3AE2C

Crystal structure of porcine heart mitochondrial complex ii bound with 2-hydroxy-n-phenyl-benzamide
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with 2-Hydroxy-N-phenyl-benzamide
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 47
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3ae2C01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3ae2C02
5C3JC 4YTPD 1K05A 3SFEC 1ZP0D 3P4SD 1KTMA 3VR9D 3SFED 3P4PD 1NEKD 3AECD 4YT0D 1KFYD 3AEFC 3AEED 1QLBC 3AE3D 2B76C 2WDQD 2WP9C 4YTND 1ZOYC 3AEBC 2WS3C 3AEDC 1ZOYD 4YTMD 4YXDD 2WDVC 1YQ4D 1YQ3D 2H88C 2WU5D 5C2TD 3AE7C 4YSYC 1PV3A 3VR8C 1NENC 3AE5C 3AE7D 3VR8D 1OW8A 3AE5D 5C3JD 3VRAC 3P4QC 3VRAD 3AE1C 3P4RC 3AEAC 3AEFD 1K04A 3CIRC 3P4RD 2H89C 3AEAD 3AE8C 2B76D 2WP9D 3AEGC 3AEBD 2WDRC 2WS3D 3AE8D 3AEDD 2BS4C 2WDRD 2WDVD 1E7PC 3AE2C 2H88D 1L0VC 4YSYD 3AE2D 1NEND 2ACZC 2FBWC 3S9OA 2BS2C 2WU2C 3ABVC 1OW6A 3AE9C 1KF6C 3P4QD 3AE1D 4YSZC 1OW7A 4YSZD 3CIRD 2H89D 4YTPC 3VRBC 1ZP0C 3AE4C 3P4SC 3AEGD 3VR9C 3VRBD 3AE4D 1NEKC 3AECC 3P4PC 3AE6C 4YT0C 3AE6D 3SFDC 3B71A 1KFYC 1L0VD 3AEEC 4KX6C 3AE3C 3SFDD 2ACZD 2WDQC 2G3AA 4YTNC 4KX6D 2FBWD 2BS3C 4YTMC 2WU2D 3ABVD 4YXDC 1YQ4C 1YQ3C 2WU5C 4YSXC 2WQYC 1KF6D 3AE9D 5C2TC 4YSXD 2WQYD
chains in the Genus database with same CATH superfamily
1IZNB 1J1DB 3CCQP 1LTJB 1KILD 2OQQA 2A45I 2JP3A 1OXZA 1OVRA 1FZCC 1SQXJ 2VRSA 3L72J 1YHQP 2XNDH 1GL2A 3H1HJ 3L75G 1NU1G 3V2PA 2W27A 5KLVG 4HH2A 4CPGA 1SFCD 2O3JA 1RQUA 2FKWB 1IK7A 2CK3H 1OX3A 1FZEA 2XDJA 4JPZB 3Q3DA 1K04A 1L0NK 3CIRC 2E75D 1KORA 3HE5B 2WS3D 4I6MC 2KNCA 3JCUH 4N78E 1IJDB 1YJ9P 2N9YB 3S9OA 1N8RQ 2R5BA 1AA0A 3AE9C 3AE1D 3MIWA 4I7ZB 3KYQA 5CCGD 1JY2O 1OW7A 4IL6X 1Y47A 4IFDK 1FBMA 3AEGD 1IFMA 1M1JA 3T97B 4GKGA 1NEKC 2I8DA 3KDPB 4UB8E 2FYUK 5BVZA 2Y0CA 3I55P 4D6TG 1L0VD 4KX6C 2R32A 3U59A 1SQBE 3VMXA 2P58A 3O6QB 3CMAP 1VQ4P 2BS3C 3L73D 2V7QH 1Q90D 3D71A 1KF6D 3A0BH 2O1KA 1RF1A 4IFMA 1AV1A 2FFDA 1KILB 3L71D 2B87A 1HJBA 4PD4D 2R5DA 2XU6A 1SFCA 1HUCA 1SQPE 2WSFH 1BSNA 1NAFA 4OVNF 1YJNP 3CXHI 3AEBC 1LTSC 2O1JA 1QVFO 1Q81Q 1L4AC 1K9MQ 1JY2P 1JMMA 1PV3A 1NENC 3AE7D 3L74D 4KJMA 2P2UA 2KSEA 3VRAC 3A3YB 3IN6A 3WU2E 1K8AQ 1NTMJ 1URQD 4C7NB 2E75B 3AE8C 1L0LD 2BS4C 2KLVA 3E1IA 3PTZA 1WRGA 5CBOA 3L70D 4HB1A 1RE4C 5APXA 3V4QA 2H43A 2WU2C 4N6JA 1FZGA 1LP1A 4I6LA 1N7SB 4YSZC 3OW2O 1R5LA 3CIRD 1JY3N 4YTPC 2FYNC 3L72D 1JTHA 3PJSK 1BE3E 3D6ZA 4H0LD 1M7LA 4N3YB 2I1JA 2P1JA 3A5TA 3W67A 2YIUB 2FY8A 1KB9E 3AE9D 4Y28J 2NPSA 3GLMA 3CD6P 2NZ2A 1LGHB 2B88A 2BCCJ 1BCCE 1MFTA 2D2CC 1NEKD 1SQQJ 2ZVNB 5AW7B 1L0NE 3M0DC 1JNMA 1QLBC 3GHGB 1KC8Q 4WB4A 3BRTB 1FZCA 2IX7C 2C0XA 1YTZT 1YIJP 2OYIB 2JEEA 3CX5E 3CCJP 1J2JB 3FWLA 1MUUA 1HF9A 4WBAA 2OTJP 1MV8A 2AXTE 4ZNCA 1QL2A 1X8YA 3P4QC 1GZLA 1TFFA 5AVVB 3B5NC 3LIEA 2J59M 2OTKE 3CC2P 1URQB 5CHXA 4ASVA 3AEBD 2WDRC 1J1EC 2FXOA 2FYUE 3H1LG 3TGUE 1L4AD 1Q2NA 2WTYA 1NEND 3A0HE 2OYHB 1H89A 3Q2YA 1BDCA 2GA1A 1ZN5A 3W68A 2JKVA 5APYA 1NAYA 2PFXA 2YKOA 4DHIB 2N1TB 5CBNA 1SP4A 1CZQA 1FAVA 3JC22 3CI9A 4H0LB 2XZRA 3SFDC 3A2AA 1PP9E 2KP8A 5KJ7C 4YTNC 3FXEA 3GW6A 4XE5B 1AVYA 2QJYC 2WU2D 2HPCA 2KK7A 2QG4A 2WQYC 2QA4P 2P67A 4L73A 4DHZA 1LNQA 3HTKA 4H44D 3S1KA 1J1DC 1LTJC 1ZMEC 1JEKA 2L5GB 3GG2A 4YTPD 1D7MA 1NOHA 1N73A 1ZXGA 1NGMB 3Q5SA 1T6AA 2C9NY 4XFJA 1U7JA 1SQPG 3MUDC 3AEDC 1AFOA 1PGQA 3KZIH 1LT1A 3EQ2A 3VR8C 1DD3A 4EIJA 1IK9A 1L4AA 2D2CD 1A02J 1N2DC 3P4RD 5E79E 3NTNA 3L35A 2FXPA 1EDLA 4RO0A 1SQXK 1YTZI 1PPJD 1EDKA 1NTZJ 1KILE 5AVSB 1PGPA 1YI2P 2O01H 1BE3D 4ZMDA 3TSIA 4BWNA 5KKZB 5B66H 2WSEJ 4I7ZC 3P4QD 2CPSA 2JO1A 3B5ND 2N9BA 3SSUA 1KB9D 3VMAA 1FDIA 1RE4A 2WPVB 2KS1A 3OA7A 2KSJA 3L75J 1NU1J 3AE6C 5KLVJ 1N86A 3AEEC 5AVXB 1BCCD 4DOJA 