3AE2C

Crystal structure of porcine heart mitochondrial complex ii bound with 2-hydroxy-n-phenyl-benzamide
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of porcine heart mitochondrial complex II bound with 2-Hydroxy-N-phenyl-benzamide
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
total genus 47
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3ae2C01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3ae2C02
2FBWC 1NEKD 2WU2D 3ABVC 3AE4D 4YTND 4YSYD 1OW8A 1YQ4C 4YSZC 1QLBC 3AE9D 4YXDD 1ZP0C 1OW7A 2ACZC 2B76C 1ZOYC 3AEGD 4YSXC 3VRBD 3AEBC 5C2TD 2H88C 3AE6C 1KTMA 2WS3C 3SFEC 2WDVC 1YQ3C 3AEEC 2FBWD 2WU2C 1NEKC 3VRAC 2BS3C 3AEDC 4YXDC 3VR8D 1ZP0D 2ACZD 2BS2C 4KX6C 3VRBC 3AECD 2BS4C 3AE7C 2H88D 3AE6D 2WP9C 3AEFC 2WDRC 3SFED 2WU5D 3AEED 3AE5C 1KFYD 3S9OA 1OW6A 3VRAD 3AE8D 3P4SD 1E7PC 5C3JC 3AEDD 2WDQC 3CIRD 1PV3A 2H89C 3B71A 3VR8C 3VR9D 2G3AA 4YT0D 4KX6D 1NEND 3AECC 1KF6D 3AE7D 3P4PD 3AE1C 3AEAC 2WP9D 3P4RD 3AE2D 2WQYC 3AEFD 4YTMC 2WDRD 2WU5C 4YTPD 3P4QD 1L0VC 3AE5D 1KFYC 3AE8C 3P4SC 3SFDC 5C3JD 2WDQD 3AE3D 3CIRC 1K05A 2H89D 1K04A 3VR9C 3AE4C 3ABVD 4YT0C 1NENC 4YTNC 4YSYC 1KF6C 1YQ4D 3P4PC 4YSZD 3AEAD 3AE1D 3P4RC 3AE2C 2WQYD 3AE9C 4YTMD 2B76D 4YTPC 4YSXD 3AEGC 1ZOYD 3P4QC 1L0VD 3AEBD 5C2TC 3SFDD 2WS3D 2WDVD 3AE3C 1YQ3D
chains in the Genus database with same CATH superfamily
3D6YA 3ABVC 3H1KJ 2AEFA 1J1EC 1HGZA 4RO0A 1KB9E 1H88A 3VOPA 1MV8A 1FC2C 2OGUA 3L74E 1SQVK 3H32B 3BASA 4LDTA 2W6AA 3VRAC 1NTMG 1LTJA 1H0TB 1RF1C 1ZR2A 1FS0E 2Z5HA 2WVRA 4I2LC 1VQOP 1PGPA 2QVAA 2YKQA 2OYHC 2ZFYA 2B87B 2KLVA 3MP7B 1JY3N 2QEXP 2YKPA 3B71A 1AV1A 1NU1D 3V2PA 1R8EA 4W7ZA 3HD7B 2DW3A 3CCMP 4H44C 1LWUA 5C3JD 2Q3IA 3GHGA 2YXQB 2KIKA 1P84H 4YT0C 3V4QA 2XDJA 3JCUH 2N1TA 2QRXA 1X0TA 3AE2C 2WQYD 4YTPC 2A45I 1SS1A 1IJDB 2O1KA 2J5UA 3CL3D 1JY2P 4LC1A 1FOSF 3RK2D 1W2BO 1PP9E 1FDOA 1LTJB 2WU2D 3CC4P 1M1KQ 1YQ4C 1SQVJ 1PP9G 3R2PA 1WT6A 3AE9D 2GUSA 3WMM0 2ACZC 4XFJA 1FJPA 5KAFE 3CX5I 5KJ7C 1QGKB 2KI7B 3KDPB 2AEMA 3L75D 1NEKC 2GM4A 1QVGO 1KD1Q 3II6A 3L70J 4JQ0D 2BS3C 2M5AB 4GOFA 2A06D 4Y28J 2ACZD 2BS2C 2CK3H 2BS4C 2FYUE 1L0NJ 2WDRC 4U3FD 3A2AA 3S9OA 4IL6E 1Z56A 2FYUD 3A0BH 1KORA 1PPJG 1BSNA 4K35A 3P8CD 1MZ9A 1PPJE 3P4QD 2Q1KA 1MFTA 2PFXA 1X22A 1KFYC 2FYUK 3L75E 5AVSB 3L72J 1VQ9P 4H0LD 3SFDC 1SQQE 2IBZD 1LTBC 2P7JA 1NENC 5BVZA 3QH9A 4YSZD 3RK3D 1YJNP 1KB9I 2R3CA 2K1AA 4OGQC 4YSXD 3QWOC 3P4QC 2JR8A 1AQ5A 2KYVA 1CI6A 1GW4A 1SQQJ 1IFIA 3G71P 5CBNA 2AEJA 4YTND 1N7SD 3RK3C 1AVOA 1BDDA 1KYOE 1CSBA 1KILA 4D6TE 1LWUB 1NKNA 3HE5A 3P8MC 3M9BA 1OIPA 2PRRA 3LW5J 1FZEA 1BCCE 4Z1MH 2WS3C 1S5LH 2Q9IA 2XNDH 4I7ZB 4LGDE 2HR3A 3TNUB 2OQQA 3HE4B 5KAIE 3HE5B 2XKMA 1U7MA 3WUVA 3AEDC 2Q5UA 2BCCG 2A45G 3BRTB 4D6TJ 3CI9A 1SQXK 2W90A 1SQBK 4N3YB 3H1KE 1FZCB 3VRAD 3RL0C 5TISE 5AW1B 2SPZA 1JUNA 1YHQP 4C7RA 3RBZA 1PGQA 1Q7YQ 5CCHC 1JMMA 3M0DA 3P4RD 2RH0A 4BXLA 3CC7P 1E79H 1Q90D 4XA4A 1KILD 1L0VC 3I5CA 2YMKA 2YXRB 1HF9A 3I55P 3E1RA 2B9BA 3P4SC 1X8YA 2KUBA 1BE3E 3KZIE 1NTZJ 1SQPJ 1NTME 5GTHE 2YIUB 2FYNC 3P4RC 1QLED 1YTZI 3LIDA 1Y47A 1N86A 2KZJA 3FX0A 1FDIA 2Q3EA 4I6LA 1IK7A 2H7HA 1MUUA 3H1IJ 1GD2E 3USSA 2B76C 3TGUD 3CWBG 1HUCA 5TJHA 5KTBA 2WU2C 1NTKD 2NPSC 1GTWA 4AYCA 2QSIA 1EQ7A 1KC8Q 3GMAA 2E75B 1T8ZA 1T2KD 4KX6C 1VQ8P 3BCCJ 5CCHA 1X9VA 2Y0EA 5APVA 2L5GB 3E1IA 2OTJP 1QX8A 3L73E 2AXTE 4LLHA 1P84I 2P67A 1T2KC 3EFFK 2FFDA 1M57D 3P4PD 1KFMA 4DJGA 2P1JA 3VTPC 2E75C 1TU3F 2V7QJ 3O8ZA 1PGOA 1M1JB 3GW6A 1N7SB 2JEEA 2BCCE 2OYIA 2IBZG 3CPWO 1LT9A 5M1BA 5APSA 1SVFA 2C0XA 1LTIC 2AXTH 3HUSC 1OVVA 3TK1A 5CJ4A 5KLVE 4GDOA 1EZVG 2OYIC 1GU5A 4EI2A 3RGUA 2QM8A 3FWNA 2W6JH 1EDLA 3MGNA 1NHLA 5AW8B 1Y9BA 4U3FE 5APXA 5B66E 3MZWB 4DHIB 2M3BA 3AEEC 