3AE2C

Crystal structure of porcine heart mitochondrial complex ii bound with 2-hydroxy-n-phenyl-benzamide
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of porcine heart mitochondrial complex II bound with 2-Hydroxy-N-phenyl-benzamide
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
total genus 47
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3ae2C01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3ae2C02
3P4SD 3S9OA 3AEBD 3CIRC 1YQ3D 4YSXC 1KF6C 3P4RC 4KX6D 5C2TC 3AEED 3AE6C 1KF6D 3VRBC 3AEAC 1YQ3C 2H89C 4YXDC 1L0VC 3AE7D 3P4RD 1K04A 5C2TD 3SFEC 3VR9C 2WDRD 4YSYC 2WDRC 2H88D 1ZOYD 3AE3C 2WP9C 5C3JC 2G3AA 2ACZC 3AE9D 4YT0D 1NEND 3VR8C 4YT0C 1E7PC 3VRAC 5C3JD 2WQYD 2FBWD 2WU5C 3P4PD 3AE2C 3ABVC 1ZP0D 3AEFD 3P4QD 2WQYC 4YSZD 3AEFC 3P4QC 2FBWC 2WU5D 3AEGD 3SFDD 4YTMC 3AE2D 2WU2D 3AEDC 2B76D 1YQ4D 2B76C 4KX6C 1OW6A 3AE6D 1YQ4C 4YTMD 2BS3C 3P4SC 4YSXD 2BS2C 3AEDD 1QLBC 3AE8D 2WDVD 3SFED 1K05A 3AE8C 1KFYC 3AE1C 1OW8A 3AE5D 1L0VD 4YXDD 1KFYD 3AE5C 3AE1D 3VRBD 2WDVC 4YTPC 3AEEC 1NEKC 3AEAD 3VR9D 1NEKD 2H89D 3AE7C 4YTPD 1ZOYC 2WP9D 3VR8D 2WDQC 2BS4C 2H88C 2ACZD 3AE9C 3AE3D 4YSYD 4YTNC 1KTMA 1PV3A 2WDQD 4YTND 3AE4C 3VRAD 3P4PC 1OW7A 3AECC 1NENC 3B71A 3AECD 3AE4D 3AEGC 3SFDC 1ZP0C 3ABVD 2WS3D 3CIRD 2WU2C 4YSZC 2WS3C 3AEBC
chains in the Genus database with same CATH superfamily
3H1HE 2ITAA 4Y99B 1SQXK 4YPCA 1J1DC 1NH4A 4IFDK 4YSXC 1L4AC 2C0WA 3NXSA 2H43A 2PAJA 1KILE 1LTTC 3BCCG 3Q3DA 4PD4H 2KK7A 2XDJA 3TGUG 1IK7A 2V7QJ 1JOCA 2WITA 3L35A 2H7HA 2O1KA 3H1JE 2ZYGA 1FDIA 5GTIH 2GA1A 3PJSK 3HE5B 1OVVA 2E5YA 2E74C 3FXEA 1IFPA 2WT7B 3VRAC 2PFXA 1MUUA 4LDTA 4KHXA 2E75B 4WY4D 4ASWA 2D2CC 2O01J 4DCKA 2B76D 3RL0C 1SQVG 3H1LG 1J2JB 4D6TD 1GZLA 1GU4A 1CW5A 1IJDB 1PP9G 4BWNA 1X9VA 5AVQB 5KLIC 4OWFA 3AE8C 1ZR4A 1H0TB 5AW1B 2P10A 2WPQA 1L0NE 3AEAD 1ZOYC 3OJAB 3VR8D 2WDQC 1YYCA 2CK3H 1HJ0A 1SQQG 3S4RA 3VRAD 1OW7A 2HG5D 3W67A 1N7LA 3Q2YA 2ZAEB 2E76D 3MZWB 1SQQE 2YMKA 3A2AA 2KZIA 1NTZE 5AW8B 3P8MC 1UIIA 2B89A 4MN4C 2A06D 1P84D 1LT9A 3R2PA 4DDIA 2N9BA 1BE3J 1GK6A 1KILD 1KFMA 3M91A 2WDRD 1PFIA 1RF0A 1VL2A 3CX5I 1DIPA 1VQPP 4JPZB 1MZ9A 3H1HD 3AE9D 3A0BE 2QIWA 3H1IE 2W6AA 5B5EE 5AVWB 3P8CE 1KB9E 3K5BA 1IFNA 4U3FG 2BCCE 2WU5C 1AA0A 3HD7C 4XE5B 1NAFA 3HE4B 2WQYC 1QGKB 1FOSE 4UB8H 2Q7CA 1RF1C 2NZ2A 1NKNA 4DHIB 4Z1MH 3P4SC 4PD4E 1QLBC 3AE8D 1URQB 3KQGA 2NPSB 5H2FH 4BXLA 2KS1B 2JWDA 1PGJA 2ZFYA 3RK3E 2LKMA 1R5SA 2I1KA 1J1EB 2WP9D 3TDKA 2Q1KA 3A7OA 1KYOE 2Q3EA 1NU1E 3VONA 1KTMA 1ZR2A 3H1JJ 3IAOA 2ZXXA 3CLQA 4ZMDA 2RH0A 5TISE 3AEGC 4I2LC 1AQTA 2QRXA 4H44B 3P7KA 1ZP0C 2FYUD 1SQVJ 2WS3C 3AEBC 5AW0B 3S9OA 5GTIE 4HH2A 1WMKA 1E5WA 2KSEA 3CXHD 3SFEC 3FGAD 4KT0J 1BCCE 4C46A 1JY3N 3L71J 1PGPA 2Q9IA 2C0XA 1HUCA 4WB4A 2PGDA 3L70J 1GW3A 3L73J 1URQD 4IOIH 1KILA 3AEGD 1FZCB 2KOGA 2K1AA 3AE2D 2B87B 3AEDC 2IZ0A 3CCJP 1VQ6P 3CC4P 1OX3A 5AW7B 1QVGO 5APTA 2YKQA 1LT9C 3PTZA 1YJNP 1EDLA 2YMYA 3FWNA 1NHLA 4K3AA 3SWYA 2H88C 1JY3O 5AW2B 1RHZB 4L76A 3H32B 1OVUA 5AVVB 1N2DC 3HUSA 1S5LH 3I55P 4R4MA 1HVVA 5K5GB 1BCCG 4XA4A 2WU2C 3RL0g 2HR3A 1MFTA 5CCHC 1FS0E 4EOTA 3V5BA 4KX6D 1KF6D 1L4AA 2B87A 2QJYC 1L0ND 2PP6A 4C7NA 1LTAC 2GUVA 2AEFA 1VF5C 5KAIE 3QWOC 2RN0A 1JEKA 4ASVA 1OMIA 4YT0C 1OXZA 3H1IJ 5B5EH 2FYUE 2L5GB 2BCCD 1DX7A 1PPJD 2HPCB 1BE3E 1FZFA 3RK2D 1VQ9P 4YTMC 2M5AB 1NVOA 3BCCE 5L8RJ 4DT0A 1IK9A 1NU1K 3AE6D 2M0BA 2HLOA 2XKMA 1RQVA 2M5AA 3M06A 2WDVC 3U1AA 1PP9E 1VQ5P 3CD6P 5AVZB 4BRYA 2XU6A 1X8YA 2BS4C 3O8ZA 1GTWA 3AE3D 1LGHB 4YTNC 4Y99C 2YIUB 2Y0DA 2QA4P 4WY4C 5KKZB 4EI2A 1LTSC 4NPFX 2P7JA 3AECD 2JO1A 1L0LG 3IFMA 3SFDC 4TLFA 4IL6X 3VMZA 1FZCA 2FXPA 3V2NA 2XZRA 1NTMD 3TNUB 3H1LD 1FZGA 4L75A 1DEBA 3AEAC 4GOFA 1SQBJ 3CWBE 