1FOSE 1KQFB 1L0ND 1OVVA 1S9KE 3CWBD 1ZR4A 3S4RA 1BGYG 1OIPA 4H44B 1T3JA 4PD4H 1KILC 4L76A 3CC7P 2IFMA 2J5UA 3CX5D 3HE4B 1S4XA 1LT9B 3TNUB 2LR2A 3MP7B 2E5TA 1ZLLA 3V2NA 1LTBC 5KJ7D 4YTND 1XTCC 2OYOA 1RY3A 1KZUB 2YMKA 3M0DA 1JMBA 2FYUD 1FOSF 1LWUB 3CL3D 4I1LA 4D6TJ 2E75C 5TJHA 2W6BA 1VQ5P 2WT7B 1LTGC 2XV5A 3AEAD 2WZ7A 3AEDD 3B5NA 2NRGA 3L71E 3B8EB 4DHJA 3F5HA 2P7JA 3H1IJ 3LIDA 5AW2B 3P8CE 3TDKA 1PP9D 2WSCJ 1N7SC 1TU3F 2A06D 5CCGC 3VR9C 3L74E 1NTMK 1VL2A 1R8EA 2IDBA 1FDMA 3B71A 4RESB 5L8RJ 1VQ9P 1VQNP 1EC5A 2YIUC 3ZDMA 1OFCX 2KYVA 4YXDC 1SQVG 1UIIA 3TK1A 4JYBA 1NTKG 3H1KJ 5APTA 4BRYA 3V4WA 2PAJA 3GHGC 1LTJA 3AEED 2WVRA 4DJGA 1SQXE 1KMIZ 3L72E 2OYIC 3AE7C 2YMYA 1LTTC 2HR3A 3H1HE 3HD7D 3M0AA 1JCDA 2WWWA 5GTIE 3L36A 3D70A 3L75D 1NU1D 1URQC 3FX0A 1VQPP 1YITP 1NWQA 1SQQK 3F89A 3VMZA 2G8YA 1WT6A 4U3FG 4UB8H 2OYHC 4U7JA 3HE5A 3Q5PA 2ZXEB 2QIWA 5AVTB 5TISH 1VDFA 3ABVC 3H1JG 4TT3H 4XA4A 1LJ2A 1Y9BA 1K73Q 1S9KD 2N1TC 4JBZA 2QSIA 4H0LC 2WPRA 5AVRB 1KQGB 1GL2B 3T97A 4K3AA 4OWFA 2M3BA 1N7SD 3CLQA 5C2TC 2PP6A 3O6QA 3BVHA 2P10A 3QH9A 1NH4A 2Q3EA 2WPQA 1MFZA 1IFPA 3VR9D 3H1LJ 3VONA 5TISE 3WU2H 2ZAEB 1KILA 1SVFA 4KHXA 2BEQD 3H1ID 4PD4I 4YXDD 1VQ8P 4ZKUA 2UWJE 1EDIA 1FE6A 1HBWA 3HD7B 1W5CE 2AEJA 3R4YA 3AE5D 1EZVE 3VTPC 2IYOA 2HG5D 4WY4B 2QM8A 1X0TA 3HRNA 1FC2C 1M1JB 2WSSH 3P8CD 1JY2N 3TF5A 1IFNA 3E7KA 3L73G 1IFIA 2JR8A 1NTME 3N4XA 1ZV8A 2HODA 4C7NA 5AVUB 5KKZC 5APUA 2YXRB 4YXWH 1FZBA 1P84I 3L71G 2RN0A 1KB9H 2QJKB 3H1KD 3IFMA 3IAOA 1EXJA 3B4SA 1KYOE 4GT1A 2B87B 4IFFA 4I2LC 3U1AA 3NFQA 3BCCD 3VRBD 1N7SA 2QRXA 3CXHD 2KB7P 5CCGA 3C9IA 3M9QA 2W90A 1M90Q 5KAFE 1SS1A 1Q7YQ 1X22A 1NTZK 3ABVD 4JYCA 4H44C 3H6PA 1M56D 1NO4A 1PPJE 3CX5H 1SQXD 1L0LG 5C3JC 2N1TD 2OTLP 2IZ0A 2AXTH 1LT9C 3H1HD 1GK4A 2ZYGA 2KZIA 3H32B 2V7QJ 2JWDA 3I5CA 2BCCE 3L70G 5B5EE 4GOEA 1NU1K 1SQQE 3USSA 4R4LA 1HGZA 5KLVK 4IL6E 1ZOYD 3FWNA 2RMZA 5C2TD 3GHGA 3WMM0 4YSYC 3NXSA 1WMKA 1LWUC 3A0HH 2WSFJ 3TYYA 2OYIA 3P4RC 4NPFX 3CCEP 3PLNA 3CWBE 3G3ZA 4Y99B 2Q7CA 2SPZA 1FS0E 2MKVA 4M3LA 3GF3A 2M0BA 1URQA 4MN4C 1BGYJ 1PIXA 2OGUA 2JWAA 2ZJSE 1NYHA 2FXMA 4FJVA 4GIFA 1N7LA 2OYHA 3H1LD 2HYNA 2YXQB 1RHZB 4TLFA 3C8VA 1VPCA 4DZOA 3MZWB 3FXDA 1G2CA 1QX8A 2QE7H 3MTUE 3OAKA 2LKMA 3Q1MA 4HJGH 4ZKPA 1YQ3C 1IFJA 2WU5C 1GW4A 2M5AB 2H8PD 2IBZE 1K05A 5AW3B 2OARA 3R2PA 1IC2A 1KTMA 1EZVD 3VP8A 5DJUB 3UIAA 1IO4A 2A06E 3KQGA 4NPDA 5E79H 5APSA 1X79B 2WSEH 1JOCA 2IFNA 1SQBG 5M1BA 1Q82Q 1NTMD 3P32A 1OW8A 1BDDA 2KIKA 5C3JD 5BU5A 1FZAA 1XTGB 3L37A 3AEAC 2Q9IA 3RK2B 2H89C 2Q3IA 3EFFK 2XNXA 1H0TB 1SQVJ 1KYOD 1VF5B 3V6IA 3PP5A 4EOTA 4YSYD 4QMAA 1GTWA 1NTKJ 2A45H 1NTZE 1KQLA 1Y8AA 3CCRP 1DIPA 1N73B 2RKLA 1PL5A 1Z56A 3U1CA 2YKPA 1GL2C 2HLOA 1W2EA 3L4FA 2Z5HA 1YYCA 3L75E 1KB9I 1NU1E 1A02F 2W6JH 1FJKA 1FU1A 5AVQB 2BCCD 3MD0A 3EWKA 1KV4A 1SQQD 5CCHC 2GUSA 5AW5B 2QM7A 3RL0B 2ZT9B 1E79H 1PPJG 1NVOA 2QJPB 4U3FJ 1BE3G 4LGDE 3AEFC 1DH3A 2W6AA 3HE4A 1BGYD 3CCLP 1QEXA 3CX5I 1USEA 1CI6B 2ZFCA 3TNUA 3VP9A 3H1JJ 5APWA 2WDVC 4PV1B 2H88C 1YQ3D 2WU5D 3HD7C 3II6A 4L74A 4WY4C 4GDOA 2CPBA 3A7OA 1M1JC 1BCCG 1LWUA 2M3EA 2E74B 1G1IA 1L0NG 5KLIB 2ZYDA 3O8ZA 1AJYA 3CWBG 2WT7A 1USDA 2ZXXA 4OGQB 3E1RA 1JCCA 1FZFA 1M57D 3C1LA 3RK3B 1W2BO 2QJKC 1RH5B 1OWAA 4GOFA 3H1IE 1GMJA 2YKQA 1HWTC 2K9YA 2H89D 3HUSB 1JB0J 2O01J 1M1KQ 3P7KA 4WWIA 1T3UA 2IBZD 3M9BA 2FYUG 3QWOC 4R4MA 3TGUG 2JJLA 2WDQC 2AXCA 3L73J 2K1AA 1Q86Q 3SFED 1GL2D 3ITKA 5GTIH 4AYCA 1SQVD 3H1KE 2K9JB 1VQKP 1SQPK 2B76C 3PHLA 3LW5J 5K5GB 1PP9G 2Y0EA 2A06G 1DEEG 1IFDA 3I56P 1NTKD 2KUBA 5AW1B 1GU5A 3BCCE 4PJ0E 3CXHE 3PH0A 5KJ7A 1RF0C 3CCSP 5CCHD 3AE5C 4C7RA 4YPCA 1FDOA 1S5LH 4LLHA 5AVYB 3KPEA 4Y99C 1NTZD 2WPSA 1DEBA 1HH0A 3AEFD 3RGUA 3SWKA 2KZJA 