5AVTB 2K3RA 1NWQA 3VYIA 2BCCD 2P10A 3L71E 2WITA 5B5EH 3CX5E 2WT7A 2C9LY 1LTGC 1JTHA 2LR2A 3H1HJ 2NZ2A 1AA0A 2FYZA 3AE8D 1E7PC 1KN7A 4PD4I 3AEDD 2LKMA 3L73G 3H1LE 2R32A 2E74B 3BCCE 1VF5D 1DD3A 4N78E 3E7KA 1IFMA 1N7SA 1H89A 2HG5D 3FGAD 4YTPD 1BCCG 5CCGD 1URQC 1RE4C 3NFQA 3C8VA 4D6TD 3CIRC 3M0AA 1BSHA 1Q82Q 2WSCH 1S4XA 2XV5A 1WRGA 4PD4D 2PGDA 3L71J 1LWUC 1KFNA 3SWFA 1WMKA 1HH0A 3MUDA 5CCGC 1QEXA 2OTKE 3PH0A 5CBOA 2WDVD 1W5CE 2N9BA 3CMAP 2IZ1A 2ZVNB 3O6QA 2FYUG 4WB4A 4HYTB 1VQ4P 3GF7A 1ZP0C 3CXHD 4IOIH 2O01H 4HH2A 1IK9A 3OW2O 5C2TD 1EDJA 3H1HD 4K3AA 3HTKA 4RKUJ 3TDKA 1LNQA 1MFZA 3BATA 1KILB 2YIUC 3L75G 3SWKA 3AECD 3AE7C 4R4MA 1XTCC 1L0NK 5KKZB 3D6ZA 1SFCD 1NU1G 1NTZD 1NJIQ 4WY4A 1OFCX 2NPSA 1L0LG 2WDQC 3TYYA 1BGYE 3ITKA 1L0ND 4KX6D 3WUUA 4ASVA 3AE7D 3CXHH 4ZMDA 4C46A 3M06A 1ZMEC 1AJYA 2QIWA 2N9YB 5KLIB 1NTMD 1AFOA 2WDQD 5AW0B 1K05A 2ZYGA 1G1JA 1P84E 3CCQP 1VPCA 2ZT9D 3MTUE 4PV1B 1RY3A 1SQVG 2HYNA 1RF1A 4BWNA 4EDFA 4AUWA 3V2QA 3BCCG 5DJUB 4H44B 1E5WA 2E42A 1SQQK 3Q2YA 2OTLP 2WSEH 4I7ZC 2JKVA 1GZLA 2QE7H 2P2UA 4WWIA 1L4AD 3P8CE 2ZT9C 3HE4A 4GKGA 1JTHB 2OARA 2BASA 2RN0A 1N73B 3M9HA 2POHA 2QG4A 1G2CB 5GTIH 1H0TA 4IFDK 1KYOI 2QJKB 1HJ0A 1JO5A 3GLMA 4IL6X 1DD4A 1P84D 4H13B 3RK3B 2XZRA 3O6QB 5KLVG 2O1JA 3AEED 4JF7A 4H13C 2H8PD 3G4SP 1NKZB 4IL6H 3L74G 1J2JB 3V2NA 3Q5SA 2H89C 1ZLLA 1NU1J 2G3AA 1S5LE 3KZIH 2RKLA 3S1KA 3AE1C 2B88A 3W68A 1HGVA 5CMZA 4I6MC 1VQ5P 2D2CD 2IBZI 4H13D 2W8ZA 1SQBE 2HODB 2H89D 1NGMB 2B89A 1NTZK 4L75A 3W67A 3I56P 4YSYC 2PP6A 3AE1D 4NPEA 2B76D 1N73C 4H44D 5H2FH 2FYNB 3PTZA 1KQLA 1FZGA 4FJVA 4DDGA 3FXDA 4DOJA 1PP9D 5AW6B 1T3UA 3N7NA 2ZYDA 1R5SA 4W7YA 1LP1B 5AVWB 4A7PA 3GG2A 1NTMK 2WT7B 1K73Q 3G3ZA 2R5BA 1VQNP 2LXBA 1RH5B 2E5TA 4YPCA 5AVVB 1N2DC 2AXCA 2G8YA 1DEBA 1OVUA 2WPRA 1SQBD 4W80A 3H1JJ 4NPFX 1ZP0D 1BCCJ 1ZV8A 2GA1A 3VMAA 3KHUA 2WP9C 2K88A 5KJ7A 4ASWA 1HWTC 2L91A 1D7MA 2E76D 2J58A 3H1LD 2XNXA 4UB8H 3CCSP 1QVFO 3GF3A 4L76A 3AECC 3HD7C 3H1HG 3CMEP 2K9YA 1A02J 1LT1A 1S72P 2WDRD 3L73D 1SFCC 3U1AA 2HPCB 2E76C 5GTIE 5KKZC 3CXHE 3MIWA 2C9NY 2Z4EA 1GW3A 1KQSO 5AVUB 1PFIA 4MN4C 2OYOA 2WTYA 1MKMA 1T3JA 1M56D 4BRYA 3PHLA 3IN6A 1OVRA 1GDTA 2A06E 3JSVC 3SSUA 1OWAA 1PPJD 1ZW0A 4YXWH 4YSZC 2QJKC 3B4SA 3VMZA 3PLNA 2IZ0A 5AW7B 4YSXC 2H88C 1URQB 3H25A 3PJSK 1NAFA 5APTA 4L73A 1OMIA 3M0DC 1LTAC 4ZKUA 2W83C 1L2PA 1ZR4A 2ZJSE 3SFED 3EFGA 2N1TB 2K9JB 1IC2A 2FFDB 3TGUE 3V2RA 4GOEA 3H6PA 2K9JA 2ZT9B 3TGUG 3V4WA 1CI6B 5DJTB 3N4XA 1FOSE 3C1LA 3L70E 1USDA 2FXMA 2WU5C 3ZDMA 4DDIA 1L0NG 3RL0D 2GUVA 3H1ID 1RQVA 3VONA 1SQXD 3MUDC 5CCGA 3VMYA 3AE3D 1EXIA 5C39A 3AE4C 2ZFCA 1M90Q 3OAKA 5CCHD 1GMJA 3K5BA 3AEAD 3IFMA 2YNYA 2KLUA 1BGYJ 1ZOYD 2R44A 1L0VD 5C2TC 2D2CC 3P32A 5KLVD 1PL5A 2KP8A 3BVHA 2KOGA 2WSFJ 2WSEJ 4OWFA 1YQ3D 1S9KE 2FY8A 4N78D 4YSYD 1JY2O 2KSEA 3D71A 5APUA 4YXDD 1J1DB 3H1KD 2I1KA 3GHGB 2NRGA 3AE6C 4N6JA 3JC22 1LT9B 3KPEA 2OYIB 5AW4B 3T97B 2ZXXA 1VQMP 1LTTC 3LW5H 3VR8D 3CD6P 3H1LG 4ZKPA 2IPPA 4WY4D 1L4AB 1T6AA 1M1JC 5EFWB 3AE5C 2NPSD 2J59M 1QL1A 1KILE 1A02F 4DHZA 1AQTA 1PV3A 1U7JA 3CLQA 4DZOA 4UB6H 3U59A 1FZCA 2WP9D 2JO1A 1TFFA 4WY4C 1NOHA 2JDIH 2KXPB 3H1JD 2KS1A 1FZFA 1L0NE 3L75J 1HJBA 1HBWA 3MD0A 2KK7A 4IFMA 1NTMJ 3EQ2A 1OXZA 1VF5B 1L4AC 3B5NB 2O3JA 2IBZE 2Q6QA 2NPSB 2QJPB 1Q86Q 3IAOA 1VL2A 1L4AA 1S2EA 5APYA 2FYUJ 1OW8A 3CWBD 2WMMA 1NVOA 3IF4A 1QLBC 1LT9C 3TF5A 1M7LA 1SFCB 3M9QA 3AEBC 1FZBA 1IFJA 1J1DC 2HPCA 2YO2A 2BEZF 3WU2E 3TSIA 4PD4H 3L70D 5AVQB 3H32A 3FXEA 3SWYA 4O9BA 1EZVD 1EDKA 3RL0B 4PJ0H 1FZCC 1ZXGA 3NMDA 1RHZB 1SQPE 1SP4A 1IO4A 3B5NA 1GU4A 5C3JC 4B86A 1IFDA 2IFNA 1CW5A 4YT0D 4HKZH 1UIIA 1NU1E 4GT1A 2JP3A 1RE3C 2WQYC 3AE2D 4YTMC 3BRVB 1KQGB 2IYOA 2JWAA 1EZVI 3AE8C 1EXJA 2OYHA 