5APVA 5C2TD 1AV1A 3GHGA 2OYHB 2W27A 2WSCH 5CCHA 1DEEG 2O3JA 2Z4EA 1AQ5A 1BGYE 2K37A 3RK2B 5KLVK 4H44D 3O6QA 4OGQB 2G3AA 1N7SD 4NPDA 1BSNA 1M7LA 1MV8A 1KB9H 2BCCJ 1LP1A 3C8VA 2QG4A 3AE2C 5C39A 1M1JB 1LWUA 3AEFC 1T6AA 3SFDD 2IPPA 1VQNP 5CJ4A 2R5DA 1SFCD 5EFWB 2KUBA 1RY3A 2OARA 2N1TD 3L71E 1BDCA 1IFJA 3AE1D 2IZ1A 4I1LA 3VRBD 3VYIA 5KLVE 1SQBD 2WPRA 2L91A 4UB6E 4PD4I 4YSYD 2OYHA 3HD7A 4PJ0H 3H1KD 3P4PC 1YTZI 3B71A 5AVSB 2NRGA 1R5LA 3L74E 1HJBA 2W8ZA 3OA7A 5CBOA 1A02F 2P58A 1KV4A 3H1JD 2QJPB 3HE5A 3V2RA 3P4RC 1X79B 1EC5A 2FFDB 5KJ7C 3KHUA 1FE6A 3PLNA 1H88A 1IFMA 3VR9C 2IBZG 4HYTB 5TJHA 1FAVA 2LXBA 1S4XA 5GTHE 3VTPC 3FX0A 1SFCB 5TISH 2WTYA 1E7PC 1L0LJ 3RK3B 2QEXP 1PPJE 4DJGA 2WQYD 2WSEJ 4A7PA 1ZP0D 1AJYA 1XTCC 1YTZT 5AVXB 3TNUA 4H13C 1OVRA 3H1LJ 1NTKE 3H25A 4HB1A 1AFOA 2BS2C 3V2PA 1K05A 4JF7A 1L0VD 1PP9D 1HH0A 2IX7C 2IBZI 5GTHH 1P84H 1G1IA 2R3SA 3VR9D 3JSVC 3CCRP 1VQOP 1L0NK 2J58A 1NOHA 2C9NY 3CX5D 3L72G 1X0TA 3L75E 2W6BA 1LWUC 2OTLP 2FXMA 2ZT9B 2KLUA 5E79H 2XV5A 3CCEP 3GF3A 3MIWA 1QLED 1T3UA 1P84E 4N6JA 2W6JH 1LNQA 2M3EA 1JO5A 1BCCJ 2J5UA 2KS1A 4PJ0E 1IC2A 3I56P 1EZVD 2YKPA 3TGUJ 5AW4B 1L4AB 3H1IG 1KYOD 5C3JD 2OYIA 2GM4A 1LT9B 1KYOH 1M8OB 3BVHA 1IFDA 1ZXGA 4OVNF 2XNXA 5AVUB 3SSUA 1YQ4C 4DDGA 2AXTE 2WWWA 1N7SB 4KJMA 1KFYC 3NTNA 2JP3A 2D2CB 2BASA 5CJ0A 3S1KA 4RO0A 2WSEH 1VQ8P 1SLQA 1GMJA 3L36A 3C1LA 2IYPA 1NENC 1X22A 1KILB 2FYUK 3I5CA 2QM7A 2YO3A 3B5NC 3M9HA 1U57A 1SQXD 3Q5PA 3LW5H 2AEJA 2Y0CA 1HGVA 5APYA 3GMAA 1RF0C 1M1JA 4DZOA 3L71G 4I6MC 3CIRC 1UIXA 1DD3A 2JR8A 3ITKA 1PIXA 1JCCA 4UB6H 1YQ3C 1BDDA 3WUVA 3PRJA 1NTKD 1Q86Q 1NTZG 1W2EA 3CL3D 4W80A 3KPEA 3L75J 2Y9ZA 4HKZH 1FBMA 2NPSD 2WVRA 5AW5B 4C7NB 3VOPA 2FBWD 2K9JB 3CWBJ 1D7MA 3AEFD 3B4SA 2D2CD 2WU5D 2E76C 4AYCA 1PZQA 4XFJA 1XTGB 3CWBG 1LTIC 1S1CX 3CX5E 1YQ4D 2B76C 5BU5A 3L70D 4YTMD 1S9KD 1N73A 3M0DC 2V7QH 3HE4A 1W5CE 3P32A 4WY4B 3HD7B 3AE5D 3EFGA 4YXDD 3VMYA 2HODB 1USEA 1L0LE 1RE3C 3G71P 4BRYB 2H89D 2M8RA 1OFCX 1N8RQ 2Z5IA 2VRSA 1S5LX 2AXTH 1NU1D 2R3CA 1RE4C 1H0TA 3AE4C 1SQBK 3H1KE 2WSFJ 5AW9B 3CPWO 3B5NA 1J1EC 1EZVE 3N7NA 4O9BA 4IL6H 3F5HA 4IL6E 3RK2C 2JKVA 2WMMA 2HPCA 3AE6C 4H0LD 1N73C 4YXDC 1FU1A 1K04A 3CCUP 1VQ4P 1M1JC 2KP8A 2WDRC 1JMBA 3BASA 5AVRB 1TFFA 4IFFA 1OZHA 3JC22 1E79H 1SQQD 3CCLP 1RE4A 1Y47A 1YIJP 5AW6B 1PPJG 4WBAA 1PP9J 2JWAA 4RESB 1NTMK 2B9BA 4U7JA 3AEDD 2G8YA 1NWQA 1LTJB 2DW3A 3D70A 2KNCA 3BCCD 2KIKA 1FZEA 1KD1Q 4L74A 3TGUD 3RBXA 3CCSP 1LTJA 3II6A 3AE9C 2FYNC 1HF9A 1G2CA 2QJKB 2QJPC 4WWIA 5CBNA 2FFDC 2Y0EA 1KB9D 3WUTA 2WPVB 3MGNA 1SQBE 2CPSA 2O01N 4H0LB 1Q7YQ 2WZ7A 3SWKA 2FKWB 4PV1C 1SQVD 1SS1A 1YBKA 1BCCD 1VQMP 3P4SD 3W68A 3CCQP 1IFIA 4W7ZA 1SFCC 2UWJE 4D6TJ 3AEED 3CC2P 2A45G 2I1JA 2I8DA 2IYOA 2BEQD 2LR2A 3RK3C 3MTUE 2ZFCA 1GL2B 3L70E 2QE7H 2WSFH 1YI2P 2QSIA 2WSSH 4H13B 3CX5H 3L74D 1EXJA 1M90Q 4I7ZB 1BGYD 2Q3IA 2POHA 3RGUA 4LC1A 1HWTC 3P4QD 3D6ZA 1VF5B 3Q5SA 4OH8B 5KLVD 3HUSB 3LIDA 1Y9BA 3FXDA 3H32A 4CPGA 1VQ7P 3H1HJ 5BVZA 1L0NJ 1NTKK 3CXHE 3AE7C 4YTPD 1SQQK 3GHGB 2ZT9C 3H1HG 2OYIC 1ZLLA 1EXIA 3A3YB 1JB0J 2YXQB 2Y9YA 4U3FD 3R4YA 1FDOA 3H1ID 1ZW0A 2KZJA 3B5ND 1S5LE 4L73A 1Q82Q 1WT6A 4EDFA 3ABVD 1K73Q 3L73D 1NO4A 4NPEA 1IO4A 2RKLA 3H6PA 1FZAA 5KKZC 5KLVJ 4GOEA 5KJ7A 4LLHA 4TT3H 2E42A 5KJ7D 5AW3B 1A02J 2OQQA 2E75C 1DH3A 2WT7A 2K9JA 1BE3D 5BU8B 4YSYC 3MD0A 4JQ0D 5APQA 2H88D 3TYYA 3L75D 1CZQA 2WP9C 3RL0B 5C3JC 3MUDA 3VMAA 1JY2O 2N1TB 2KXPB 2V4HA 1N7SC 2OTJP 2KYVA 3L72E 1JNMA 2P1JA 2OYHC 1YJWP 1OIPA 3M0AA 5KAFH 2FYUG 1JUNA 3WUUA 4D6TG 3TK1A 5APXA 1QL1A 3A0BH 3L71D 5E79E 4W7YA 1VDFA 2J59M 4AUWA 3PHLA 1KILC 1NTZJ 3T97A 1JCDA 2E75D 3B5NB 1NEKD 1USDA 1JY2N 1SQBG 2E43A 1AVYA 3BRVB 3LIEA 1SQPG 1GK4A 5DJUB 4YTND 3GG2A 3V4WA 