2E76B 2WDVD 2IPPA 2H88D 1HJ0A 1S1CX 5H2FE 3AE2D 2J58A 2ACZC 3M91A 3MUDA 1L0LJ 1MKMA 4WY4D 4A7PA 2R3CA 1X9VA 3L70J 5KLVD 4U3FD 2IYPA 3VRBC 2QEXP 1KD1Q 1RE3C 2WITA 3Q5RA 3AE4D 1NKNA 4UB6E 1KFYC 1RQVA 3H1JD 3V2RA 5GTHE 3PRJA 1S5LE 4H13B 5KAIE 2PRRA 1QLED 1SLQA 2BASA 1HVVA 5CCHA 1VQ6P 2WDQD 1ZOYC 3H1LE 2A45G 1GU4A 1GD2E 1ZRTE 1S2EA 4D6TD 4GODA 3WUUA 1LTIC 2WMMA 3HD7A 3RK2C 5AW4B 2KNCB 4WY4A 3VMYA 1KYOH 2KI7B 2B76D 1VF5C 3G71P 2KLUA 1E5WA 3KXDA 3VN0A 1OVUA 2LXCB 5KAFH 2C0WA 4K35A 3GMAA 1N73C 3SWYA 2H7HA 3WUTA 3H1IG 3P4PC 1SQBJ 3AECC 3JCUE 2B89A 3OJAB 2MJZA 2IZ1A 5AW8B 5B5EH 3AE3C 2ACZD 1KFNA 2NPSD 1SQVK 4Z1MH 1QL1A 1RF1B 4IL6H 1U57A 2R3SA 2FFDB 1G1JA 4YSXD 1NTKK 3RL0C 2ZT9C 3NMDA 4HYTB 1JY3O 1SFCB 1SQPJ 1EXIA 3M06A 2LXBA 2YNYA 1DD4A 2QJPC 3RK3E 3L74G 1CSBA 4KT0J 1KFYD 1JUNA 2HODB 5CMZA 3H32A 4PV1C 3H1KG 1NKZB 2DW3A 1P84D 3EFGA 4LC1A 1DX7A 3A0BE 2Y9YA 3BCCG 5AW6B 5EFWB 2JDIH 1RF0A 2E74C 1MZ9A 3M9HA 4HKZH 4L75A 5KLIC 1KQSO 2M8RA 4DDIA 4W7ZA 1ZR2A 2Y9ZA 4OGQC 1UIXA 4DDGA 1JY3P 1SQXG 3RBZA 3L72G 1JO5A 1LP1B 3RK3C 3RL0g 5APVA 3H1HG 2BS2C 4EYYQ 3N7NA 1BGYE 1OW6A 3RBXA 4W80A 4RKUJ 1JTHB 3V5BA 3RK2D 1BE3J 4LDTA 3HUSC 1L2PA 1FJPA 3VOPA 1VF5D 2YO3A 3CMEP 2FYZA 1RE3A 4KX6D 2NPSB 2RH0A 2K3RA 1GDTA 1YQ4C 4JQ0D 1GK6A 1BCCJ 2G3AA 4NPEA 5AW9B 2K88A 4WVZA 1AVOA 1BSHA 1ZRTD 1L0NJ 2M5AA 3CWBJ 4N78D 3P4PD 3AECD 2ZYAA 2ZFYA 1VQMP 2GUVA 2N1TA 1FZCB 3AE3D 3WUVA 2ITAA 1EQ7A 1NHLA 1EZVI 3GF7A 1H8AA 1KFMA 3RL0D 4EDFA 2ZT9D 4DT0A 2AEMA 1NJIQ 2O01N 1EDJA 3VRAD 1SQBD 2FYUJ 1KN7A 3TGUJ 2Z4EA 2KOGA 1QGKB 2E76C 1G2CB 3JSVC 3AE8D 4PV1D 1H0TA 1SQVE 1T2KC 4C46A 1KYOI 1SQPD 1EZVG 2BEZF 2E74D 1NTKE 1AQ5A 1PZQA 4YSZD 1VQOP 1YBKA 3SWFA 3CPWO 1ZP0C 3P4SC 1PP9J 2ZVOB 2PGDA 5KTBA 4YT0C 4OGQD 1NTMG 2HPCB 4H13C 3RK3D 3HTKB 5AVZB 1M8OB 4YTMC 3K5BA 4RJTA 1AQTA 1L0LK 1ZW0A 3SFEC 4EI2A 5CJ4A 2V4HA 2W8ZA 3P8MC 4OH8B 2WP9C 5KLVE 4U3FE 1YJWP 1YQ4D 1L4AB 1CI6A 1CW5A 3H1JE 1R5SA 1VQ7P 1VQLP 1PGJA 3V2QA 1LT9A 2WSCH 2BCCG 4W7YA 2AEFA 3KZIE 2Q5UA 2WDRD 1SQQG 1E7PC 2Q1KA 2E5YA 3AE2C 2GM4A 4IOIH 2FBWC 5DJTB 4BXLA 1OMIA 2KS1B 1GW3A 3LW5H 2YO2A 3AE4C 4D6TE 2E76D 1U7MA 2C9LY 1OZHA 2FYNB 4JF7A 3FGAD 4DCKA 3CCVP 5BU8B 3HUSA 3SFDD 1JM0A 1RF1C 5AVWB 1T2KD 5B66E 1HTLC 3KHUA 2FFDC 3CCMP 2IBZI 5C39A 4PJ0H 3CXHH 3H25A 1SFCC 2WQYD 2K37A 2POHA 5AW0B 2QVAA 1LTAC 2R44A 1ZP0D 3TGUD 3P4SD 1HGVA 1S72P 2E43A 4YT0D 1H88A 2D2CB 1S5LX 1PFIA 3L73E 4H13D 1P84H 3G4SP 1T8ZA 1SQBK 2WS3C 5APQA 4YTMD 2K9JA 3MHVA 5H2FH 2XKMA 3BASA 3VR8D 4PD4E 3IR9A 2Z5IA 2Y0DA 5CJ0A 2IBZG 3AE1C 3CC4P 4ASWA 2E42A 3B5NB 1QVGO 3L71J 2KXPB 2WP9D 3AEGC 2B9BA 3G6EP 3G9RA 1J1EB 3MGNA 3IF4A 1L0VC 3BRVB 4UB6H 2HFED 5GTHH 4AUWA 2Q6QA 5KAIH 2W83C 2I1KA 1KF6C 4B86A 1L0LE 1P84E 3L74J 3D6YA 4AQRD 1S3JA 3L70E 3AE6D 2NPSC 1PGOA 3BCCJ 2FBWD 3CCUP 3VYIA 2L91A 1NTZG 4YSXC 2QJYB 4O9BA 4BRYB 3BATA
chains in the Genus database with same CATH topology
3O6QA 4H44B 2ZT9C 1ZMEC 2P10A 2NZ2A 5C3JC 1EXIA 1K05A 4YTPD 2ZT9B 3SFEC 1ZP0D 3P4SD 1DD4A 2J5UA 2QJPC 1NGMB 2OQQA 1KTMA 3VR9D 3Q5SA 3SFED 2D2CC 2JP3A 3RK3E 1NEKD 3AECD 3P4PD 4YT0D 2V7QJ 2D2CB 1S5LX 4KT0J 1KFYD 3AEFC 4H13D 3AEED 1QLBC 3AE3D 2B76C 4XFJA 2WDQD 3LW5J 2WP9C 4YTND 1ZOYC 3AEBC 4R4LA 2WS3C 3AEDC 4PV1C 1ZOYD 4YTMD 1KMIZ 2BEQD 4YXDD 2WDVC 4PV1B 1YQ4D 2H88C 1YQ3D 1ZRTE 2WU5D 5C2TD 3GF7A 3AE7C 4YSYC 1PV3A 3VR8C 2YMKA 1NENC 5M1BA 3AE5C 1WMKA 3AE7D 1DD3A 1RQUA 3VR8D 2ZT9D 2WSFJ 1OW8A 1IK7A 3R4YA 4GDOA 3AE5D 1FDOA 1HF9A 5C3JD 4YSXD 3VRAC 3P4QC 2D2CD 3IN6A 3VRAD 3AE1C 3D70A 2E74C 3P4RC 2E75C 3AEAC 3AEFD 3Q3DA 1K04A 2E74B 2WQYD 3CIRC 2H89C 5KLIC 2E75D 3AEAD 1KORA 2E75B 3AE8C 2B76D 2WP9D 3AEGC 1VF5C 2E76C 2WDRC 2WS3D 3AEBD 3AE8D 3AEDD 2FXPA 4PV1D 2MKVA 