MTU E;  1Z56 A;  2AEJ A;  5KKZ B;  3V5B A;  1SQX D;  2NPS B;  1H8A A;  1L4A A;  5KLV G;  2HLO A;  2OAR A;  1EQ7 A;  3CCM P;  2QM7 A;  1VQ7 P;  4EI2 A;  1HH0 A;  2PFX A;  3QWO C;  2BEZ F;  4KX6 D;  4ZNC A;  2AEF A;  4WWI A;  1FZF A;  1SVF A;  3HUS A;  1KN7 A;  3SFD D;  3RK2 B;  3KYQ A;  3CCL P;  4RKU J;  1IZN B;  2KK7 A;  2C9L Y;  1M1J A;  1LGH B;  2ZVO B;  2NRG A;  2E43 A;  2AXT E;  1JOC A;  1KB9 I;  2HYN A;  1JB0 J;  2FFD C;  2B76 D;  5B66 H;  2H88 D;  1QVF O;  1CSB A;  1HVV A;  2R3C A;  1QVG O;  1G2C B;  1KIL B;  4I7Z B;  3P4Q C;  2E76 C;  4U7J A;  2IBZ D;  3H1K D;  2H89 C;  1BDD A;  3H1L J;  2WDV D;  2Z5I A;  4DJG A;  3SFD C;  2FY8 A;  1ZP0 C;  2IYP A;  3O6Q B;  4A7P A;  1RF1 C;  2QJK C;  5B5E H;  2H43 A;  2OGU A;  2H88 C;  1QL1 A;  3L37 A;  3L75 D;  3S1K A;  1YTZ T;  3CC2 P;  2HOD A;  4W7Y A;  2ZFY A;  4YPC A;  1PFI A;  2N1T C;  3USS A;  3M9H A;  1SQV K;  3GHG B;  1HBW A;  1N7S B;  1L4A D;  4R4L A;  5H2F E;  3VMX A;  3EQ2 A;  1FZG A;  2D2C C;  1LT9 B;  2LR2 A;  1RF1 A;  1KOR A;  1IFM A;  1L0L D;  3AED D;  1NU1 J;  3P8M C;  1FOS E;  4BRY A;  2R44 A;  4DT0 A;  1R5S A;  1N2D C;  4N3Y B;  3H6P A;  2Q1K A;  4PV1 C;  1Q86 Q;  3AE2 D;  2R32 A;  5C2T C;  3VRA C;  1TFF A;  3P4P C;  1NHL A;  3NMD A;  3Q5P A;  1SQP J;  3AEF C;  2G3A A;  5APQ A;  3TSI A;  1KIL E;  1ZR2 A;  2RMZ A;  1LTA C;  2PP6 A;  2PRR A;  2HPC B;  4BXL A;  1NTM K;  1G1J A;  4CPG A;  5B66 E;  2P67 A;  3CXH H;  3ABV D;  1VQN P;  3AE1 D;  5TJH A;  4B86 A;  1X79 B;  4NPE A;  1FZC B;  3KZI E;  1T3J A;  1PZQ A;  4OGQ B;  1KQS O;  1LT9 C;  3VRA D;  3II6 A;  1OZH A;  2NPS C;  1NU1 G;  1UII A;  3H1J E;  4ASW A;  1L0V C;  3CIR D;  3M91 A;  4NPF X;  3S9O A;  1JY2 P;  1VQ4 P;  1S5L H;  1GL2 C;  2E74 C;  3H1I J;  2QJP C;  4YTN D;  3G4S P;  2IBZ G;  3AE8 D;  1W2B O;  3L71 E;  3RK2 C;  4LLH A;  3KQG A;  3AE3 C;  4KJM A;  4MN4 C;  2ACZ C;  3VTP C;  2IBZ E;  3B4S A;  1E79 H;  3L73 E;  1RE4 C;  3PTZ A;  2O01 H;  1UIX A;  4H13 C;  5AVV B;  1KF6 C;  1S5L E;  2IX7 C;  1EDI A;  1KD1 Q;  2OTJ P;  2W27 A;  2ZT9 C;  2K9Y A;  1Y8A A;  4BRY B;  3MZW B;  1CI6 B;  1LTJ C;  2I1J A;  3CPW O;  1NTM D;  3PJS K;  1GW4 A;  1LTT C;  2KI7 B;  1NTK D;  2WIT A;  3L36 A;  1LTB C;  1PPJ G;  3AEC C;  2WSE H;  3H1L G;  1PGJ A;  2P1J A;  1N7L A;  2FYU G;  2YKP A;  3OJA B;  3HD7 B;  2RKL A;  5B5E E;  4K3A A;  2N9Y B;  2FBW C;  1PP9 E;  2WVR A;  1WT6 A;  2IBZ I;  2KUB A;  3VMY A;  1K9M Q;  5CBN A;  4DHI B;  3VRB C;  2P7J A;  