1SQPJ 1T2KC 4GT1A 3F89A 3USSA 2BCCG 1KZUB 5AVTB 2YXRB 5B66E 1ZRTD 1T8ZA 2FFDA 2YKOA 4JBZA 1KMIZ 2WS3D 3CIRD 4N3YB 1JTHA 2AXCA 3KZIH 4EIJA 1YQ3D 3A0HE 2B88A 3A0HH 2W90A 1H8AA 2K88A 1M56D 2YO2A 2OYOA 3P4RD 3A5TA 2E76B 1FJKA 2AEMA 3AE3C 3V6IA 4U3FJ 2BEZF 4I6LA 1PGOA 2NPSC 1H89A 1KQFB 4QMAA 3P4PD 1T2KD 1AVOA 3U59A 4YSZD 4FJVA 2GUSA 2ZVOB 1GL2D 5APSA 1KC8Q 3CCVP 1FJPA 1U7MA 1Q81Q 1YITP 4DHZA 4H13D 1NTMG 2FY8A 1BSHA 1SQVK 1P84I 1G2CB 3IN6A 1FC2C 1NEKC 2ZT9D 1QL2A 4ZKUA 3G3ZA 4H44C 1Q2NA 1VF5D 5DJTB 1GL2A 2MJZA 1EZVI 2KNCB 1OWAA 3H1KJ 4LGDE 3RBZA 3Q1MA 3AE4D 2JEEA 4JYCA 4YXWH 5CHXA 5CCGC 1SQXG 5AVYB 1FDMA 2KSJA 2A06G 1EDKA 3N4XA 3E1IA 3CMEP 3BATA 1SQXJ 5B66H 1K9MQ 2A06E 1VQKP 1L2PA 3L73E 1FZCC 1DD4A 1J1DB 2ACZC 4YT0D 3L74J 1NEND 2N9YB 5APWA 1EZVG 3MUDC 2FYUJ 1LTJC 3VP8A 2ZYAA 1W2BO 1QVFO 2WU2D 5KAIH 3KXDA 1EQ7A 3HRNA 4GDOA 1KQLA 3RK3D 3QH9A 1LTBC 2E74B 1JY2P 2FYNB 3RL0D 2KB7P 3G6EP 2A45I 2M3BA 3PH0A 3L72J 1M57D 4HJGH 1NTME 4H0LC 2QM8A 1G1JA 5APUA 3MP7B 3G4SP 2KI7B 2K9YA 2FXOA 4B86A 3JCUE 3VP9A 1HTLC 5KLIB 1PV3A 2WDQD 1S3JA 2WSCJ 5H2FE 2Z5HA 4UB8E 1KN7A 1NTZK 1RE3A 1GW4A 2QJYB 1GDTA 1GU5A 2NPSA 1GL2C 1LP1B 1Z56A 5M1BA 3CCMP 1YHQP 1VPCA 2Q6QA 1SVFA 1NAYA 3O6QB 3CI9A 4DHJA 3EWKA 1M1KQ 5KLVG 1L0NG 4I7ZC 2H89C 3AE7D 1SQXE 1S9KE 2H8PD 2LXCB 4R4LA 2Q5UA 2P67A 4RJTA 1RF1A 2HYNA 1EDIA 3VN0A 1JM0A 3HUSC 2R5BA 3VR8C 3H1KG 3M9BA 1KYOI 3GW6A 2R32A 1RQUA 3ABVC 1L0LK 1FOSF 2ZVNB 2FBWC 3PP5A 1SP4A 1SQPE 3ZDMA 4EYYQ 3GHGC 1L4AD 1OW6A 2QVAA 4N78E 2OYIB 1NYHA 3L73G 2WDVD 2YIUC 5CCHD 3SFED 3AE1C 1OW8A 1KFYD 3M0DA 2IBZD 4YTPC 3AEEC 1QX8A 3VMXA 4GKGA 1RF1B 4C7RA 1WRGA 1BE3G 2ACZD 4WY4A 1CI6B 4DOJA 1URQC 1NU1G 2R44A 4JYBA 2FYZA 3HTKA 1T3JA 1L0LD 2MKVA 2IFMA 4ZKPA 2RMZA 4YSZC 1Y8AA 4OGQC 2N1TC 1JY3P 2HFED 3FWLA 3EQ2A 1KF6C 5C2TC 2E5TA 3E7KA 2W83C 3GF7A 1RH5B 3VRBC 4ZNCA 1L0VC 1JMMA 1NTKJ 1N86A 3U1CA 1U7JA 2OTKE 1Q90D 3L37A 3BCCJ 2K3RA 1GD2E 1IZNB 1ZV8A 2HODA 1KQGB 2YNYA 4U3FE 1S2EA 4N78D 2A45H 1K8AQ 3CXHH 4K35A 2ZXEB 3NMDA 3LW5J 4GIFA 1N73B 4RKUJ 3G9RA 4PV1D 3KZIE 3P4QC 2IBZE 3OAKA 1NGMB 4KX6C 1LT1A 3HTKB 3GLMA 2ZYDA 3TSIA 4OGQD 1SQPK 1MFZA 3WU2H 4AQRD 1PL5A 2WPSA 3AE5C 3T97B 3KYQA 4Y28J 1ZRTE 3E1RA 1NJIQ 1KFNA 1VQLP 1URQA 1TU3F 3KDPB 3NFQA 3HD7D 2E74D 1EDJA 1KQSO 3AECC 5KTBA 4M3LA 1LTGC 3WMM0 1SQQJ 5CMZA 3Q5RA 2CPBA 2SPZA 3C9IA 5CCGD 1BGYJ 1PGQA 3AEBD 2O01H 3L70G 3CXHI 1NTMJ 2N1TA 2ZJSE 2QJKC 5KAFE 2OGUA 2XNDH 2KLVA 3H1LE 3IR9A 4PD4D 5CCGA 3JCUH 1CI6A 4PV1B 3V4QA 3BRTB 1ZOYD 4IFMA 3OW2O 4D6TE 3L74G 3D71A 3L75G 3M9QA 1ZMEC 1S72P 3CC7P 1LJ2A 1BGYG 3L4FA 1HGZA 1KB9I 2JDIH 2IDBA 1NU1J 3TGUE 4GODA 3SWFA 3TF5A 1KORA 3V2QA 2BS3C 4YSXD 3CMAP 2PRRA 2P2UA 3IF4A 1JTHB 3D6YA 1HBWA 2JJLA 1NTKG 1LWUB 1NKZB 1NTZD 1R8EA 3EFFK 2IFNA 1SQVE 1SFCA 1ZN5A 2O1JA 3MHVA 1YJ9P 3UIAA 3L72D 3WU2E 1SQPD 4WVZA 1FZBA 3B8EB 2C9LY 1MKMA 3CWBD 1N7SA 1CSBA 3P8CD 3H1JG 1QEXA
chains in the Genus database with same CATH topology
3P4SD 3S9OA 3AEBD 3GF3A 4OGQC 3CIRC 1UIXA 1YQ3D 2QJKC 5KKZC 4YSXC 1DD3A 1KF6C 3P4RC 4KX6D 5C2TC 1PIXA 3EWKA 3AE6C 1WMKA 3AEED 1KF6D 4I7ZC 2BEQD 3GF7A 3VRBC 3AEAC 4H0LD 4TT3H 1KILE 1YQ3C 2QJYC 2H89C 4YXDC 1L0VC 3AE7D 3Q3DA 3P4RD 1K04A 2OQQA 2E75C 3SFEC 5C2TD 3VR9C 3FGAD 4KT0J 4R4LA 1IK7A 2V7QJ 4PV1B 1Q90D 2J5UA 2WDRD 4YSYC 2E76B 1VL2A 2H88D 2WDRC 1VF5C 2QSIA 1DIPA 4H44D 3AE3C 1ZOYD 2WP9C 4H13B 3O6QA 5C3JC 1KQGB 1FDIA 4OGQB 1DD4A 2G3AA 2ACZC 3AE9D 4YT0D 2BEZF 1EXJA 1NEND 3VR8C 3D71A 1OMIA 2QIWA 4YT0C 2E74C 1E7PC 1ZMEC 3VRAC 5C3JD 4I7ZB 3LW5J 2WQYD 2FBWD 4RKUJ 3C8VA 1KQFB 2WU5C 2WSEJ 3G9RA 3P4PD 2E75B 3AE2C 1RQUA 4PV1D 3ABVC 1ZP0D 2D2CC 2O01J 1AJYA 3AEFD 3P4QD 2IDBA 2WQYC 4YSZD 2D2CD 3AEFC 2FBWC 3D6ZA 2WU5D 3P4QC 2E76C 