1AJYA 2G8YA 2BS4C 4OGQC 2WDRD 1VF5B 2E76B 2WDVD 1E7PC 1UIXA 1KILE 3AE2C 3G9RA 3GF3A 4U7JA 2H88D 4OGQB 1HJ0A 1L0VC 3Q5PA 4YSYD 1S1CX 2QIWA 4H44D 1NEND 3AE2D 2ACZC 1PIXA 5KKZC 3RL0g 3Q2YA 1MKMA 2FBWC 1NYHA 3S9OA 2BS2C 3GMAA 2QJKC 3ABVC 2WU2C 1OW6A 2WSEJ 1OMIA 2WSCJ 4I7ZC 1TU3F 4TT3H 3AE9C 4RKUJ 1KF6C 3P4QD 3IAOA 2BEZF 3AE1D 1DIPA 4I7ZB 1EXJA 1GMJA 4YSZC 2E74D 2JO1A 1PL5A 1OW7A 1Y9BA 4YSZD 4IL6X 3D6YA 3CIRD 2K9YA 2H89D 1FDIA 2WPVB 4YTPC 3VRBC 1ZP0C 3AE4C 1JB0J 2FYNC 2O01J 3P4SC 3AEGD 3Q5RA 1VF5D 2E76D 2QSIA 4H0LC 3T97B 3VRBD 3VR9C 3AE4D 1NEKC 3AECC 1VL2A 3AE6C 3P4PC 3FGAD 4YT0C 3C8VA 4OGQD 4H0LD 3D6ZA 4H0LB 1R8EA 1KQGB 3AE6D 2IDBA 3SFDC 3P4RD 3B71A 1RQVA 1KFYC 4H13C 1L0VD 3AEEC 4R4MA 4KX6C 3AE3C 3SFDD 2ACZD 2WDQC 4H13B 5L8RJ 4YTNC 4KX6D 2YIUC 2FBWD 4Z1MH 3Q1MA 2BS3C 4YTMC 2QJYC 2WU2D 1KQFB 4YXDC 3ABVD 3EWKA 1YQ4C 1YQ3C 1Q90D 1U57A 2WQYC 4H44C 3D71A 1KF6D 2WU5C 3AE9D 4YSXC 5C2TC 3H25A 4Y28J 3GLMA 2G3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C3J C;  4YTP D;  1K05 A;  3SFE C;  1ZP0 D;  3P4S D;  1KTM A;  3VR9 D;  3SFE D;  3P4P D;  1NEK D;  3AEC D;  4YT0 D;  1KFY D;  3AEF C;  3AEE D;  1QLB C;  3AE3 D;  2B76 C;  2WDQ D;  2WP9 C;  4YTN D;  1ZOY C;  3AEB C;  2WS3 C;  3AED C;  1ZOY D;  4YTM D;  4YXD D;  2WDV C;  1YQ4 D;  1YQ3 D;  2H88 C;  2WU5 D;  5C2T D;  3AE7 C;  4YSY C;  1PV3 A;  3VR8 C;  1NEN C;  3AE5 C;  3AE7 D;  3VR8 D;  1OW8 A;  3AE5 D;  5C3J D;  3VRA C;  3P4Q C;  3VRA D;  3AE1 C;  3P4R C;  3AEA C;  3AEF D;  1K04 A;  3CIR C;  3P4R D;  2H89 C;  3AEA D;  3AE8 C;  2B76 D;  2WP9 D;  3AEG C;  3AEB D;  2WDR C;  2WS3 D;  3AE8 D;  3AED D;  2BS4 C;  2WDR D;  2WDV D;  1E7P C;  3AE2 C;  2H88 D;  1L0V C;  4YSY D;  3AE2 D;  1NEN D;  2ACZ C;  2FBW C;  3S9O A;  2BS2 C;  2WU2 C;  3ABV C;  1OW6 A;  3AE9 C;  1KF6 C;  3P4Q D;  3AE1 D;  4YSZ C;  1OW7 A;  4YSZ D;  3CIR D;  2H89 D;  4YTP C;  3VRB C;  1ZP0 C;  3AE4 C;  3P4S C;  3AEG D;  3VR9 C;  3VRB D;  3AE4 D;  1NEK C;  3AEC C;  3P4P C;  3AE6 C;  4YT0 C;  3AE6 D;  3SFD C;  3B71 A;  1KFY C;  1L0V D;  3AEE C;  4KX6 C;  3AE3 C;  3SFD D;  2ACZ D;  2WDQ C;  2G3A A;  4YTN C;  4KX6 D;  2FBW D;  2BS3 C;  4YTM C;  2WU2 D;  3ABV D;  4YXD C;  1YQ4 C;  1YQ3 C;  2WU5 C;  4YSX C;  2WQY C;  1KF6 D;  3AE9 D;  5C2T C;  4YSX D;  2WQY D; 
#chains in the Genus database with same CATH topology
 1IZN B;  1J1D B;  3CCQ P;  1LTJ B;  1KIL D;  2OQQ A;  2A45 I;  2JP3 A;  1OXZ A;  1OVR A;  1FZC C;  1SQX J;  2VRS A;  3L72 J;  1YHQ P;  2XND H;  1GL2 A;  3H1H J;  3L75 G;  1NU1 G;  3V2P A;  2W27 A;  5KLV G;  4HH2 A;  4CPG A;  1SFC D;  2O3J A;  1RQU A;  2FKW B;  1IK7 A;  2CK3 H;  1OX3 A;  1FZE A;  2XDJ A;  4JPZ B;  3Q3D A;  1K04 A;  1L0N K;  3CIR C;  2E75 D;  1KOR A;  3HE5 B;  2WS3 D;  4I6M C;  2KNC A;  3JCU H;  4N78 E;  1IJD B;  1YJ9 P;  2N9Y B;  3S9O A;  1N8R Q;  2R5B A;  1AA0 A;  3AE9 C;  3AE1 D;  3MIW A;  4I7Z B;  3KYQ A;  5CCG D;  1JY2 O;  1OW7 A;  4IL6 X;  1Y47 A;  4IFD K;  1FBM A;  3AEG D;  1IFM A;  1M1J A;  3T97 B;  4GKG A;  1NEK C;  2I8D A;  3KDP B;  4UB8 E;  2FYU K;  5BVZ A;  2Y0C A;  3I55 P;  4D6T G;  1L0V D;  4KX6 C;  2R32 A;  3U59 A;  1SQB E;  3VMX A;  2P58 A;  3O6Q B;  3CMA P;  1VQ4 P;  2BS3 C;  3L73 D;  2V7Q H;  1Q90 D;  3D71 A;  1KF6 D;  3A0B H;  2O1K A;  1RF1 A;  4IFM A;  1AV1 A;  2FFD A;  1KIL B;  3L71 D;  2B87 A;  1HJB A;  4PD4 D;  2R5D A;  2XU6 A;  1SFC A;  1HUC A;  1SQP E;  2WSF H;  1BSN A;  1NAF A;  4OVN F;  1YJN P;  3CXH I;  3AEB C;  1LTS C;  2O1J A;  1QVF O;  1Q81 Q;  1L4A C;  1K9M Q;  1JY2 P;  1JMM A;  1PV3 A;  1NEN C;  3AE7 D;  3L74 D;  4KJM A;  2P2U A;  2KSE A;  3VRA C;  3A3Y B;  3IN6 A;  3WU2 E;  1K8A Q;  1NTM J;  1URQ D;  4C7N B;  2E75 