3RK2C 1KB9D 2I1JA 1GL2D 1YJWP 3H1JG 4QMAA 3CC2P 1YQ4D 1JB0J 4WBAA 3EWKA 4YTMD 1SFCA 3R4YA 2R3SA 4GIFA 4C7NB 2C0WA 5AW2B 4OGQB 3AE3C 5E79H 1DEEG 3RK3E 2FBWC 1NEKD 1VQPP 1RE4A 4UB8E 5APWA 1N73A 3HUSA 1NTZE 1ZOYC 2HODA 2O01N 2XU6A 2Y9ZA 2WDVC 1YQ3C 2FBWD 1KYOD 1GL2B 1GK4A 1BE3D 2W6BA 3H1IG 1BE3G 4YXDC 3CCLP 1AVYA 3Q5RA 1VDFA 4CPGA 3HD7D 3CCUP 3H1IE 1EDIA 2HLOA 3AEFC 2CPBA 2A06G 1G1IA 1SQPG 2WSCJ 2M3EA 4H0LC 3VR8C 2E76B 1YYCA 1NEND 1SQPD 1PZQA 3AEFD 1JMBA 1VQ7P 1BE3J 3AE5D 3V5BA 1M1JA 1SQXG 4JYCA 5KAIH 4I1LA 3T97A 2Y0CA 3G9RA 3CCRP 3VN0A 3CCJP 1SQVE 2MJZA 1FDMA 1KYOH 1Y8AA 3NTNA 1URQA 1ZRTD 2JJLA 2KNCA 4EIJA 1JY3P 4XE5B 3KYQA 2WSFH 5AW5B 1LTJC 1NO4A 1UIXA 1N7LA 2MKVA 1JY2N 3CX5D 3SFEC 2E5YA 3HRNA 5KAFH 4OH8B 1SLQA 2WWWA 2V4HA 4PD4E 4ZNCA 1SQQD 5E79E 1OZHA 1VQLP 3B8EB 3BCCD 5AVYB 1S3JA 4R4LA 3G6EP 3A0BE 1KILC 2WU5D 1S1CX 1IZNB 3UIAA 5B66H 2Z5IA 1JCCA 3P4SD 4KT0J 1K8AQ 3L72D 4RESB 4OVNF 4NPDA 1RF1B 1KF6D 2Y0DA 3AEAC 3L72G 2V7QH 3Q3DA 1YJ9P 2HFED 4TT3H 2BCCJ 3KQGA 4KHXA 3L74J 5AW3B 3NXSA 4WVZA 2LXCB 5CJ0A 4DHJA 2KZIA 5KLVJ 1L0LK 1RQUA 1GL2A 4GODA 3H1LJ 1JM0A 1JOCA 3A7OA 1DH3A 1R5LA 3A5TA 3LIEA 2E74D 1GL2C 3CCEP 2YKOA 4U3FJ 2K37A 3A3YB 1J1EB 1L0LE 1VQ6P 5K5GB 3FWLA 2KB7P 1CZQA 3L37A 3OA7A 2E74C 3TNUA 4DCKA 1YTZT 1N8RQ 1LGHB 2ITAA 5BU8B 2M0BA 4WY4B 1RF0A 3WUTA 2IYPA 4L74A 4PV1C 5KJ7D 2IDBA 2UWJE 3VMXA 1Q2NA 1YI2P 1OW6A 4HB1A 3V6IA 3RK2B 2WPSA 5APQA 3VR9D 2YO3A 3HTKB 2KSJA 4PV1D 3L71D 4U7JA 1LJ2A 3L72E 3PRJA 3TGUJ 5AVRB 4EYYQ 3F89A 2WZ7A 4AQRD 1L0LJ 1QL2A 5L8RJ 1FBMA 3WU2H 1FZAA 2D2CB 3L4FA 4UB6E 3M91A 3PP5A 3L70G 3IR9A 1DX7A 5KLIC 1KB9H 2VRSA 1JCDA 3AEGC 4EOTA 3AEBD 2IX7C 3HUSB 5CHXA 3JCUE 1PP9J 3OJAB 3SFDD 1JY3O 5AVXB 3CXHI 1HTLC 2CPSA 1IFPA 1BGYD 1SQXE 5TISH 2FXPA 1G2CA 1BGYG 1OW7A 3AEGD 2PAJA 3VRBD 1FE6A 3CWBJ 1Q81Q 2WSSH 1IFNA 4Y99C 1LP1A 1NAYA 2QJPC 5B5EE 2OYHB 1YBKA 4H0LB 3VP9A 1BDCA 4C7NA 3B5NC 3C9IA 1VF5C 4M3LA 2B87A 3VRBC 2H88D 1SQXJ 2YMYA 1NTKK 3L35A 1K9MQ 2ZYAA 1URQD 3Q5PA 1L0LD 5AW9B 3F5HA 1SQVD 3CIRD 2N1TC 3B5ND 1NTZG 1KQFB 1M8OB 4JBZA 1X79B 3RBXA 3VP8A 1KMIZ 4Y99B 3RL0g 1FU1A 1NTKE 1ZN5A 1U57A 5BU5A 1SQPK 2N1TD 1K04A 1RE3A 1KF6C 2KNCB 1YITP 3AE9C 3P7KA 1KV4A 1YIJP 4BRYB 1NU1K 1ZRTE 1EZVE 2M8RA 4U3FG 1USEA 1OX3A 1W2EA 4PJ0E 3H1KG 1PGJA 2RMZA 5AVZB 3A0HH 3CX5H 3AE4D 3L74D 1S9KD 2M5AA 3GHGC 2FKWB 2R5DA 1RF0C 1PIXA 2QJYC 1FJKA 3L71G 4RJTA 1S5LX 1KTMA 4HJGH 2FXOA 1JEKA 2JWDA 2QM7A 3H1HE 3KXDA 2A45H 1NTKJ 4KJMA 1JNMA 1SQBG 2KS1B 1KZUB 2BEQD 3D70A 1SQQG 4JYBA 2QA4P 3AE6D 3S4RA 1HVVA 2P58A 3HD7A 2W27A 2Y9YA 3MHVA 3L73J 1KFYD 4TLFA 2H43A 3L36A 4DT0A 1XTGB 3Q1MA 2QJYB 2Q7CA 2WPVB 5KLVK 1DIPA 2WPQA 3H1JE 1VQKP 2I8DA 4OGQD 3CCVP 5H2FE 1SQBJ 2ZXEB 3CWBE 4D6TG 1NTKG 1NYHA 4JPZB 3A0HE 1H8AA 1EC5A 2E43A 4IFFA 3VR9C 2FFDC 3ABVD 1BCCD 1NH4A 4YTNC 1N7SC 3P4PC 2ZAEB 2E75D 1FAVA 2ZVOB 2O01J 3U1CA 5GTHH 2WS3D 2IFMA 1GK6A 1LTSC
chains in the Genus database with same CATH topology
2E74D 3RK3E 2FBWC 3D6YA 1VL2A 1NEKD 2WU2D 3ABVC 3AE4D 3Q2YA 4YTND 3O6QA 1OW8A 1YQ4C 4YSYD 4I7ZC 3D71A 3GF7A 4YSZC 2QJKC 1Y9BA 1QLBC 3AE9D 4YXDD 2ZT9C 1ZP0C 2FXPA 1PIXA 2QJYC 1OW7A 2ACZC 1UIXA 1ZOYC 2B76C 4XFJA 3AEGD 4YSXC 3VRBD 3AEBC 3LW5J 5C2TD 1S5LX 2H88C 2MKVA 3AE6C 4Z1MH 3H25A 1KTMA 2WS3C 4I7ZB 3SFEC 2WDVC 1YQ3C 2E74C 2BEZF 3AEEC 4RKUJ 1NEKC 2OQQA 2FBWD 2WU2C 3T97B 2QJPC 3VRAC 2G8YA 4H0LB 1OMIA 2P10A 2BS3C 2QSIA 3AEDC 1HJ0A 3GMAA 4YXDC 3VR8D 3GLMA 1ZP0D 2E75B 1VF5C 2BEQD 4Y28J 4IL6X 3D70A 1DD4A 2ACZD 3Q5RA 2BS2C 4KX6C 2YIUC 3VRBC 3AECD 2BS4C 3AE7C 4PV1C 4R4MA 2H88D 2IDBA 3AE6D 2WP9C 4H13B 3AEFC 4R4LA 2NZ2A 2WDRC 3SFED 3D6ZA 2WU5D 1S1CX 3AEED 3AE5C 1KFYD 4H13C 3S9OA 2WSCJ 1OW6A 3VRAD 2E76D 4H0LC 4KT0J 3Q5PA 3AE8D 