3AEGD 3SFDD 4XFJA 1VF5B 3AE2D 4YTMC 3Q5SA 1KORA 2WU2D 2NZ2A 1S1CX 3AEDC 2B76D 4H13C 1NGMB 1YQ4D 2B76C 5L8RJ 2WS3C 4KX6C 1OW6A 4U7JA 3AE6D 3H25A 1YQ4C 4Z1MH 4GDOA 4YTMD 3GLMA 2BS3C 3P4SC 3RL0g 4YSXD 2E74B 1NYHA 1QLBC 2BS2C 4H13D 3AEDD 2G8YA 4OGQD 3AE8D 2WDVD 5KLIC 2YIUC 3D6YA 1K05A 3AE8C 1KFYC 3D70A 3SFED 1RQVA 1Y9BA 1OW8A 2JP3A 1PL5A 3AE1C 3IN6A 1KFYD 1L0VD 3AE5D 4YXDD 3AE5C 3AE1D 2D2CB 3VRBD 2P10A 2WDVC 4YTPC 3T97B 4Y28J 3AEEC 1R8EA 3RK3E 1NEKC 2ZT9D 2E75D 1ZRTE 4H0LC 3AEAD 3VR9D 1NEKD 2H89D 3AE7C 4YTPD 1ZOYC 4H44C 2WP9D 3VR8D 2K9YA 2ZT9C 2H88C 2BS4C 2WDQC 1VF5D 3AE9C 2ACZD 1EXIA 1GMJA 1JB0J 2FYNC 3AE3D 4YSYD 1TU3F 1S5LX 1HF9A 4YTNC 1HJ0A 1KTMA 1PV3A 2WDQD 2WSCJ 4YTND 2QJPC 3AE4C 2E74D 3VRAD 3P4PC 1OW7A 2WSFJ 3AECC 3R4YA 1FDOA 1NENC 3B71A 3IAOA 3Q1MA 3AECD 3Q2YA 2WPVB 2JO1A 2MKVA 3AE4D 4H0LB 2E76D 3AEGC 4R4MA 3SFDC 1MKMA 1U57A 3Q5RA 4H44B 3Q5PA 4IL6X 4PV1C 1ZP0C 2ZT9B 1KMIZ 5M1BA 2WS3D 3ABVD 3CIRD 2YMKA 2WU2C 4YSZC 3GMAA 2FXPA 3AEBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P4S D;  3S9O A;  3AEB D;  3CIR C;  1YQ3 D;  4YSX C;  1KF6 C;  3P4R C;  4KX6 D;  5C2T C;  3AEE D;  3AE6 C;  1KF6 D;  3VRB C;  3AEA C;  1YQ3 C;  2H89 C;  4YXD C;  1L0V C;  3AE7 D;  3P4R D;  1K04 A;  5C2T D;  3SFE C;  3VR9 C;  2WDR D;  4YSY C;  2WDR C;  2H88 D;  1ZOY D;  3AE3 C;  2WP9 C;  5C3J C;  2G3A A;  2ACZ C;  3AE9 D;  4YT0 D;  1NEN D;  3VR8 C;  4YT0 C;  1E7P C;  3VRA C;  5C3J D;  2WQY D;  2FBW D;  2WU5 C;  3P4P D;  3AE2 C;  3ABV C;  1ZP0 D;  3AEF D;  3P4Q D;  2WQY C;  4YSZ D;  3AEF C;  3P4Q C;  2FBW C;  2WU5 D;  3AEG D;  3SFD D;  4YTM C;  3AE2 D;  2WU2 D;  3AED C;  2B76 D;  1YQ4 D;  2B76 C;  4KX6 C;  1OW6 A;  3AE6 D;  1YQ4 C;  4YTM D;  2BS3 C;  3P4S C;  4YSX D;  2BS2 C;  3AED D;  1QLB C;  3AE8 D;  2WDV D;  3SFE D;  1K05 A;  3AE8 C;  1KFY C;  3AE1 C;  1OW8 A;  3AE5 D;  1L0V D;  4YXD D;  1KFY D;  3AE5 C;  3AE1 D;  3VRB D;  2WDV C;  4YTP C;  3AEE C;  1NEK C;  3AEA D;  3VR9 D;  1NEK D;  2H89 D;  3AE7 C;  4YTP D;  1ZOY C;  2WP9 D;  3VR8 D;  2WDQ C;  2BS4 C;  2H88 C;  2ACZ D;  3AE9 C;  3AE3 D;  4YSY D;  4YTN C;  1KTM A;  1PV3 A;  2WDQ D;  4YTN D;  3AE4 C;  3VRA D;  3P4P C;  1OW7 A;  3AEC C;  1NEN C;  3B71 A;  3AEC D;  3AE4 D;  3AEG C;  3SFD C;  1ZP0 C;  3ABV D;  2WS3 D;  3CIR D;  2WU2 C;  4YSZ C;  2WS3 C;  3AEB C; 
#chains in the Genus database with same CATH topology
 3H1H E;  2ITA A;  4Y99 B;  1SQX K;  4YPC A;  1J1D C;  1NH4 A;  4IFD K;  4YSX C;  1L4A C;  2C0W A;  3NXS A;  2H43 A;  2PAJ A;  1KIL E;  1LTT C;  3BCC G;  3Q3D A;  4PD4 H;  2KK7 A;  2XDJ A;  3TGU G;  1IK7 A;  2V7Q J;  1JOC A;  2WIT A;  3L35 A;  2H7H A;  2O1K A;  3H1J E;  2ZYG A;  1FDI A;  5GTI H;  2GA1 A;  3PJS K;  3HE5 B;  1OVV A;  2E5Y A;  2E74 C;  3FXE A;  1IFP A;  2WT7 B;  3VRA C;  2PFX A;  1MUU A;  4LDT A;  4KHX A;  2E75 B;  4WY4 D;  4ASW A;  2D2C C;  2O01 J;  4DCK A;  2B76 D;  3RL0 C;  1SQV G;  3H1L G;  1J2J B;  4D6T D;  1GZL A;  1GU4 A;  1CW5 A;  1IJD B;  1PP9 G;  4BWN A;  1X9V A;  5AVQ B;  5KLI C;  4OWF A;  3AE8 C;  1ZR4 A;  1H0T B;  5AW1 B;  2P10 A;  2WPQ A;  1L0N E;  3AEA D;  1ZOY C;  3OJA B;  3VR8 D;  2WDQ C;  1YYC A;  2CK3 H;  1HJ0 A;  1SQQ G;  3S4R A;  3VRA D;  1OW7 A;  2HG5 D;  3W67 A;  1N7L A;  3Q2Y A;  2ZAE B;  2E76 D;  3MZW B;  1SQQ E;  2YMK A;  3A2A A;  2KZI A;  1NTZ E;  5AW8 B;  3P8M C;  1UII A;  2B89 A;  4MN4 C;  2A06 D;  1P84 D;  1LT9 A;  3R2P A;  4DDI A;  2N9B A;  1BE3 J;  1GK6 A;  1KIL D;  1KFM A;  3M91 A;  2WDR D;  1PFI A;  1RF0 A;  1VL2 A;  3CX5 I;  1DIP A;  1VQP P;  4JPZ B;  1MZ9 A;  3H1H D;  3AE9 D;  3A0B E;  2QIW A;  3H1I E;  2W6A A;  5B5E E;  5AVW B;  3P8C E;  1KB9 E;  3K5B A;  1IFN A;  4U3F G;  2BCC E;  2WU5 