B;  3AE8 C;  1L0L D;  2BS4 C;  2KLV A;  3E1I A;  3PTZ A;  1WRG A;  5CBO A;  3L70 D;  4HB1 A;  1RE4 C;  5APX A;  3V4Q A;  2H43 A;  2WU2 C;  4N6J A;  1FZG A;  1LP1 A;  4I6L A;  1N7S B;  4YSZ C;  3OW2 O;  1R5L A;  3CIR D;  1JY3 N;  4YTP C;  2FYN C;  3L72 D;  1JTH A;  3PJS K;  1BE3 E;  3D6Z A;  4H0L D;  1M7L A;  4N3Y B;  2I1J A;  2P1J A;  3A5T A;  3W67 A;  2YIU B;  2FY8 A;  1KB9 E;  3AE9 D;  4Y28 J;  2NPS A;  3GLM A;  3CD6 P;  2NZ2 A;  1LGH B;  2B88 A;  2BCC J;  1BCC E;  1MFT A;  2D2C C;  1NEK D;  1SQQ J;  2ZVN B;  5AW7 B;  1L0N E;  3M0D C;  1JNM A;  1QLB C;  3GHG B;  1KC8 Q;  4WB4 A;  3BRT B;  1FZC A;  2IX7 C;  2C0X A;  1YTZ T;  1YIJ P;  2OYI B;  2JEE A;  3CX5 E;  3CCJ P;  1J2J B;  3FWL A;  1MUU A;  1HF9 A;  4WBA A;  2OTJ P;  1MV8 A;  2AXT E;  4ZNC A;  1QL2 A;  1X8Y A;  3P4Q C;  1GZL A;  1TFF A;  5AVV B;  3B5N C;  3LIE A;  2J59 M;  2OTK E;  3CC2 P;  1URQ B;  5CHX A;  4ASV A;  3AEB D;  2WDR C;  1J1E C;  2FXO A;  2FYU E;  3H1L G;  3TGU E;  1L4A D;  1Q2N A;  2WTY A;  1NEN D;  3A0H E;  2OYH B;  1H89 A;  3Q2Y A;  1BDC A;  2GA1 A;  1ZN5 A;  3W68 A;  2JKV A;  5APY A;  1NAY A;  2PFX A;  2YKO A;  4DHI B;  2N1T B;  5CBN A;  1SP4 A;  1CZQ A;  1FAV A;  3JC2 2;  3CI9 A;  4H0L B;  2XZR A;  3SFD C;  3A2A A;  1PP9 E;  2KP8 A;  5KJ7 C;  4YTN C;  3FXE A;  3GW6 A;  4XE5 B;  1AVY A;  2QJY C;  2WU2 D;  2HPC A;  2KK7 A;  2QG4 A;  2WQY C;  2QA4 P;  2P67 A;  4L73 A;  4DHZ A;  1LNQ A;  3HTK A;  4H44 D;  3S1K A;  1J1D C;  1LTJ C;  1ZME C;  1JEK A;  2L5G B;  3GG2 A;  4YTP D;  1D7M A;  1NOH A;  1N73 A;  1ZXG A;  1NGM B;  3Q5S A;  1T6A A;  2C9N Y;  4XFJ A;  1U7J A;  1SQP G;  3MUD C;  3AED C;  1AFO A;  1PGQ A;  3KZI H;  1LT1 A;  3EQ2 A;  3VR8 C;  1DD3 A;  4EIJ A;  1IK9 A;  1L4A A;  2D2C D;  1A02 J;  1N2D C;  3P4R D;  5E79 E;  3NTN A;  3L35 A;  2FXP A;  1EDL A;  4RO0 A;  1SQX K;  1YTZ I;  1PPJ D;  1EDK A;  1NTZ J;  1KIL E;  5AVS B;  1PGP A;  1YI2 P;  2O01 H;  1BE3 D;  4ZMD A;  3TSI A;  4BWN A;  5KKZ B;  5B66 H;  2WSE J;  4I7Z C;  3P4Q D;  2CPS A;  2JO1 A;  3B5N D;  2N9B A;  3SSU A;  1KB9 D;  3VMA A;  1FDI A;  1RE4 A;  2WPV B;  2KS1 A;  3OA7 A;  2KSJ A;  3L75 J;  1NU1 J;  3AE6 C;  5KLV J;  1N86 A;  3AEE C;  5AVX B;  1BCC D;  4DOJ A;  1FOS E;  1KQF B;  1L0N D;  1OVV A;  1S9K E;  3CWB D;  1ZR4 A;  3S4R A;  1BGY G;  1OIP A;  4H44 B;  1T3J A;  4PD4 H;  1KIL C;  4L76 A;  3CC7 P;  2IFM A;  2J5U A;  3CX5 D;  3HE4 B;  1S4X A;  1LT9 B;  3TNU B;  2LR2 A;  3MP7 B;  2E5T A;  1ZLL A;  3V2N A;  1LTB C;  5KJ7 D;  4YTN D;  1XTC C;  2OYO A;  1RY3 A;  1KZU B;  2YMK A;  3M0D A;  1JMB A;  2FYU D;  1FOS F;  1LWU B;  3CL3 D;  4I1L A;  4D6T J;  2E75 C;  5TJH A;  2W6B A;  1VQ5 P;  2WT7 B;  1LTG C;  2XV5 A;  3AEA D;  2WZ7 A;  3AED D;  3B5N A;  2NRG A;  3L71 E;  3B8E B;  4DHJ A;  3F5H A;  2P7J A;  3H1I J;  3LID A;  5AW2 B;  3P8C E;  3TDK A;  1PP9 D;  2WSC J;  1N7S C;  1TU3 F;  2A06 D;  5CCG C;  3VR9 C;  3L74 E;  1NTM K;  1VL2 A;  1R8E A;  2IDB A;  1FDM A;  3B71 A;  4RES B;  5L8R J;  1VQ9 P;  1VQN P;  1EC5 A;  2YIU C;  3ZDM A;  1OFC X;  2KYV A;  4YXD C;  1SQV G;  1UII A;  3TK1 A;  4JYB A;  1NTK G;  3H1K J;  5APT A;  4BRY A;  3V4W A;  2PAJ A;  3GHG C;  1LTJ A;  3AEE D;  2WVR A;  4DJG A;  1SQX E;  1KMI Z;  3L72 E;  2OYI C;  3AE7 C;  2YMY A;  1LTT C;  2HR3 A;  3H1H E;  3HD7 D;  3M0A A;  1JCD A;  2WWW A;  5GTI E;  3L36 A;  3D70 A;  3L75 D;  1NU1 D;  1URQ C;  3FX0 A;  1VQP P;  1YIT P;  1NWQ A;  1SQQ K;  3F89 A;  3VMZ A;  2G8Y A;  1WT6 A;  4U3F G;  4UB8 H;  2OYH C;  4U7J A;  3HE5 A;  3Q5P A;  2ZXE B;  2QIW A;  5AVT B;  5TIS H;  1VDF A;  3ABV C;  3H1J G;  4TT3 H;  4XA4 A;  1LJ2 A;  1Y9B A;  1K73 Q;  1S9K D;  2N1T C;  4JBZ A;  2QSI A;  