3P4SD 1KILE 1E7PC 5C3JC 3AEDD 3Q5SA 2WDQC 3CIRD 1PV3A 2H89C 3Q1MA 3B71A 3VR8C 3VR9D 2E74B 1VF5D 1DD3A 2E76B 2G3AA 4YT0D 2ZT9B 4KX6D 3GF3A 2WDVD 2WPVB 1NEND 1KQFB 3AECC 1KF6D 4PV1D 1DIPA 1KORA 3AE7D 3P4PD 2K9YA 2JP3A 3AE1C 3AEAC 2WP9D 1R8EA 3P4RD 2WQYC 3AE2D 2JO1A 1Q90D 3AEFD 4YTMC 4H44B 2E75C 3Q3DA 4U7JA 1TU3F 3FGAD 1KQGB 4OGQD 2WDRD 2WU5C 4YTPD 2V7QJ 1KMIZ 3P4QD 1L0VC 4TT3H 1ZMEC 3RL0g 2YMKA 2D2CD 4H44C 1AJYA 1KFYC 4H13D 1HF9A 2QIWA 3AE5D 2E76C 3AE8C 4H0LD 1U57A 3SFDC 5L8RJ 1EXJA 3P4SC 5C3JD 1RQVA 3C8VA 1NYHA 5KKZC 3G9RA 2WDQD 3AE3D 3CIRC 1K05A 2D2CB 1K04A 4OGQB 1NGMB 1EXIA 2H89D 3VR9C 3AE4C 3ABVD 4YT0C 1NENC 5M1BA 4YTNC 4YSYC 1KF6C 1YQ4D 2FYNC 1GMJA 1JB0J 1RQUA 3P4PC 3AEAD 3AE1D 3P4RC 4YSZD 1VF5B 3AE2C 3EWKA 5KLIC 3AE9C 2WQYD 2ZT9D 1MKMA 4YTMD 2E75D 4OGQC 3R4YA 2B76D 4YTPC 4GDOA 3AEGC 1ZOYD 4YSXD 4PV1B 1L0VD 3P4QC 1WMKA 3AEBD 5C2TC 1ZRTE 2D2CC 3IN6A 4H44D 2J5UA 2O01J 1PL5A 1FDIA 3SFDD 3IAOA 2WS3D 1IK7A 2WSFJ 2WSEJ 3AE3C 1YQ3D 1FDOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FBW C;  1NEK D;  2WU2 D;  3ABV C;  3AE4 D;  4YTN D;  4YSY D;  1OW8 A;  1YQ4 C;  4YSZ C;  1QLB C;  3AE9 D;  4YXD D;  1ZP0 C;  1OW7 A;  2ACZ C;  2B76 C;  1ZOY C;  3AEG D;  4YSX C;  3VRB D;  3AEB C;  5C2T D;  2H88 C;  3AE6 C;  1KTM A;  2WS3 C;  3SFE C;  2WDV C;  1YQ3 C;  3AEE C;  2FBW D;  2WU2 C;  1NEK C;  3VRA C;  2BS3 C;  3AED C;  4YXD C;  3VR8 D;  1ZP0 D;  2ACZ D;  2BS2 C;  4KX6 C;  3VRB C;  3AEC D;  2BS4 C;  3AE7 C;  2H88 D;  3AE6 D;  2WP9 C;  3AEF C;  2WDR C;  3SFE D;  2WU5 D;  3AEE D;  3AE5 C;  1KFY D;  3S9O A;  1OW6 A;  3VRA D;  3AE8 D;  3P4S D;  1E7P C;  5C3J C;  3AED D;  2WDQ C;  3CIR D;  1PV3 A;  2H89 C;  3B71 A;  3VR8 C;  3VR9 D;  2G3A A;  4YT0 D;  4KX6 D;  1NEN D;  3AEC C;  1KF6 D;  3AE7 D;  3P4P D;  3AE1 C;  3AEA C;  2WP9 D;  3P4R D;  3AE2 D;  2WQY C;  3AEF D;  4YTM C;  2WDR D;  2WU5 C;  4YTP D;  3P4Q D;  1L0V C;  3AE5 D;  1KFY C;  3AE8 C;  3P4S C;  3SFD C;  5C3J D;  2WDQ D;  3AE3 D;  3CIR C;  1K05 A;  2H89 D;  1K04 A;  3VR9 C;  3AE4 C;  3ABV D;  4YT0 C;  1NEN C;  4YTN C;  4YSY C;  1KF6 C;  1YQ4 D;  3P4P C;  4YSZ D;  3AEA D;  3AE1 D;  3P4R C;  3AE2 C;  2WQY D;  3AE9 C;  4YTM D;  2B76 D;  4YTP C;  4YSX D;  3AEG C;  1ZOY D;  3P4Q C;  1L0V D;  3AEB D;  5C2T C;  3SFD D;  2WS3 D;  2WDV D;  3AE3 C;  1YQ3 D; 
#chains in the Genus database with same CATH topology
 3D6Y A;  3ABV C;  3H1K J;  2AEF A;  1J1E C;  1HGZ A;  4RO0 A;  1KB9 E;  1H88 A;  3VOP A;  1MV8 A;  1FC2 C;  2OGU A;  3L74 E;  1SQV K;  3H32 B;  3BAS A;  4LDT A;  2W6A A;  3VRA C;  1NTM G;  1LTJ A;  1H0T B;  1RF1 C;  1ZR2 A;  1FS0 E;  2Z5H A;  2WVR A;  4I2L C;  1VQO P;  1PGP A;  2QVA A;  2YKQ A;  2OYH C;  2ZFY A;  2B87 B;  2KLV A;  3MP7 B;  1JY3 N;  2QEX P;  2YKP A;  3B71 A;  1AV1 A;  1NU1 D;  3V2P A;  1R8E A;  4W7Z A;  3HD7 B;  2DW3 A;  3CCM P;  4H44 C;  1LWU A;  5C3J D;  2Q3I A;  3GHG A;  2YXQ B;  2KIK A;  1P84 H;  4YT0 C;  3V4Q A;  2XDJ A;  3JCU H;  2N1T A;  2QRX A;  1X0T A;  3AE2 C;  2WQY D;  4YTP C;  2A45 I;  1SS1 A;  1IJD B;  2O1K A;  2J5U A;  3CL3 D;  1JY2 P;  4LC1 A;  1FOS F;  3RK2 D;  1W2B O;  1PP9 E;  1FDO A;  1LTJ B;  2WU2 D;  3CC4 P;  1M1K Q;  1YQ4 C;  1SQV J;  1PP9 G;  3R2P A;  1WT6 A;  3AE9 D;  2GUS A;  3WMM 0;  2ACZ C;  4XFJ A;  1FJP A;  5KAF E;  3CX5 I;  5KJ7 C;  1QGK B;  2KI7 B;  3KDP B;  2AEM A;  3L75 D;  1NEK C;  2GM4 A;  1QVG O;  1KD1 Q;  3II6 A;  3L70 J;  4JQ0 D;  2BS3 C;  2M5A B;  4GOF A;  2A06 D;  4Y28 J;  2ACZ D;  2BS2 C;  2CK3 H;  2BS4 C;  2FYU E;  1L0N J;  2WDR C;  4U3F D;  3A2A A;  3S9O A;  4IL6 E;  1Z56 A;  2FYU D;  3A0B H;  1KOR A;  1PPJ G;  1BSN A;  4K35 A;  3P8C D;  1MZ9 A;  1PPJ E;  3P4Q D;  2Q1K A;  1MFT