C;  1AA0 A;  3HD7 C;  4XE5 B;  1NAF A;  3HE4 B;  2WQY C;  1QGK B;  1FOS E;  4UB8 H;  2Q7C A;  1RF1 C;  2NZ2 A;  1NKN A;  4DHI B;  4Z1M H;  3P4S C;  4PD4 E;  1QLB C;  3AE8 D;  1URQ B;  3KQG A;  2NPS B;  5H2F H;  4BXL A;  2KS1 B;  2JWD A;  1PGJ A;  2ZFY A;  3RK3 E;  2LKM A;  1R5S A;  2I1K A;  1J1E B;  2WP9 D;  3TDK A;  2Q1K A;  3A7O A;  1KYO E;  2Q3E A;  1NU1 E;  3VON A;  1KTM A;  1ZR2 A;  3H1J J;  3IAO A;  2ZXX A;  3CLQ A;  4ZMD A;  2RH0 A;  5TIS E;  3AEG C;  4I2L C;  1AQT A;  2QRX A;  4H44 B;  3P7K A;  1ZP0 C;  2FYU D;  1SQV J;  2WS3 C;  3AEB C;  5AW0 B;  3S9O A;  5GTI E;  4HH2 A;  1WMK A;  1E5W A;  2KSE A;  3CXH D;  3SFE C;  3FGA D;  4KT0 J;  1BCC E;  4C46 A;  1JY3 N;  3L71 J;  1PGP A;  2Q9I A;  2C0X A;  1HUC A;  4WB4 A;  2PGD A;  3L70 J;  1GW3 A;  3L73 J;  1URQ D;  4IOI H;  1KIL A;  3AEG D;  1FZC B;  2KOG A;  2K1A A;  3AE2 D;  2B87 B;  3AED C;  2IZ0 A;  3CCJ P;  1VQ6 P;  3CC4 P;  1OX3 A;  5AW7 B;  1QVG O;  5APT A;  2YKQ A;  1LT9 C;  3PTZ A;  1YJN P;  1EDL A;  2YMY A;  3FWN A;  1NHL A;  4K3A A;  3SWY A;  2H88 C;  1JY3 O;  5AW2 B;  1RHZ B;  4L76 A;  3H32 B;  1OVU A;  5AVV B;  1N2D C;  3HUS A;  1S5L H;  3I55 P;  4R4M A;  1HVV A;  5K5G B;  1BCC G;  4XA4 A;  2WU2 C;  3RL0 g;  2HR3 A;  1MFT A;  5CCH C;  1FS0 E;  4EOT A;  3V5B A;  4KX6 D;  1KF6 D;  1L4A A;  2B87 A;  2QJY C;  1L0N D;  2PP6 A;  4C7N A;  1LTA C;  2GUV A;  2AEF A;  1VF5 C;  5KAI E;  3QWO C;  2RN0 A;  1JEK A;  4ASV A;  1OMI A;  4YT0 C;  1OXZ A;  3H1I J;  5B5E H;  2FYU E;  2L5G B;  2BCC D;  1DX7 A;  1PPJ D;  2HPC B;  1BE3 E;  1FZF A;  3RK2 D;  1VQ9 P;  4YTM C;  2M5A B;  1NVO A;  3BCC E;  5L8R J;  4DT0 A;  1IK9 A;  1NU1 K;  3AE6 D;  2M0B A;  2HLO A;  2XKM A;  1RQV A;  2M5A A;  3M06 A;  2WDV C;  3U1A A;  1PP9 E;  1VQ5 P;  3CD6 P;  5AVZ B;  4BRY A;  2XU6 A;  1X8Y A;  2BS4 C;  3O8Z A;  1GTW A;  3AE3 D;  1LGH B;  4YTN C;  4Y99 C;  2YIU B;  2Y0D A;  2QA4 P;  4WY4 C;  5KKZ B;  4EI2 A;  1LTS C;  4NPF X;  2P7J A;  3AEC D;  2JO1 A;  1L0L G;  3IFM A;  3SFD C;  4TLF A;  4IL6 X;  3VMZ A;  1FZC A;  2FXP A;  3V2N A;  2XZR A;  1NTM D;  3TNU B;  3H1L D;  1FZG A;  4L75 A;  1DEB A;  3AEA C;  4GOF A;  1SQB J;  3CWB E;  5APV A;  5C2T D;  1AV1 A;  3GHG A;  2OYH B;  2W27 A;  2WSC H;  5CCH A;  1DEE G;  2O3J A;  2Z4E A;  1AQ5 A;  1BGY E;  2K37 A;  3RK2 B;  5KLV K;  4H44 D;  3O6Q A;  4OGQ B;  2G3A A;  1N7S D;  4NPD A;  1BSN A;  1M7L A;  1MV8 A;  1KB9 H;  2BCC J;  1LP1 A;  3C8V A;  2QG4 A;  3AE2 C;  5C39 A;  1M1J B;  1LWU A;  3AEF C;  1T6A A;  3SFD D;  2IPP A;  1VQN P;  5CJ4 A;  2R5D A;  1SFC D;  5EFW B;  2KUB A;  1RY3 A;  2OAR A;  2N1T D;  3L71 E;  1BDC A;  1IFJ A;  3AE1 D;  2IZ1 A;  4I1L A;  3VRB D;  3VYI A;  5KLV E;  1SQB D;  2WPR A;  2L91 A;  4UB6 E;  4PD4 I;  4YSY D;  2OYH A;  3HD7 A;  4PJ0 H;  3H1K D;  3P4P C;  1YTZ I;  3B71 A;  5AVS B;  2NRG A;  1R5L A;  3L74 E;  1HJB A;  2W8Z A;  3OA7 A;  5CBO A;  1A02 F;  2P58 A;  1KV4 A;  3H1J D;  2QJP B;  3HE5 A;  3V2R A;  3P4R C;  1X79 B;  1EC5 A;  2FFD B;  5KJ7 C;  3KHU A;  1FE6 A;  3PLN A;  1H88 A;  1IFM A;  3VR9 C;  2IBZ G;  4HYT B;  5TJH A;  1FAV A;  2LXB A;  1S4X A;  5GTH E;  3VTP C;  3FX0 A;  1SFC B;  5TIS H;  2WTY A;  1E7P C;  1L0L J;  3RK3 B;  2QEX P;  1PPJ E;  4DJG A;  2WQY D;  2WSE J;  4A7P A;  1ZP0 D;  1AJY A;  1XTC C;  1YTZ T;  5AVX B;  3TNU A;  4H13 C;  1OVR A;  3H1L J;  1NTK E;  3H25 A;  4HB1 A;  1AFO A;  2BS2 C;  3V2P A;  1K05 A;  4JF7 A;  1L0V D;  1PP9 D;  1HH0 A;  2IX7 C;  2IBZ I;  5GTH H;  1P84 H;  1G1I A;  2R3S A;  3VR9 D;  3JSV C;  3CCR P;  1VQO P;  1L0N K;  2J58 A;  1NOH A;  2C9N Y;  3CX5 D;  3L72 G;  1X0T A;  3L75 E;  2W6B A;  1LWU C;  2OTL P;  2FXM A;  2ZT9 B;  2KLU A;  5E79 