1LTG C;  1NGM B;  4LC1 A;  3AE9 C;  3BCC D;  1LTI C;  4YSX D;  3ZDM A;  1RF0 C;  2KOG A;  1Q2N A;  3GF7 A;  1TU3 F;  2E42 A;  5APU A;  4RO0 A;  2JP3 A;  3P4R C;  5KLV J;  4OWF A;  3GHG C;  4PD4 E;  3RK3 C;  2C9N Y;  2D2C B;  2K88 A;  1E5W A;  3A3Y B;  2XZR A;  3P4S D;  1URQ A;  3RL0 C;  1HF9 A;  1AV1 A;  1KFY D;  2N9B A;  3AE4 C;  1AQT A;  1YBK A;  5CCG C;  1XTC C;  1RE4 A;  1NKN A;  5AW9 B;  1KB9 H;  1NU1 E;  1AJY A;  3P4R D;  3CWB E;  2YIU C;  2OYO A;  4NPD A;  4IL6 X;  1T3U A;  1LWU A;  1RQV A;  3ITK A;  1GL2 A;  1IFJ A;  5AW7 B;  1FBM A;  1OX3 A;  4HB1 A;  3L72 G;  1FS0 E;  4PV1 D;  1LTJ B;  3O6Q A;  3AE4 D;  1SQB D;  3KPE A;  3MGN A;  1BE3 D;  4PD4 D;  1ZXG A;  1GK6 A;  1IFN A;  4UB6 E;  2BCC E;  1BDC A;  1VQK P;  2WSE J;  3L74 D;  2WSF J;  1SQQ G;  3FWL A;  2JJL A;  4ZKU A;  1KZU B;  5KJ7 A;  1HJB A;  2P58 A;  3CCS P;  1SQX J;  2M3B A;  3GW6 A;  3L70 E;  3PRJ A;  1L0N K;  2CPS A;  5CCG D;  1OVR A;  3H1H D;  1KQF B;  2ZT9 B;  3BRT B;  3HE4 A;  1ZW0 A;  2IFN A;  2O1J A;  3AEB C;  4DDI A;  2N1T B;  2WU2 C;  3CX5 I;  2KLV A;  2POH A;  3H1K G;  1M56 D;  2AXC A;  3L73 G;  4IL6 H;  2NPS D;  3H1L D;  1IJD B;  4C7N A;  5TIS H;  2FXP A;  3CCU P;  1L0L E;  1L0V D;  1BGY E;  3CIR C;  3L73 J;  1JY3 O;  2A06 D;  5C3J D;  2WP9 D;  3AE6 D;  1NTM J;  5GTI H;  2WDV C;  4WY4 D;  4XFJ A;  4DOJ A;  4GT1 A;  2IYO A;  3GHG A;  2M5A A;  4YT0 C;  1ZP0 D;  1URQ D;  3M0D C;  4UB8 H;  1MUU A;  2Y0D A;  3FXD A;  5TIS E;  2OYH C;  1WRG A;  1KB9 E;  1ZRT E;  1Y47 A;  2B88 A;  5KAI H;  1KIL C;  1JMB A;  3PH0 A;  2I8D A;  3V4Q A;  3CLQ A;  1HUC A;  1LTS C;  3WUU A;  1OW8 A;  1KV4 A;  5AVT B;  4PV1 B;  4AYC A;  1IFD A;  2FYZ A;  2WMM A;  1IK7 A;  2MJZ A;  2WZ7 A;  2ZYD A;  3FGA D;  3N7N A;  2W8Z A;  5AVZ B;  1KYO H;  5AW4 B;  4RES B;  3L70 D;  3L72 J;  4I1L A;  4H13 B;  1U7M A;  1KYO I;  2IZ0 A;  3B5N B;  3MUD A;  1WMK A;  1JCD A;  1KIL D;  2G8Y A;  2ZXE B;  1X8Y A;  2E5T A;  4WY4 C;  3CCJ P;  3T97 B;  2W83 C;  1QGK B;  2H8P D;  1S9K E;  2WPS A;  2FFD B;  3B5N A;  2E5Y A;  4PD4 H;  2M5A B;  1M1J C;  1KQG B;  4H44 D;  4YSX C;  2IFM A;  2QE7 H;  1SQX K;  4AUW A;  3Q5S A;  2YMK A;  4OVN F;  1E7P C;  1FDI A;  3RL0 B;  2WPQ A;  3IN6 A;  1IK9 A; 
#chains in the Genus database with same CATH homology