A;  2PFX A;  1X22 A;  1KFY C;  2FYU K;  3L75 E;  5AVS B;  3L72 J;  1VQ9 P;  4H0L D;  3SFD C;  1SQQ E;  2IBZ D;  1LTB C;  2P7J A;  1NEN C;  5BVZ A;  3QH9 A;  4YSZ D;  3RK3 D;  1YJN P;  1KB9 I;  2R3C A;  2K1A A;  4OGQ C;  4YSX D;  3QWO C;  3P4Q C;  2JR8 A;  1AQ5 A;  2KYV A;  1CI6 A;  1GW4 A;  1SQQ J;  1IFI A;  3G71 P;  5CBN A;  2AEJ A;  4YTN D;  1N7S D;  3RK3 C;  1AVO A;  1BDD A;  1KYO E;  1CSB A;  1KIL A;  4D6T E;  1LWU B;  1NKN A;  3HE5 A;  3P8M C;  3M9B A;  1OIP A;  2PRR A;  3LW5 J;  1FZE A;  1BCC E;  4Z1M H;  2WS3 C;  1S5L H;  2Q9I A;  2XND H;  4I7Z B;  4LGD E;  2HR3 A;  3TNU B;  2OQQ A;  3HE4 B;  5KAI E;  3HE5 B;  2XKM A;  1U7M A;  3WUV A;  3AED C;  2Q5U A;  2BCC G;  2A45 G;  3BRT B;  4D6T J;  3CI9 A;  1SQX K;  2W90 A;  1SQB K;  4N3Y B;  3H1K E;  1FZC B;  3VRA D;  3RL0 C;  5TIS E;  5AW1 B;  2SPZ A;  1JUN A;  1YHQ P;  4C7R A;  3RBZ A;  1PGQ A;  1Q7Y Q;  5CCH C;  1JMM A;  3M0D A;  3P4R D;  2RH0 A;  4BXL A;  3CC7 P;  1E79 H;  1Q90 D;  4XA4 A;  1KIL D;  1L0V C;  3I5C A;  2YMK A;  2YXR B;  1HF9 A;  3I55 P;  3E1R A;  2B9B A;  3P4S C;  1X8Y A;  2KUB A;  1BE3 E;  3KZI E;  1NTZ J;  1SQP J;  1NTM E;  5GTH E;  2YIU B;  2FYN C;  3P4R C;  1QLE D;  1YTZ I;  3LID A;  1Y47 A;  1N86 A;  2KZJ A;  3FX0 A;  1FDI A;  2Q3E A;  4I6L A;  1IK7 A;  2H7H A;  1MUU A;  3H1I J;  1GD2 E;  3USS A;  2B76 C;  3TGU D;  3CWB G;  1HUC A;  5TJH A;  5KTB A;  2WU2 C;  1NTK D;  2NPS C;  1GTW A;  4AYC A;  2QSI A;  1EQ7 A;  1KC8 Q;  3GMA A;  2E75 B;  1T8Z A;  1T2K D;  4KX6 C;  1VQ8 P;  3BCC J;  5CCH A;  1X9V A;  2Y0E A;  5APV A;  2L5G B;  3E1I A;  2OTJ P;  1QX8 A;  3L73 E;  2AXT E;  4LLH A;  1P84 I;  2P67 A;  1T2K C;  3EFF K;  2FFD A;  1M57 D;  3P4P D;  1KFM A;  4DJG A;  2P1J A;  3VTP C;  2E75 C;  1TU3 F;  2V7Q J;  3O8Z A;  1PGO A;  1M1J B;  3GW6 A;  1N7S B;  2JEE A;  2BCC E;  2OYI A;  2IBZ G;  3CPW O;  1LT9 A;  5M1B A;  5APS A;  1SVF A;  2C0X A;  1LTI C;  2AXT H;  3HUS C;  1OVV A;  3TK1 A;  5CJ4 A;  5KLV E;  4GDO A;  1EZV G;  2OYI C;  1GU5 A;  4EI2 A;  3RGU A;  2QM8 A;  3FWN A;  2W6J H;  1EDL A;  3MGN A;  1NHL A;  5AW8 B;  1Y9B A;  4U3F E;  5APX A;  5B66 E;  3MZW B;  4DHI B;  2M3B A;  3AEE C;  5AVT B;  2K3R A;  1NWQ A;  3VYI A;  2BCC D;  2P10 A;  3L71 E;  2WIT A;  5B5E H;  3CX5 E;  2WT7 A;  2C9L Y;  1LTG C;  1JTH A;  2LR2 A;  3H1H J;  2NZ2 A;  1AA0 A;  2FYZ A;  3AE8 D;  1E7P C;  1KN7 A;  4PD4 I;  3AED D;  2LKM A;  3L73 G;  3H1L E;  2R32 A;  2E74 B;  3BCC E;  1VF5 D;  1DD3 A;  4N78 E;  3E7K A;  1IFM A;  1N7S A;  1H89 A;  2HG5 D;  3FGA D;  4YTP D;  1BCC G;  5CCG D;  1URQ C;  1RE4 C;  3NFQ A;  3C8V A;  4D6T D;  3CIR C;  3M0A A;  1BSH A;  1Q82 Q;  2WSC H;  1S4X A;  2XV5 A;  1WRG A;  4PD4 D;  2PGD A;  3L71 J;  1LWU C;  1KFN A;  3SWF A;  1WMK A;  1HH0 A;  3MUD A;  5CCG C;  1QEX A;  2OTK E;  3PH0 A;  5CBO A;  2WDV D;  1W5C E;  2N9B A;  3CMA P;  2IZ1 A;  2ZVN B;  3O6Q A;  2FYU G;  4WB4 A;  4HYT B;  1VQ4 P;  3GF7 A;  1ZP0 C;  3CXH D;  4IOI H;  2O01 H;  4HH2 A;  1IK9 A;  3OW2 O;  5C2T D;  1EDJ A;  3H1H D;  4K3A A;  3HTK A;  4RKU J;  3TDK A;  1LNQ A;  1MFZ A;  3BAT A;  1KIL B;  2YIU C;  3L75 G;  3SWK A;  3AEC D;  3AE7 C;  4R4M A;  1XTC C;  1L0N K;  5KKZ B;  3D6Z A;  1SFC D;  1NU1 G;  1NTZ D;  1NJI Q;  4WY4 A;  1OFC X;  2NPS A;  1L0L G;  2WDQ C;  3TYY A;  1BGY E;  3ITK A;  1L0N D;  4KX6 D;  3WUU A;  4ASV A;  3AE7 D;  3CXH H;  4ZMD A;  4C46 A;  3M06 A;  1ZME C;  1AJY A;  2QIW A;  2N9Y B;  5KLI B;  1NTM D;  1AFO A;  2WDQ D;  5AW0 B;  1K05 A;  2ZYG A;  1G1J A;  1P84 E;  3CCQ P;  1VPC A;  2ZT9 D;  3MTU E;  4PV1 B;  1RY3 A;  1SQV G;  2HYN A;  1RF1 A;  4BWN A;  4EDF A;  4AUW A;  3V2Q A;  3BCC G;  5DJU B;  4H44 B;  1E5W A;  2E42 A;  1SQQ K;  3Q2Y A;  2OTL P;  2WSE H;  4I7Z C;  2JKV A;  1GZL A;  2QE7 H;  2P2U A;  4WWI A;  1L4A D;  3P8C E;  2ZT9 C;  3HE4 A;  4GKG A;  1JTH B;  2OAR A;  2BAS A;  2RN0 A;  1N73 B;  3M9H A;  2POH A;  2QG4 A;  1G2C B;  5GTI H;  1H0T A;  4IFD K;  1KYO I;  2QJK B;  1HJ0 A;  1JO5 A;  3GLM A;  4IL6 X;  1DD4 A;  1P84 D;  4H13 B;  3RK3 B;  2XZR A;  3O6Q B;  5KLV G;  2O1J A;  3AEE D;  4JF7 A;  4H13 C;  2H8P D;  3G4S P;  1NKZ B;  4IL6 H;  3L74 G;  1J2J B;  3V2N A;  3Q5S A;  2H89 C;  1ZLL A;  1NU1 J;  2G3A A;  1S5L E;  3KZI H;  2RKL A;  3S1K A;  3AE1 C;  2B88 A;  3W68 A;  1HGV A;  5CMZ A;  4I6M C;  1VQ5 P;  2D2C D;  2IBZ I;  4H13 D;  2W8Z A;  1SQB E;  2HOD B;  2H89 D;  1NGM B;  2B89 A;  1NTZ K;  4L75 A;  3W67 A;  3I56 P;  4YSY C;  2PP6 A;  3AE1 D;  4NPE A;  2B76 D;  1N73 C;  4H44 D;  5H2F H;  2FYN B;  3PTZ A;  1KQL A;  1FZG A;  4FJV A;  4DDG A;  3FXD A;  4DOJ A;  1PP9 D;  5AW6 B;  1T3U A;  3N7N A;  2ZYD A;  1R5S A;  4W7Y A;  1LP1 B;  5AVW B;  4A7P A;  3GG2 A;  1NTM K;  2WT7 B;  1K73 Q;  3G3Z A;  2R5B A;  1VQN P;  2LXB A;  1RH5 B;  2E5T A;  4YPC A;  5AVV B;  1N2D C;  2AXC A;  2G8Y A;  1DEB A;  1OVU A;  2WPR A;  1SQB D;  4W80 A;  3H1J J;  4NPF X;  1ZP0 D;  1BCC J;  1ZV8 A;  2GA1 A;  3VMA A;  3KHU A;  2WP9 C;  2K88 A;  5KJ7 A;  4ASW A;  1HWT C;  2L91 A;  1D7M A;  2E76 D;  2J58 A;  3H1L D;  2XNX A;  4UB8 H;  3CCS P;  1QVF O;  3GF3 A;  4L76 A;  3AEC C;  3HD7 C;  3H1H G;  3CME P;  2K9Y A;  1A02 J;  1LT1 A;  1S72 P;  2WDR D;  3L73 D;  1SFC C;  3U1A A;  2HPC B;  2E76 C;  5GTI E;  5KKZ C;  3CXH E;  3MIW A;  2C9N Y;  2Z4E A;  1GW3 A;  1KQS O;  5AVU B;  1PFI A;  4MN4 C;  2OYO A;  2WTY A;  1MKM A;  1T3J A;  1M56 D;  4BRY A;  3PHL A;  3IN6 A;  1OVR A;  1GDT A;  2A06 E;  3JSV C;  3SSU A;  1OWA A;  1PPJ D;  1ZW0 A;  4YXW H;  4YSZ C;  2QJK C;  3B4S A;  3VMZ A;  3PLN A;  2IZ0 A;  5AW7 B;  4YSX C;  2H88 C;  1URQ B;  3H25 A;  3PJS K;  1NAF A;  5APT A;  4L73 A;  1OMI A;  3M0D C;  1LTA C;  4ZKU A;  2W83 C;  1L2P A;  1ZR4 A;  2ZJS E;  3SFE D;  3EFG A;  2N1T B;  2K9J B;  1IC2 A;  2FFD B;  3TGU E;  3V2R A;  4GOE A;  3H6P A;  2K9J A;  2ZT9 B;  3TGU G;  3V4W A;  1CI6 B;  5DJT B;  3N4X A;  1FOS E;  3C1L A;  3L70 E;  1USD A;  2FXM A;  2WU5 C;  3ZDM A;  4DDI A;  1L0N G;  3RL0 D;  2GUV A;  3H1I D;  1RQV A;  3VON A;  1SQX D;  3MUD C;  5CCG A;  3VMY A;  3AE3 D;  1EXI A;  5C39 A;  3AE4 C;  2ZFC A;  1M90 Q;  3OAK A;  5CCH D;  1GMJ A;  3K5B A;  3AEA D;  3IFM A;  2YNY A;  2KLU A;  1BGY J;  1ZOY D;  2R44 A;  1L0V D;  5C2T C;  2D2C C;  3P32 A;  5KLV D;  1PL5 A;  2KP8 A;  3BVH A;  2KOG A;  2WSF J;  2WSE J;  4OWF A;  1YQ3 D;  1S9K E;  2FY8 A;  4N78 D;  4YSY D;  1JY2 O;  2KSE A;  3D71 A;  5APU A;  4YXD D;  1J1D B;  3H1K D;  2I1K A;  3GHG B;  2NRG A;  3AE6 C;  4N6J A;  3JC2 2;  1LT9 B;  3KPE A;  2OYI B;  5AW4 B;  3T97 B;  2ZXX A;  1VQM P;  1LTT C;  3LW5 H;  3VR8 D;  3CD6 P;  3H1L G;  4ZKP A;  2IPP A;  4WY4 D;  1L4A B;  1T6A A;  1M1J C;  5EFW B;  3AE5 C;  2NPS D;  2J59 M;  1QL1 A;  1KIL E;  1A02 F;  4DHZ A;  1AQT A;  1PV3 A;  1U7J A;  3CLQ A;  4DZO A;  4UB6 H;  3U59 A;  1FZC A;  2WP9 D;  2JO1 A;  1TFF A;  4WY4 C;  1NOH A;  2JDI H;  2KXP B;  3H1J D;  2KS1 A;  1FZF A;  1L0N E;  3L75 J;  1HJB A;  1HBW A;  3MD0 A;  2KK7 A;  4IFM A;  1NTM J;  3EQ2 A;  1OXZ A;  1VF5 B;  1L4A C;  3B5N B;  2O3J A;  2IBZ E;  2Q6Q A;  2NPS B;  2QJP B;  1Q86 Q;  3IAO A;  1VL2 A;  1L4A A;  1S2E A;  5APY A;  2FYU J;  1OW8 A;  3CWB D;  2WMM A;  1NVO A;  3IF4 A;  1QLB C;  1LT9 C;  3TF5 A;  1M7L A;  1SFC B;  3M9Q A;  3AEB C;  1FZB A;  1IFJ A;  1J1D C;  2HPC A;  2YO2 A;  2BEZ F;  3WU2 E;  3TSI A;  4PD4 H;  3L70 D;  5AVQ B;  3H32 A;  3FXE A;  3SWY A;  4O9B A;  