H;  2XV5 A;  3CCE P;  3GF3 A;  3MIW A;  1QLE D;  1T3U A;  1P84 E;  4N6J A;  2W6J H;  1LNQ A;  2M3E A;  1JO5 A;  1BCC J;  2J5U A;  2KS1 A;  4PJ0 E;  1IC2 A;  3I56 P;  1EZV D;  2YKP A;  3TGU J;  5AW4 B;  1L4A B;  3H1I G;  1KYO D;  5C3J D;  2OYI A;  2GM4 A;  1LT9 B;  1KYO H;  1M8O B;  3BVH A;  1IFD A;  1ZXG A;  4OVN F;  2XNX A;  5AVU B;  3SSU A;  1YQ4 C;  4DDG A;  2AXT E;  2WWW A;  1N7S B;  4KJM A;  1KFY C;  3NTN A;  2JP3 A;  2D2C B;  2BAS A;  5CJ0 A;  3S1K A;  4RO0 A;  2WSE H;  1VQ8 P;  1SLQ A;  1GMJ A;  3L36 A;  3C1L A;  2IYP A;  1NEN C;  1X22 A;  1KIL B;  2FYU K;  3I5C A;  2QM7 A;  2YO3 A;  3B5N C;  3M9H A;  1U57 A;  1SQX D;  3Q5P A;  3LW5 H;  2AEJ A;  2Y0C A;  1HGV A;  5APY A;  3GMA A;  1RF0 C;  1M1J A;  4DZO A;  3L71 G;  4I6M C;  3CIR C;  1UIX A;  1DD3 A;  2JR8 A;  3ITK A;  1PIX A;  1JCC A;  4UB6 H;  1YQ3 C;  1BDD A;  3WUV A;  3PRJ A;  1NTK D;  1Q86 Q;  1NTZ G;  1W2E A;  3CL3 D;  4W80 A;  3KPE A;  3L75 J;  2Y9Z A;  4HKZ H;  1FBM A;  2NPS D;  2WVR A;  5AW5 B;  4C7N B;  3VOP A;  2FBW D;  2K9J B;  3CWB J;  1D7M A;  3AEF D;  3B4S A;  2D2C D;  2WU5 D;  2E76 C;  4AYC A;  1PZQ A;  4XFJ A;  1XTG B;  3CWB G;  1LTI C;  1S1C X;  3CX5 E;  1YQ4 D;  2B76 C;  5BU5 A;  3L70 D;  4YTM D;  1S9K D;  1N73 A;  3M0D C;  2V7Q H;  3HE4 A;  1W5C E;  3P32 A;  4WY4 B;  3HD7 B;  3AE5 D;  3EFG A;  4YXD D;  3VMY A;  2HOD B;  1USE A;  1L0L E;  1RE3 C;  3G71 P;  4BRY B;  2H89 D;  2M8R A;  1OFC X;  1N8R Q;  2Z5I A;  2VRS A;  1S5L X;  2AXT H;  1NU1 D;  2R3C A;  1RE4 C;  1H0T A;  3AE4 C;  1SQB K;  3H1K E;  2WSF J;  5AW9 B;  3CPW O;  3B5N A;  1J1E C;  1EZV E;  3N7N A;  4O9B A;  4IL6 H;  3F5H A;  4IL6 E;  3RK2 C;  2JKV A;  2WMM A;  2HPC A;  3AE6 C;  4H0L D;  1N73 C;  4YXD C;  1FU1 A;  1K04 A;  3CCU P;  1VQ4 P;  1M1J C;  2KP8 A;  2WDR C;  1JMB A;  3BAS A;  5AVR B;  1TFF A;  4IFF A;  1OZH A;  3JC2 2;  1E79 H;  1SQQ D;  3CCL P;  1RE4 A;  1Y47 A;  1YIJ P;  5AW6 B;  1PPJ G;  4WBA A;  1PP9 J;  2JWA A;  4RES B;  1NTM K;  2B9B A;  4U7J A;  3AED D;  2G8Y A;  1NWQ A;  1LTJ B;  2DW3 A;  3D70 A;  2KNC A;  3BCC D;  2KIK A;  1FZE A;  1KD1 Q;  4L74 A;  3TGU D;  3RBX A;  3CCS P;  1LTJ A;  3II6 A;  3AE9 C;  2FYN C;  1HF9 A;  1G2C A;  2QJK B;  2QJP C;  4WWI A;  5CBN A;  2FFD C;  2Y0E A;  1KB9 D;  3WUT A;  2WPV B;  3MGN A;  1SQB E;  2CPS A;  2O01 N;  4H0L B;  1Q7Y Q;  2WZ7 A;  3SWK A;  2FKW B;  4PV1 C;  1SQV D;  1SS1 A;  1YBK A;  1BCC D;  1VQM P;  3P4S D;  3W68 A;  3CCQ P;  1IFI A;  4W7Z A;  1SFC C;  2UWJ E;  4D6T J;  3AEE D;  3CC2 P;  2A45 G;  2I1J A;  2I8D A;  2IYO A;  2BEQ D;  2LR2 A;  3RK3 C;  3MTU E;  2ZFC A;  1GL2 B;  3L70 E;  2QE7 H;  2WSF H;  1YI2 P;  2QSI A;  2WSS H;  4H13 B;  3CX5 H;  3L74 D;  1EXJ A;  1M90 Q;  4I7Z B;  1BGY D;  2Q3I A;  2POH A;  3RGU A;  4LC1 A;  1HWT C;  3P4Q D;  3D6Z A;  1VF5 B;  3Q5S A;  4OH8 B;  5KLV D;  3HUS B;  3LID A;  1Y9B A;  3FXD A;  3H32 A;  4CPG A;  1VQ7 P;  3H1H J;  5BVZ A;  1L0N J;  1NTK K;  3CXH E;  3AE7 C;  4YTP D;  1SQQ K;  3GHG B;  2ZT9 C;  3H1H G;  2OYI C;  1ZLL A;  1EXI A;  3A3Y B;  1JB0 J;  2YXQ B;  2Y9Y A;  4U3F D;  3R4Y A;  1FDO A;  3H1I D;  1ZW0 A;  2KZJ A;  3B5N D;  1S5L E;  4L73 A;  1Q82 Q;  1WT6 A;  4EDF A;  3ABV D;  1K73 Q;  3L73 D;  1NO4 A;  4NPE A;  1IO4 A;  2RKL A;  3H6P A;  1FZA A;  5KKZ C;  5KLV J;  4GOE A;  5KJ7 A;  4LLH A;  4TT3 H;  2E42 A;  5KJ7 D;  5AW3 B;  1A02 J;  2OQQ A;  2E75 C;  1DH3 A;  2WT7 A;  2K9J A;  1BE3 D;  5BU8 B;  4YSY C;  3MD0 A;  4JQ0 D;  5APQ A;  2H88 D;  3TYY A;  3L75 D;  1CZQ A;  2WP9 C;  3RL0 B;  5C3J C;  3MUD A;  3VMA A;  1JY2 O;  2N1T B;  2KXP B;  2V4H A;  1N7S C;  2OTJ P;  2KYV A;  3L72 E;  1JNM A;  2P1J A;  2OYH C;  1YJW P;  1OIP A;  3M0A A;  