4H0L C;  2WPR A;  5AVR B;  1KQG B;  1GL2 B;  3T97 A;  4K3A A;  4OWF A;  2M3B A;  1N7S D;  3CLQ A;  5C2T C;  2PP6 A;  3O6Q A;  3BVH A;  2P10 A;  3QH9 A;  1NH4 A;  2Q3E A;  2WPQ A;  1MFZ A;  1IFP A;  3VR9 D;  3H1L J;  3VON A;  5TIS E;  3WU2 H;  2ZAE B;  1KIL A;  1SVF A;  4KHX A;  2BEQ D;  3H1I D;  4PD4 I;  4YXD D;  1VQ8 P;  4ZKU A;  2UWJ E;  1EDI A;  1FE6 A;  1HBW A;  3HD7 B;  1W5C E;  2AEJ A;  3R4Y A;  3AE5 D;  1EZV E;  3VTP C;  2IYO A;  2HG5 D;  4WY4 B;  2QM8 A;  1X0T A;  3HRN A;  1FC2 C;  1M1J B;  2WSS H;  3P8C D;  1JY2 N;  3TF5 A;  1IFN A;  3E7K A;  3L73 G;  1IFI A;  2JR8 A;  1NTM E;  3N4X A;  1ZV8 A;  2HOD A;  4C7N A;  5AVU B;  5KKZ C;  5APU A;  2YXR B;  4YXW H;  1FZB A;  1P84 I;  3L71 G;  2RN0 A;  1KB9 H;  2QJK B;  3H1K D;  3IFM A;  3IAO A;  1EXJ A;  3B4S A;  1KYO E;  4GT1 A;  2B87 B;  4IFF A;  4I2L C;  3U1A A;  3NFQ A;  3BCC D;  3VRB D;  1N7S A;  2QRX A;  3CXH D;  2KB7 P;  5CCG A;  3C9I A;  3M9Q A;  2W90 A;  1M90 Q;  5KAF E;  1SS1 A;  1Q7Y Q;  1X22 A;  1NTZ K;  3ABV D;  4JYC A;  4H44 C;  3H6P A;  1M56 D;  1NO4 A;  1PPJ E;  3CX5 H;  1SQX D;  1L0L G;  5C3J C;  2N1T D;  2OTL P;  2IZ0 A;  2AXT H;  1LT9 C;  3H1H D;  1GK4 A;  2ZYG A;  2KZI A;  3H32 B;  2V7Q J;  2JWD A;  3I5C A;  2BCC E;  3L70 G;  5B5E E;  4GOE A;  1NU1 K;  1SQQ E;  3USS A;  4R4L A;  1HGZ A;  5KLV K;  4IL6 E;  1ZOY D;  3FWN A;  2RMZ A;  5C2T D;  3GHG A;  3WMM 0;  4YSY C;  3NXS A;  1WMK A;  1LWU C;  3A0H H;  2WSF J;  3TYY A;  2OYI A;  3P4R C;  4NPF X;  3CCE P;  3PLN A;  3CWB E;  3G3Z A;  4Y99 B;  2Q7C A;  2SPZ A;  1FS0 E;  2MKV A;  4M3L A;  3GF3 A;  2M0B A;  1URQ A;  4MN4 C;  1BGY J;  1PIX A;  2OGU A;  2JWA A;  2ZJS E;  1NYH A;  2FXM A;  4FJV A;  4GIF A;  1N7L A;  2OYH A;  3H1L D;  2HYN A;  2YXQ B;  1RHZ B;  4TLF A;  3C8V A;  1VPC A;  4DZO A;  3MZW B;  3FXD A;  1G2C A;  1QX8 A;  2QE7 H;  3MTU E;  3OAK A;  2LKM A;  3Q1M A;  4HJG H;  4ZKP A;  1YQ3 C;  1IFJ A;  2WU5 C;  1GW4 A;  2M5A B;  2H8P D;  2IBZ E;  1K05 A;  5AW3 B;  2OAR A;  3R2P A;  1IC2 A;  1KTM A;  1EZV D;  3VP8 A;  5DJU B;  3UIA A;  1IO4 A;  2A06 E;  3KQG A;  4NPD A;  5E79 H;  5APS A;  1X79 B;  2WSE H;  1JOC A;  2IFN A;  1SQB G;  5M1B A;  1Q82 Q;  1NTM D;  3P32 A;  1OW8 A;  1BDD A;  2KIK A;  5C3J D;  5BU5 A;  1FZA A;  1XTG B;  3L37 A;  3AEA C;  2Q9I A;  3RK2 B;  2H89 C;  2Q3I A;  3EFF K;  2XNX A;  1H0T B;  1SQV J;  1KYO D;  1VF5 B;  3V6I A;  3PP5 A;  4EOT A;  4YSY D;  4QMA A;  1GTW A;  1NTK J;  2A45 H;  1NTZ E;  1KQL A;  1Y8A A;  3CCR P;  1DIP A;  1N73 B;  2RKL A;  1PL5 A;  1Z56 A;  3U1C A;  2YKP A;  1GL2 C;  2HLO A;  1W2E A;  3L4F A;  2Z5H A;  1YYC A;  3L75 E;  1KB9 I;  1NU1 E;  1A02 F;  2W6J H;  1FJK A;  1FU1 A;  5AVQ B;  2BCC D;  3MD0 A;  3EWK A;  1KV4 A;  1SQQ D;  5CCH C;  2GUS A;  5AW5 B;  2QM7 A;  3RL0 B;  2ZT9 B;  1E79 H;  1PPJ G;  1NVO A;  2QJP B;  4U3F J;  1BE3 G;  4LGD E;  3AEF C;  1DH3 A;  2W6A A;  3HE4 A;  1BGY D;  3CCL P;  1QEX A;  3CX5 I;  1USE A;  1CI6 B;  2ZFC A;  3TNU A;  3VP9 A;  3H1J J;  5APW A;  2WDV C;  4PV1 B;  2H88 C;  1YQ3 D;  2WU5 D;  3HD7 C;  3II6 A;  4L74 A;  4WY4 C;  4GDO A;  2CPB A;  3A7O A;  1M1J C;  1BCC G;  1LWU A;  2M3E A;  2E74 B;  1G1I A;  1L0N G;  5KLI B;  2ZYD A;  3O8Z A;  1AJY A;  3CWB G;  2WT7 A;  1USD A;  2ZXX A;  4OGQ B;  3E1R A;  1JCC A;  1FZF A;  1M57 D;  3C1L A;  3RK3 B;  1W2B O;  2QJK C;  1RH5 B;  1OWA A;  4GOF A;  3H1I E;  1GMJ A;  2YKQ A;  1HWT C;  2K9Y A;  2H89 D;  3HUS B;  1JB0 J;  2O01 J;  1M1K Q;  3P7K A;  4WWI A;  1T3U A;  2IBZ D;  3M9B A;  2FYU G;  3QWO C;  4R4M A;  3TGU G;  2JJL A;  2WDQ C;  2AXC A;  3L73 J;  2K1A A;  1Q86 Q;  3SFE D;  1GL2 D;  3ITK A;  5GTI H;  4AYC A;  1SQV D;  3H1K E;  2K9J