1EZV D;  1EDK A;  3RL0 B;  4PJ0 H;  1FZC C;  1ZXG A;  3NMD A;  1RHZ B;  1SQP E;  1SP4 A;  1IO4 A;  3B5N A;  1GU4 A;  5C3J C;  4B86 A;  1IFD A;  2IFN A;  1CW5 A;  4YT0 D;  4HKZ H;  1UII A;  1NU1 E;  4GT1 A;  2JP3 A;  1RE3 C;  2WQY C;  3AE2 D;  4YTM C;  3BRV B;  1KQG B;  2IYO A;  2JWA A;  1EZV I;  3AE8 C;  1EXJ A;  2OYH A;  3RK2 C;  1KB9 D;  2I1J A;  1GL2 D;  1YJW P;  3H1J G;  4QMA A;  3CC2 P;  1YQ4 D;  1JB0 J;  4WBA A;  3EWK A;  4YTM D;  1SFC A;  3R4Y A;  2R3S A;  4GIF A;  4C7N B;  2C0W A;  5AW2 B;  4OGQ B;  3AE3 C;  5E79 H;  1DEE G;  3RK3 E;  2FBW C;  1NEK D;  1VQP P;  1RE4 A;  4UB8 E;  5APW A;  1N73 A;  3HUS A;  1NTZ E;  1ZOY C;  2HOD A;  2O01 N;  2XU6 A;  2Y9Z A;  2WDV C;  1YQ3 C;  2FBW D;  1KYO D;  1GL2 B;  1GK4 A;  1BE3 D;  2W6B A;  3H1I G;  1BE3 G;  4YXD C;  3CCL P;  1AVY A;  3Q5R A;  1VDF A;  4CPG A;  3HD7 D;  3CCU P;  3H1I E;  1EDI A;  2HLO A;  3AEF C;  2CPB A;  2A06 G;  1G1I A;  1SQP G;  2WSC J;  2M3E A;  4H0L C;  3VR8 C;  2E76 B;  1YYC A;  1NEN D;  1SQP D;  1PZQ A;  3AEF D;  1JMB A;  1VQ7 P;  1BE3 J;  3AE5 D;  3V5B A;  1M1J A;  1SQX G;  4JYC A;  5KAI H;  4I1L A;  3T97 A;  2Y0C A;  3G9R A;  3CCR P;  3VN0 A;  3CCJ P;  1SQV E;  2MJZ A;  1FDM A;  1KYO H;  1Y8A A;  3NTN A;  1URQ A;  1ZRT D;  2JJL A;  2KNC A;  4EIJ A;  1JY3 P;  4XE5 B;  3KYQ A;  2WSF H;  5AW5 B;  1LTJ C;  1NO4 A;  1UIX A;  1N7L A;  2MKV A;  1JY2 N;  3CX5 D;  3SFE C;  2E5Y A;  3HRN A;  5KAF H;  4OH8 B;  1SLQ A;  2WWW A;  2V4H A;  4PD4 E;  4ZNC A;  1SQQ D;  5E79 E;  1OZH A;  1VQL P;  3B8E B;  3BCC D;  5AVY B;  1S3J A;  4R4L A;  3G6E P;  3A0B E;  1KIL C;  2WU5 D;  1S1C X;  1IZN B;  3UIA A;  5B66 H;  2Z5I A;  1JCC A;  3P4S D;  4KT0 J;  1K8A Q;  3L72 D;  4RES B;  4OVN F;  4NPD A;  1RF1 B;  1KF6 D;  2Y0D A;  3AEA C;  3L72 G;  2V7Q H;  3Q3D A;  1YJ9 P;  2HFE D;  4TT3 H;  2BCC J;  3KQG A;  4KHX A;  3L74 J;  5AW3 B;  3NXS A;  4WVZ A;  2LXC B;  5CJ0 A;  4DHJ A;  2KZI A;  5KLV J;  1L0L K;  1RQU A;  1GL2 A;  4GOD A;  3H1L J;  1JM0 A;  1JOC A;  3A7O A;  1DH3 A;  1R5L A;  3A5T A;  3LIE A;  2E74 D;  1GL2 C;  3CCE P;  2YKO A;  4U3F J;  2K37 A;  3A3Y B;  1J1E B;  1L0L E;  1VQ6 P;  5K5G B;  3FWL A;  2KB7 P;  1CZQ A;  3L37 A;  3OA7 A;  2E74 C;  3TNU A;  4DCK A;  1YTZ T;  1N8R Q;  1LGH B;  2ITA A;  5BU8 B;  2M0B A;  4WY4 B;  1RF0 A;  3WUT A;  2IYP A;  4L74 A;  4PV1 C;  5KJ7 D;  2IDB A;  2UWJ E;  3VMX A;  1Q2N A;  1YI2 P;  1OW6 A;  4HB1 A;  3V6I A;  3RK2 B;  2WPS A;  5APQ A;  3VR9 D;  2YO3 A;  3HTK B;  2KSJ A;  4PV1 D;  3L71 D;  4U7J A;  1LJ2 A;  3L72 E;  3PRJ A;  3TGU J;  5AVR B;  4EYY Q;  3F89 A;  2WZ7 A;  4AQR D;  1L0L J;  1QL2 A;  5L8R J;  1FBM A;  3WU2 H;  1FZA A;  2D2C B;  3L4F A;  4UB6 E;  3M91 A;  3PP5 A;  3L70 G;  3IR9 A;  1DX7 A;  5KLI C;  1KB9 H;  2VRS A;  1JCD A;  3AEG C;  4EOT A;  3AEB D;  2IX7 C;  3HUS B;  5CHX A;  3JCU E;  1PP9 J;  3OJA B;  3SFD D;  1JY3 O;  5AVX B;  3CXH I;  1HTL C;  2CPS A;  1IFP A;  1BGY D;  1SQX E;  5TIS H;  2FXP A;  1G2C A;  1BGY G;  1OW7 A;  3AEG D;  2PAJ A;  3VRB D;  1FE6 A;  3CWB J;  1Q81 Q;  2WSS H;  1IFN A;  4Y99 C;  1LP1 A;  1NAY A;  2QJP C;  5B5E E;  2OYH B;  1YBK A;  4H0L B;  3VP9 A;  1BDC A;  4C7N A;  3B5N C;  3C9I A;  1VF5 C;  4M3L A;  2B87 A;  3VRB C;  2H88 D;  1SQX J;  2YMY A;  1NTK K;  3L35 A;  1K9M Q;  2ZYA A;  1URQ D;  3Q5P A;  1L0L D;  5AW9 B;  3F5H A;  1SQV D;  3CIR D;  2N1T C;  3B5N D;  1NTZ G;  1KQF B;  1M8O B;  4JBZ A;  1X79 B;  3RBX A;  3VP8 A;  1KMI Z;  4Y99 B;  3RL0 g;  1FU1 A;  1NTK E;  1ZN5 A;  1U57 A;  5BU5 A;  1SQP K;  2N1T D;  1K04 A;  1RE3 A;  1KF6 C;  2KNC B;  1YIT P;  3AE9 C;  3P7K A;  1KV4 A;  1YIJ P;  4BRY B;  1NU1 K;  1ZRT E;  1EZV E;  2M8R A;  4U3F G;  1USE