5KAF H;  2FYU G;  1JUN A;  3WUU A;  4D6T G;  3TK1 A;  5APX A;  1QL1 A;  3A0B H;  3L71 D;  5E79 E;  4W7Y A;  1VDF A;  2J59 M;  4AUW A;  3PHL A;  1KIL C;  1NTZ J;  3T97 A;  1JCD A;  2E75 D;  3B5N B;  1NEK D;  1USD A;  1JY2 N;  1SQB G;  2E43 A;  1AVY A;  3BRV B;  3LIE A;  1SQP G;  1GK4 A;  5DJU B;  4YTN D;  3GG2 A;  3V4W A;  1SQP J;  1T2K C;  4GT1 A;  3F89 A;  3USS A;  2BCC G;  1KZU B;  5AVT B;  2YXR B;  5B66 E;  1ZRT D;  1T8Z A;  2FFD A;  2YKO A;  4JBZ A;  1KMI Z;  2WS3 D;  3CIR D;  4N3Y B;  1JTH A;  2AXC A;  3KZI H;  4EIJ A;  1YQ3 D;  3A0H E;  2B88 A;  3A0H H;  2W90 A;  1H8A A;  2K88 A;  1M56 D;  2YO2 A;  2OYO A;  3P4R D;  3A5T A;  2E76 B;  1FJK A;  2AEM A;  3AE3 C;  3V6I A;  4U3F J;  2BEZ F;  4I6L A;  1PGO A;  2NPS C;  1H89 A;  1KQF B;  4QMA A;  3P4P D;  1T2K D;  1AVO A;  3U59 A;  4YSZ D;  4FJV A;  2GUS A;  2ZVO B;  1GL2 D;  5APS A;  1KC8 Q;  3CCV P;  1FJP A;  1U7M A;  1Q81 Q;  1YIT P;  4DHZ A;  4H13 D;  1NTM G;  2FY8 A;  1BSH A;  1SQV K;  1P84 I;  1G2C B;  3IN6 A;  1FC2 C;  1NEK C;  2ZT9 D;  1QL2 A;  4ZKU A;  3G3Z A;  4H44 C;  1Q2N A;  1VF5 D;  5DJT B;  1GL2 A;  2MJZ A;  1EZV I;  2KNC B;  1OWA A;  3H1K J;  4LGD E;  3RBZ A;  3Q1M A;  3AE4 D;  2JEE A;  4JYC A;  4YXW H;  5CHX A;  5CCG C;  1SQX G;  5AVY B;  1FDM A;  2KSJ A;  2A06 G;  1EDK A;  3N4X A;  3E1I A;  3CME P;  3BAT A;  1SQX J;  5B66 H;  1K9M Q;  2A06 E;  1VQK P;  1L2P A;  3L73 E;  1FZC C;  1DD4 A;  1J1D B;  2ACZ C;  4YT0 D;  3L74 J;  1NEN D;  2N9Y B;  5APW A;  1EZV G;  3MUD C;  2FYU J;  1LTJ C;  3VP8 A;  2ZYA A;  1W2B O;  1QVF O;  2WU2 D;  5KAI H;  3KXD A;  1EQ7 A;  3HRN A;  4GDO A;  1KQL A;  3RK3 D;  3QH9 A;  1LTB C;  2E74 B;  1JY2 P;  2FYN B;  3RL0 D;  2KB7 P;  3G6E P;  2A45 I;  2M3B A;  3PH0 A;  3L72 J;  1M57 D;  4HJG H;  1NTM E;  4H0L C;  2QM8 A;  1G1J A;  5APU A;  3MP7 B;  3G4S P;  2KI7 B;  2K9Y A;  2FXO A;  4B86 A;  3JCU E;  3VP9 A;  1HTL C;  5KLI B;  1PV3 A;  2WDQ D;  1S3J A;  2WSC J;  5H2F E;  2Z5H A;  4UB8 E;  1KN7 A;  1NTZ K;  1RE3 A;  1GW4 A;  2QJY B;  1GDT A;  1GU5 A;  2NPS A;  1GL2 C;  1LP1 B;  1Z56 A;  5M1B A;  3CCM P;  1YHQ P;  1VPC A;  2Q6Q A;  1SVF A;  1NAY A;  3O6Q B;  3CI9 A;  4DHJ A;  3EWK A;  1M1K Q;  5KLV G;  1L0N G;  4I7Z C;  2H89 C;  3AE7 D;  1SQX E;  1S9K E;  2H8P D;  2LXC B;  4R4L A;  2Q5U A;  2P67 A;  4RJT A;  1RF1 A;  2HYN A;  1EDI A;  3VN0 A;  1JM0 A;  3HUS C;  2R5B A;  3VR8 C;  3H1K G;  3M9B A;  1KYO I;  3GW6 A;  2R32 A;  1RQU A;  3ABV C;  1L0L K;  1FOS F;  2ZVN B;  2FBW C;  3PP5 A;  1SP4 A;  1SQP E;  3ZDM A;  4EYY Q;  3GHG C;  1L4A D;  1OW6 A;  2QVA A;  4N78 E;  2OYI B;  1NYH A;  3L73 G;  2WDV D;  2YIU C;  5CCH D;  3SFE D;  3AE1 C;  1OW8 A;  1KFY D;  3M0D A;  2IBZ D;  4YTP C;  3AEE C;  1QX8 A;  3VMX A;  4GKG A;  1RF1 B;  4C7R A;  1WRG A;  1BE3 G;  2ACZ D;  4WY4 A;  1CI6 B;  4DOJ A;  1URQ C;  1NU1 G;  2R44 A;  4JYB A;  2FYZ A;  3HTK A;  1T3J A;  1L0L D;  2MKV A;  2IFM A;  4ZKP A;  2RMZ A;  4YSZ C;  1Y8A A;  4OGQ C;  2N1T C;  1JY3 P;  2HFE D;  3FWL A;  3EQ2 A;  1KF6 C;  5C2T C;  2E5T A;  3E7K A;  2W83 C;  3GF7 A;  1RH5 B;  3VRB C;  4ZNC A;  1L0V C;  1JMM A;  1NTK J;  1N86 A;  3U1C A;  1U7J A;  2OTK E;  1Q90 D;  3L37 A;  3BCC J;  2K3R A;  1GD2 E;  1IZN B;  1ZV8 A;  2HOD A;  1KQG B;  2YNY A;  4U3F E;  1S2E A;  4N78 D;  2A45 H;  1K8A Q;  3CXH H;  4K35 A;  2ZXE B;  3NMD A;  3LW5 J;  4GIF A;  1N73 B;  4RKU J;  3G9R A;  4PV1 D;  3KZI E;  3P4Q C;  2IBZ E;  3OAK A;  1NGM B;  4KX6 C;  1LT1 A;  3HTK B;  3GLM A;  2ZYD A;  3TSI A;  4OGQ D;  1SQP K;  1MFZ A;  3WU2 H;  4AQR D;  1PL5 A;  2WPS A;  3AE5 C;  3T97 B;  3KYQ A;  4Y28 J;  1ZRT E;  3E1R A;  1NJI Q;  1KFN A;  1VQL P;  1URQ A;  1TU3 F;  3KDP B;  3NFQ A;  3HD7 D;  2E74 D;  1EDJ A;  1KQS O;  3AEC C;  5KTB A;  4M3L A;  1LTG C;  3WMM 0;  1SQQ J;  5CMZ A;  3Q5R A;  2CPB A;  2SPZ A;  3C9I A;  5CCG D;  1BGY J;  1PGQ A;  3AEB D;  2O01 H;  3L70 G;  3CXH I;  1NTM J;  2N1T A;  2ZJS E;  2QJK C;  5KAF E;  2OGU A;  2XND H;  2KLV A;  3H1L E;  3IR9 A;  4PD4 D;  5CCG A;  3JCU H;  1CI6 A;  4PV1 B;  3V4Q A;  3BRT B;  1ZOY D;  4IFM A;  3OW2 O;  4D6T E;  3L74 G;  3D71 A;  3L75 G;  3M9Q A;  1ZME C;  1S72 P;  3CC7 P;  1LJ2 A;  1BGY G;  3L4F A;  1HGZ A;  1KB9 I;  2JDI H;  2IDB A;  1NU1 J;  3TGU E;  4GOD A;  3SWF A;  3TF5 A;  1KOR A;  3V2Q A;  2BS3 C;  4YSX D;  3CMA P;  2PRR A;  2P2U A;  3IF4 A;  1JTH B;  3D6Y A;  1HBW A;  2JJL A;  1NTK G;  1LWU B;  1NKZ B;  1NTZ D;  1R8E A;  3EFF K;  2IFN A;  1SQV E;  1SFC A;  1ZN5 A;  2O1J A;  3MHV A;  1YJ9 P;  3UIA A;  3L72 D;  3WU2 E;  1SQP D;  4WVZ A;  1FZB A;  3B8E B;  2C9L Y;  1MKM A;  3CWB D;  1N7S A;  1CSB A;  3P8C D;  3H1J G;  1QEX A; 
#chains in the Genus database with same CATH homology
 3P4S D;  3S9O A;  3AEB D;  3GF3 A;  4OGQ C;  3CIR C;  1UIX A;  1YQ3 D;  2QJK C;  5KKZ C;  4YSX C;  1DD3 A;  1KF6 C;  3P4R C;  4KX6 D;  5C2T C;  1PIX A;  3EWK A;  3AE6 C;  1WMK A;  3AEE D;  1KF6 D;  4I7Z C;  2BEQ D;  3GF7 A;  3VRB C;  3AEA C;  4H0L D;  4TT3 H;  1KIL E;  1YQ3 C;  2QJY C;  2H89 C;  4YXD C;  1L0V C;  3AE7 D;  3Q3D A;  3P4R D;  1K04 A;  2OQQ A;  2E75 C;  3SFE C;  5C2T D;  3VR9 C;  3FGA D;  4KT0 J;  4R4L A;  1IK7 A;  2V7Q J;  4PV1 B;  1Q90 D;  2J5U A;  2WDR D;  4YSY C;  2E76 B;  1VL2 A;  2H88 D;  2WDR C;  1VF5 C;  2QSI A;  1DIP A;  4H44 D;  3AE3 C;  1ZOY D;  2WP9 C;  4H13 B;  3O6Q A;  5C3J C;  1KQG B;  1FDI A;  4OGQ B;  1DD4 A;  2G3A A;  2ACZ C;  3AE9 D;  4YT0 D;  2BEZ F;  1EXJ A;  1NEN D;  3VR8 C;  3D71 A;  1OMI A;  2QIW A;  4YT0 C;  2E74 C;  1E7P C;  1ZME C;  3VRA C;  5C3J D;  4I7Z B;  3LW5 J;  2WQY D;  2FBW D;  4RKU J;  3C8V A;  1KQF B;  2WU5 C;  2WSE J;  3G9R A;  3P4P D;  2E75 B;  3AE2 C;  1RQU A;  4PV1 D;  3ABV C;  1ZP0 D;  2D2C C;  2O01 J;  1AJY A;  3AEF D;  3P4Q D;  2IDB A;  2WQY C;  4YSZ D;  2D2C D;  3AEF C;  2FBW C;  3D6Z A;  2WU5 D;  3P4Q C;  2E76 C;  3AEG D;  3SFD D;  4XFJ A;  1VF5 B;  3AE2 D;  4YTM C;  3Q5S A;  1KOR A;  2WU2 D;  2NZ2 A;  1S1C X;  3AED C;  2B76 D;  4H13 C;  1NGM B;  1YQ4 D;  2B76 C;  5L8R J;  2WS3 C;  4KX6 C;  1OW6 A;  4U7J A;  3AE6 D;  3H25 A;  1YQ4 C;  4Z1M H;  4GDO A;  4YTM D;  3GLM A;  2BS3 C;  3P4S C;  3RL0 g;  4YSX D;  2E74 B;  1NYH A;  1QLB C;  2BS2 C;  4H13 D;  3AED D;  2G8Y A;  4OGQ D;  3AE8 D;  2WDV D;  5KLI C;  2YIU C;  3D6Y A;  1K05 A;  3AE8 C;  1KFY C;  3D70 A;  3SFE D;  1RQV A;  1Y9B A;  1OW8 A;  2JP3 A;  1PL5 A;  3AE1 C;  3IN6 A;  1KFY D;  1L0V D;  3AE5 D;  4YXD D;  3AE5 C;  3AE1 D;  2D2C B;  3VRB D;  2P10 A;  2WDV C;  4YTP C;  3T97 B;  4Y28 J;  3AEE C;  1R8E A;  3RK3 E;  1NEK C;  2ZT9 D;  2E75 D;  1ZRT E;  4H0L C;  3AEA D;  3VR9 D;  1NEK D;  2H89 D;  3AE7 C;  4YTP D;  1ZOY C;  4H44 C;  2WP9 D;  3VR8 D;  2K9Y A;  2ZT9 C;  2H88 C;  2BS4 C;  2WDQ C;  1VF5 D;  3AE9 C;  2ACZ D;  1EXI A;  1GMJ A;  1JB0 J;  2FYN C;  3AE3 D;  4YSY D;  1TU3 F;  1S5L X;  1HF9 A;  4YTN C;  1HJ0 A;  1KTM A;  1PV3 A;  2WDQ D;  2WSC J;  4YTN D;  2QJP C;  3AE4 C;  2E74 D;  3VRA D;  3P4P C;  1OW7 A;  2WSF J;  3AEC C;  3R4Y A;  1FDO A;  1NEN C;  3B71 A;  3IAO A;  3Q1M A;  3AEC D;  3Q2Y A;  2WPV B;  2JO1 A;  2MKV A;  3AE4 D;  4H0L B;  2E76 D;  3AEG C;  4R4M A;  3SFD C;  1MKM A;  1U57 A;  3Q5R A;  4H44 B;  3Q5P A;  4IL6 X;  4PV1 C;  1ZP0 C;  2ZT9 B;  1KMI Z;  5M1B A;  2WS3 D;  3ABV D;  3CIR D;  2YMK A;  2WU2 C;  4YSZ C;  3GMA A;  2FXP A;  3AEB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...