 3SFE D;  2WU5 D;  2JO1 A;  2MKV A;  3Q2Y A;  2OQQ A;  1NEK C;  4YT0 C;  1RQV A;  1ZP0 D;  2IDB A;  3AEA C;  1PV3 A;  2H88 C;  2WPV B;  4OGQ B;  2E75 B;  3GF3 A;  4H0L B;  2WDQ D;  3AE5 C;  4H0L D;  2ZT9 D;  3AE2 C;  3VRA D;  4GDO A;  3P4S C;  2E74 D;  5KKZ C;  1NEN C;  3VRB C;  3AEB D;  5C2T D;  4R4M A;  2WQY C;  1NGM B;  4YTP C;  1QLB C;  4H13 D;  3C8V A;  3D6Y A;  2WDR C;  1DD3 A;  1ZRT E;  3VR8 D;  2FYN C;  4YTM C;  1OW7 A;  3D70 A;  1L0V C;  4PV1 D;  3B71 A;  3O6Q A;  3VR9 C;  3CIR D;  3AE9 C;  1Y9B A;  3S9O A;  1PIX A;  1Q90 D;  2V7Q J;  1EXJ A;  1HJ0 A;  4H44 B;  3AEG D;  2E76 B;  1K04 A;  2BS2 C;  3AE4 D;  2E74 B;  4YSX D;  2BS3 C;  2E76 D;  2E74 C;  2QJP C;  1YQ4 C;  2WP9 C;  1ZOY C;  3AEE D;  4R4L A;  4YSZ C;  4YTN D;  4YTP D;  4OGQ C;  2BEZ F;  3ABV C;  2QIW A;  2B76 C;  1OW8 A;  4TT3 H;  4KX6 D;  1FDO A;  2D2C C;  4PV1 B;  3R4Y A;  1EXI A;  3AE7 D;  4YTM D;  3P4Q D;  4H0L C;  1YQ3 C;  3AE8 D;  3Q3D A;  2WS3 C;  3VR9 D;  3SFD D;  1NEN D;  3VRB D;  3GF7 A;  1KOR A;  2WSE J;  2WSF J;  1VF5 C;  4RKU J;  1TU3 F;  1IK7 A;  3AEA D;  4YXD C;  2JP3 A;  3LW5 J;  3AE3 C;  3P4P D;  3P4R C;  1MKM A;  1DIP A;  3FGA D;  1YQ4 D;  2ACZ C;  3AED D;  4YSY C;  3AEC D;  4OGQ D;  3SFE C;  3Q5R A;  5L8R J;  3AE5 D;  2J5U A;  3AEG C;  1KTM A;  2D2C D;  2BEQ D;  4H44 C;  2QSI A;  3RL0 g;  1UIX A;  3RK3 E;  4H13 C;  5C3J C;  1JB0 J;  4H13 B;  1KF6 C;  1S1C X;  2B76 D;  2BS4 C;  1KMI Z;  4PV1 C;  3AED C;  3AE2 D;  4YSY D;  4Z1M H;  1KQF B;  2H88 D;  3G9R A;  3AE9 D;  2D2C B;  1VL2 A;  3AE1 C;  1OW6 A;  1K05 A;  3AE8 C;  3H25 A;  5C2T C;  2WQY D;  2H89 D;  2ZT9 B;  3VR8 C;  2ZT9 C;  3VRA C;  1WMK A;  1U57 A;  3P4S D;  1ZOY D;  2K9Y A;  3AE3 D;  3P4P C;  4YTN C;  3D6Z A;  3AEB C;  2G8Y A;  2E75 D;  1PL5 A;  3AE6 C;  3Q5P A;  2WU2 C;  4I7Z B;  3P4Q C;  2NZ2 A;  1NYH A;  4KT0 J;  1HF9 A;  2E76 C;  4U7J A;  1DD4 A;  3AEF C;  2G3A A;  5M1B A;  2FBW D;  1KFY D;  1KIL E;  2P10 A;  3T97 B;  3GLM A;  1NEK D;  3AE4 C;  2H89 C;  4YT0 D;  3D71 A;  4YXD D;  3Q1M A;  1KF6 D;  1ZME C;  3AE1 D;  3AE7 C;  1S5L X;  2FXP A;  3AEC C;  2WDV D;  1L0V D;  2WS3 D;  2O01 J;  2E75 C;  3SFD C;  4IL6 X;  2WU5 C;  3CIR C;  2WDQ C;  1VF5 D;  1ZP0 C;  5KLI C;  1KQG B;  4H44 D;  1VF5 B;  4XFJ A;  4Y28 J;  1R8E A;  1AJY A;  3AEF D;  3P4R D;  1KFY C;  4YSX C;  5C3J D;  3AEE C;  2WSC J;  2WDR D;  2WP9 D;  4YSZ D;  3Q5S A;  2YMK A;  3IN6 A;  1E7P C;  3AE6 D;  1FDI A;  1RQU A;  1OMI A;  2WU2 D;  4I7Z C;  3ABV D;  2YIU C;  4KX6 C;  2QJK C;  2WDV C;  2ACZ D;  3GMA A;  1GMJ A;  2QJY C;  3IAO A;  2FBW C;  3EWK A;  1YQ3 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...