A;  1OX3 A;  1W2E A;  4PJ0 E;  3H1K G;  1PGJ A;  2RMZ A;  5AVZ B;  3A0H H;  3CX5 H;  3AE4 D;  3L74 D;  1S9K D;  2M5A A;  3GHG C;  2FKW B;  2R5D A;  1RF0 C;  1PIX A;  2QJY C;  1FJK A;  3L71 G;  4RJT A;  1S5L X;  1KTM A;  4HJG H;  2FXO A;  1JEK A;  2JWD A;  2QM7 A;  3H1H E;  3KXD A;  2A45 H;  1NTK J;  4KJM A;  1JNM A;  1SQB G;  2KS1 B;  1KZU B;  2BEQ D;  3D70 A;  1SQQ G;  4JYB A;  2QA4 P;  3AE6 D;  3S4R A;  1HVV A;  2P58 A;  3HD7 A;  2W27 A;  2Y9Y A;  3MHV A;  3L73 J;  1KFY D;  4TLF A;  2H43 A;  3L36 A;  4DT0 A;  1XTG B;  3Q1M A;  2QJY B;  2Q7C A;  2WPV B;  5KLV K;  1DIP A;  2WPQ A;  3H1J E;  1VQK P;  2I8D A;  4OGQ D;  3CCV P;  5H2F E;  1SQB J;  2ZXE B;  3CWB E;  4D6T G;  1NTK G;  1NYH A;  4JPZ B;  3A0H E;  1H8A A;  1EC5 A;  2E43 A;  4IFF A;  3VR9 C;  2FFD C;  3ABV D;  1BCC D;  1NH4 A;  4YTN C;  1N7S C;  3P4P C;  2ZAE B;  2E75 D;  1FAV A;  2ZVO B;  2O01 J;  3U1C A;  5GTH H;  2WS3 D;  2IFM A;  1GK6 A;  1LTS C; 
#chains in the Genus database with same CATH homology
 2E74 D;  3RK3 E;  2FBW C;  3D6Y A;  1VL2 A;  1NEK D;  2WU2 D;  3ABV C;  3AE4 D;  3Q2Y A;  4YTN D;  3O6Q A;  1OW8 A;  1YQ4 C;  4YSY D;  4I7Z C;  3D71 A;  3GF7 A;  4YSZ C;  2QJK C;  1Y9B A;  1QLB C;  3AE9 D;  4YXD D;  2ZT9 C;  1ZP0 C;  2FXP A;  1PIX A;  2QJY C;  1OW7 A;  2ACZ C;  1UIX A;  1ZOY C;  2B76 C;  4XFJ A;  3AEG D;  4YSX C;  3VRB D;  3AEB C;  3LW5 J;  5C2T D;  1S5L X;  2H88 C;  2MKV A;  3AE6 C;  4Z1M H;  3H25 A;  1KTM A;  2WS3 C;  4I7Z B;  3SFE C;  2WDV C;  1YQ3 C;  2E74 C;  2BEZ F;  3AEE C;  4RKU J;  1NEK C;  2OQQ A;  2FBW D;  2WU2 C;  3T97 B;  2QJP C;  3VRA C;  2G8Y A;  4H0L B;  1OMI A;  2P10 A;  2BS3 C;  2QSI A;  3AED C;  1HJ0 A;  3GMA A;  4YXD C;  3VR8 D;  3GLM A;  1ZP0 D;  2E75 B;  1VF5 C;  2BEQ D;  4Y28 J;  4IL6 X;  3D70 A;  1DD4 A;  2ACZ D;  3Q5R A;  2BS2 C;  4KX6 C;  2YIU C;  3VRB C;  3AEC D;  2BS4 C;  3AE7 C;  4PV1 C;  4R4M A;  2H88 D;  2IDB A;  3AE6 D;  2WP9 C;  4H13 B;  3AEF C;  4R4L A;  2NZ2 A;  2WDR C;  3SFE D;  3D6Z A;  2WU5 D;  1S1C X;  3AEE D;  3AE5 C;  1KFY D;  4H13 C;  3S9O A;  2WSC J;  1OW6 A;  3VRA D;  2E76 D;  4H0L C;  4KT0 J;  3Q5P A;  3AE8 D;  3P4S D;  1KIL E;  1E7P C;  5C3J C;  3AED D;  3Q5S A;  2WDQ C;  3CIR D;  1PV3 A;  2H89 C;  3Q1M A;  3B71 A;  3VR8 C;  3VR9 D;  2E74 B;  1VF5 D;  1DD3 A;  2E76 B;  2G3A A;  4YT0 D;  2ZT9 B;  4KX6 D;  3GF3 A;  2WDV D;  2WPV B;  1NEN D;  1KQF B;  3AEC C;  1KF6 D;  4PV1 D;  1DIP A;  1KOR A;  3AE7 D;  3P4P D;  2K9Y A;  2JP3 A;  3AE1 C;  3AEA C;  2WP9 D;  1R8E A;  3P4R D;  2WQY C;  3AE2 D;  2JO1 A;  1Q90 D;  3AEF D;  4YTM C;  4H44 B;  2E75 C;  3Q3D A;  4U7J A;  1TU3 F;  3FGA D;  1KQG B;  4OGQ D;  2WDR D;  2WU5 C;  4YTP D;  2V7Q J;  1KMI Z;  3P4Q D;  1L0V C;  4TT3 H;  1ZME C;  3RL0 g;  2YMK A;  2D2C D;  4H44 C;  1AJY A;  1KFY C;  4H13 D;  1HF9 A;  2QIW A;  3AE5 D;  2E76 C;  3AE8 C;  4H0L D;  1U57 A;  3SFD C;  5L8R J;  1EXJ A;  3P4S C;  5C3J D;  1RQV A;  3C8V A;  1NYH A;  5KKZ C;  3G9R A;  2WDQ D;  3AE3 D;  3CIR C;  1K05 A;  2D2C B;  1K04 A;  4OGQ B;  1NGM B;  1EXI A;  2H89 D;  3VR9 C;  3AE4 C;  3ABV D;  4YT0 C;  1NEN C;  5M1B A;  4YTN C;  4YSY C;  1KF6 C;  1YQ4 D;  2FYN C;  1GMJ A;  1JB0 J;  1RQU A;  3P4P C;  3AEA D;  3AE1 D;  3P4R C;  4YSZ D;  1VF5 B;  3AE2 C;  3EWK A;  5KLI C;  3AE9 C;  2WQY D;  2ZT9 D;  1MKM A;  4YTM D;  2E75 D;  4OGQ C;  3R4Y A;  2B76 D;  4YTP C;  4GDO A;  3AEG C;  1ZOY D;  4YSX D;  4PV1 B;  1L0V D;  3P4Q C;  1WMK A;  3AEB D;  5C2T C;  1ZRT E;  2D2C C;  3IN6 A;  4H44 D;  2J5U A;  2O01 J;  1PL5 A;  1FDI A;  3SFD D;  3IAO A;  2WS3 D;  1IK7 A;  2WSF J;  2WSE J;  3AE3 C;  1YQ3 D;  1FDO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...