B;  1VQK P;  1SQP K;  2B76 C;  3PHL A;  3LW5 J;  5K5G B;  1PP9 G;  2Y0E A;  2A06 G;  1DEE G;  1IFD A;  3I56 P;  1NTK D;  2KUB A;  5AW1 B;  1GU5 A;  3BCC E;  4PJ0 E;  3CXH E;  3PH0 A;  5KJ7 A;  1RF0 C;  3CCS P;  5CCH D;  3AE5 C;  4C7R A;  4YPC A;  1FDO A;  1S5L H;  4LLH A;  5AVY B;  3KPE A;  4Y99 C;  1NTZ D;  2WPS A;  1DEB A;  1HH0 A;  3AEF D;  3RGU A;  3SWK A;  2KZJ A;  2E76 B;  2WDV D;  2IPP A;  2H88 D;  1HJ0 A;  1S1C X;  5H2F E;  3AE2 D;  2J58 A;  2ACZ C;  3M91 A;  3MUD A;  1L0L J;  1MKM A;  4WY4 D;  4A7P A;  2R3C A;  1X9V A;  3L70 J;  5KLV D;  4U3F D;  2IYP A;  3VRB C;  2QEX P;  1KD1 Q;  1RE3 C;  2WIT A;  3Q5R A;  3AE4 D;  1NKN A;  4UB6 E;  1KFY C;  1RQV A;  3H1J D;  3V2R A;  5GTH E;  3PRJ A;  1S5L E;  4H13 B;  5KAI E;  2PRR A;  1QLE D;  1SLQ A;  2BAS A;  1HVV A;  5CCH A;  1VQ6 P;  2WDQ D;  1ZOY C;  3H1L E;  2A45 G;  1GU4 A;  1GD2 E;  1ZRT E;  1S2E A;  4D6T D;  4GOD A;  3WUU A;  1LTI C;  2WMM A;  3HD7 A;  3RK2 C;  5AW4 B;  2KNC B;  4WY4 A;  3VMY A;  1KYO H;  2KI7 B;  2B76 D;  1VF5 C;  3G71 P;  2KLU A;  1E5W A;  3KXD A;  3VN0 A;  1OVU A;  2LXC B;  5KAF H;  2C0W A;  4K35 A;  3GMA A;  1N73 C;  3SWY A;  2H7H A;  3WUT A;  3H1I G;  3P4P C;  1SQB J;  3AEC C;  3JCU E;  2B89 A;  3OJA B;  2MJZ A;  2IZ1 A;  5AW8 B;  5B5E H;  3AE3 C;  2ACZ D;  1KFN A;  2NPS D;  1SQV K;  4Z1M H;  1QL1 A;  1RF1 B;  4IL6 H;  1U57 A;  2R3S A;  2FFD B;  1G1J A;  4YSX D;  1NTK K;  3RL0 C;  2ZT9 C;  3NMD A;  4HYT B;  1JY3 O;  1SFC B;  1SQP J;  1EXI A;  3M06 A;  2LXB A;  2YNY A;  1DD4 A;  2QJP C;  3RK3 E;  3L74 G;  1CSB A;  4KT0 J;  1KFY D;  1JUN A;  2HOD B;  5CMZ A;  3H32 A;  4PV1 C;  3H1K G;  1NKZ B;  2DW3 A;  1P84 D;  3EFG A;  4LC1 A;  1DX7 A;  3A0B E;  2Y9Y A;  3BCC G;  5AW6 B;  5EFW B;  2JDI H;  1RF0 A;  2E74 C;  1MZ9 A;  3M9H A;  4HKZ H;  4L75 A;  5KLI C;  1KQS O;  2M8R A;  4DDI A;  4W7Z A;  1ZR2 A;  2Y9Z A;  4OGQ C;  1UIX A;  4DDG A;  1JY3 P;  1SQX G;  3RBZ A;  3L72 G;  1JO5 A;  1LP1 B;  3RK3 C;  3RL0 g;  5APV A;  3H1H G;  2BS2 C;  4EYY Q;  3N7N A;  1BGY E;  1OW6 A;  3RBX A;  4W80 A;  4RKU J;  1JTH B;  3V5B A;  3RK2 D;  1BE3 J;  4LDT A;  3HUS C;  1L2P A;  1FJP A;  3VOP A;  1VF5 D;  2YO3 A;  3CME P;  2FYZ A;  1RE3 A;  4KX6 D;  2NPS B;  2RH0 A;  2K3R A;  1GDT A;  1YQ4 C;  4JQ0 D;  1GK6 A;  1BCC J;  2G3A A;  4NPE A;  5AW9 B;  2K88 A;  4WVZ A;  1AVO A;  1BSH A;  1ZRT D;  1L0N J;  2M5A A;  3CWB J;  4N78 D;  3P4P D;  3AEC D;  2ZYA A;  2ZFY A;  1VQM P;  2GUV A;  2N1T A;  1FZC B;  3AE3 D;  3WUV A;  2ITA A;  1EQ7 A;  1NHL A;  1EZV I;  3GF7 A;  1H8A A;  1KFM A;  3RL0 D;  4EDF A;  2ZT9 D;  4DT0 A;  2AEM A;  1NJI Q;  2O01 N;  1EDJ A;  3VRA D;  1SQB D;  2FYU J;  1KN7 A;  3TGU J;  2Z4E A;  2KOG A;  1QGK B;  2E76 C;  1G2C B;  3JSV C;  3AE8 D;  4PV1 D;  1H0T A;  1SQV E;  1T2K C;  4C46 A;  1KYO I;  1SQP D;  1EZV G;  2BEZ F;  2E74 D;  1NTK E;  1AQ5 A;  1PZQ A;  4YSZ D;  1VQO P;  1YBK A;  3SWF A;  3CPW O;  1ZP0 C;  3P4S C;  1PP9 J;  2ZVO B;  2PGD A;  5KTB A;  4YT0 C;  4OGQ D;  1NTM G;  2HPC B;  4H13 C;  3RK3 D;  3HTK B;  5AVZ B;  1M8O B;  4YTM C;  3K5B A;  4RJT A;  1AQT A;  1L0L K;  1ZW0 A;  3SFE C;  4EI2 A;  5CJ4 A;  2V4H A;  2W8Z A;  3P8M C;  4OH8 B;  2WP9 C;  5KLV E;  4U3F E;  1YJW P;  1YQ4 D;  1L4A B;  1CI6 A;  1CW5 A;  3H1J E;  1R5S A;  1VQ7 P;  1VQL P;  1PGJ A;  3V2Q A;  1LT9 A;  2WSC H;  2BCC G;  4W7Y A;  2AEF A;  3KZI E;  2Q5U A;  2WDR D;  1SQQ G;  1E7P C;  2Q1K A;  2E5Y A;  3AE2 C;  2GM4 A;  4IOI H;  2FBW C;  5DJT B;  4BXL A;  1OMI A;  2KS1 B;  1GW3 A;  3LW5 H;  2YO2 A;  3AE4 C;  4D6T E;  2E76 D;  1U7M A;  2C9L Y;  1OZH A;  2FYN B;  4JF7 A;  3FGA D;  4DCK A;  3CCV P;  5BU8 B;  3HUS A;  3SFD D;  1JM0 A;  1RF1 C;  5AVW B;  1T2K D;  5B66 E;  1HTL C;  3KHU A;  2FFD C;  3CCM P;  2IBZ I;  5C39 A;  4PJ0 H;  3CXH H;  3H25 A;  1SFC C;  2WQY D;  2K37 A;  2POH A;  5AW0 B;  2QVA A;  1LTA C;  2R44 A;  1ZP0 D;  3TGU D;  3P4S D;  1HGV A;  1S72 P;  2E43 A;  4YT0 D;  1H88 A;  2D2C B;  1S5L X;  1PFI A;  3L73 E;  4H13 D;  1P84 H;  3G4S P;  1T8Z A;  1SQB K;  2WS3 C;  5APQ A;  4YTM D;  2K9J A;  3MHV A;  5H2F H;  2XKM A;  3BAS A;  3VR8 D;  4PD4 E;  3IR9 A;  2Z5I A;  2Y0D A;  5CJ0 A;  2IBZ G;  3AE1 C;  3CC4 P;  4ASW A;  2E42 A;  3B5N B;  1QVG O;  3L71 J;  2KXP B;  2WP9 D;  3AEG C;  2B9B A;  3G6E P;  3G9R A;  1J1E B;  3MGN A;  3IF4 A;  1L0V C;  3BRV B;  4UB6 H;  2HFE D;  5GTH H;  4AUW A;  2Q6Q A;  5KAI H;  2W83 C;  2I1K A;  1KF6 C;  4B86 A;  1L0L E;  1P84 E;  3L74 J;  3D6Y A;  4AQR D;  1S3J A;  3L70 E;  3AE6 D;  2NPS C;  1PGO A;  3BCC J;  2FBW D;  3CCU P;  3VYI A;  2L91 A;  1NTZ G;  4YSX C;  2QJY B;  4O9B A;  4BRY B;  3BAT A; 
#chains in the Genus database with same CATH homology
 3O6Q A;  4H44 B;  2ZT9 C;  1ZME C;  2P10 A;  2NZ2 A;  5C3J C;  1EXI A;  1K05 A;  4YTP D;  2ZT9 B;  3SFE C;  1ZP0 D;  3P4S D;  1DD4 A;  2J5U A;  2QJP C;  1NGM B;  2OQQ A;  1KTM A;  3VR9 D;  3Q5S A;  3SFE D;  2D2C C;  2JP3 A;  3RK3 E;  1NEK D;  3AEC D;  3P4P D;  4YT0 D;  2V7Q J;  2D2C B;  1S5L X;  4KT0 J;  1KFY D;  3AEF C;  4H13 D;  3AEE D;  1QLB C;  3AE3 D;  2B76 C;  4XFJ A;  2WDQ D;  3LW5 J;  2WP9 C;  4YTN D;  1ZOY C;  3AEB C;  4R4L A;  2WS3 C;  3AED C;  4PV1 C;  1ZOY D;  4YTM D;  1KMI Z;  2BEQ D;  4YXD D;  2WDV C;  4PV1 B;  1YQ4 D;  2H88 C;  1YQ3 D;  1ZRT E;  2WU5 D;  5C2T D;  3GF7 A;  3AE7 C;  4YSY C;  1PV3 A;  3VR8 C;  2YMK A;  1NEN C;  5M1B A;  3AE5 C;  1WMK A;  3AE7 D;  1DD3 A;  1RQU A;  3VR8 D;  2ZT9 D;  2WSF J;  1OW8 A;  1IK7 A;  3R4Y A;  4GDO A;  3AE5 D;  1FDO A;  1HF9 A;  5C3J D;  4YSX D;  3VRA C;  3P4Q C;  2D2C D;  3IN6 A;  3VRA D;  3AE1 C;  3D70 A;  2E74 C;  3P4R C;  2E75 C;  3AEA C;  3AEF D;  3Q3D A;  1K04 A;  2E74 B;  2WQY D;  3CIR C;  2H89 C;  5KLI C;  2E75 D;  3AEA D;  1KOR A;  2E75 B;  3AE8 C;  2B76 D;  2WP9 D;  3AEG C;  1VF5 C;  2E76 C;  2WDR C;  2WS3 D;  3AEB D;  3AE8 D;  3AED D;  2FXP A;  4PV1 D;  2MKV A;  1AJY A;  2G8Y A;  2BS4 C;  4OGQ C;  2WDR D;  1VF5 B;  2E76 B;  2WDV D;  1E7P C;  1UIX A;  1KIL E;  3AE2 C;  3G9R A;  3GF3 A;  4U7J A;  2H88 D;  4OGQ B;  1HJ0 A;  1L0V C;  3Q5P A;  4YSY D;  1S1C X;  2QIW A;  4H44 D;  1NEN D;  3AE2 D;  2ACZ C;  1PIX A;  5KKZ C;  3RL0 g;  3Q2Y A;  1MKM A;  2FBW C;  1NYH A;  3S9O A;  2BS2 C;  3GMA A;  2QJK C;  3ABV C;  2WU2 C;  1OW6 A;  2WSE J;  1OMI A;  2WSC J;  4I7Z C;  1TU3 F;  4TT3 H;  3AE9 C;  4RKU J;  1KF6 C;  3P4Q D;  3IAO A;  2BEZ F;  3AE1 D;  1DIP A;  4I7Z B;  1EXJ A;  1GMJ A;  4YSZ C;  2E74 D;  2JO1 A;  1PL5 A;  1OW7 A;  1Y9B A;  4YSZ D;  4IL6 X;  3D6Y A;  3CIR D;  2K9Y A;  2H89 D;  1FDI A;  2WPV B;  4YTP C;  3VRB C;  1ZP0 C;  3AE4 C;  1JB0 J;  2FYN C;  2O01 J;  3P4S C;  3AEG D;  3Q5R A;  1VF5 D;  2E76 D;  2QSI A;  4H0L C;  3T97 B;  3VRB D;  3VR9 C;  3AE4 D;  1NEK C;  3AEC C;  1VL2 A;  3AE6 C;  3P4P C;  3FGA D;  4YT0 C;  3C8V A;  4OGQ D;  4H0L D;  3D6Z A;  4H0L B;  1R8E A;  1KQG B;  3AE6 D;  2IDB A;  3SFD C;  3P4R D;  3B71 A;  1RQV A;  1KFY C;  4H13 C;  1L0V D;  3AEE C;  4R4M A;  4KX6 C;  3AE3 C;  3SFD D;  2ACZ D;  2WDQ C;  4H13 B;  5L8R J;  4YTN C;  4KX6 D;  2YIU C;  2FBW D;  4Z1M H;  3Q1M A;  2BS3 C;  4YTM C;  2QJY C;  2WU2 D;  1KQF B;  4YXD C;  3ABV D;  3EWK A;  1YQ4 C;  1YQ3 C;  1Q90 D;  1U57 A;  2WQY C;  4H44 C;  3D71 A;  1KF6 D;  2WU5 C;  3AE9 D;  4YSX C;  5C2T C;  3H25 A;  4Y28 J;  3GLM A;  2G3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...