3AE2C

Crystal structure of porcine heart mitochondrial complex ii bound with 2-hydroxy-n-phenyl-benzamide
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with 2-Hydroxy-N-phenyl-benzamide
rcsb
total genus 47
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3ae2C01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3ae2C02
3AEDD 2FBWD 3P4PC 5C2TD 3ABVC 5C3JC 3AE4D 3AE8C 4YSXD 3AE9D 3P4RD 3AEFD 3CIRD 3P4QC 3S9OA 4YTPC 3AE7D 2H89D 1KFYD 2WDVD 2H88C 3SFEC 2WU5C 1KF6C 1NENC 2BS3C 3AEBD 4YTMD 2WS3D 3AEGC 3VR9D 1OW6A 3AEEC 4YSYD 4YT0C 1L0VD 2WU2D 3AEAC 2WDRC 3SFDD 1YQ3C 1NEKC 3AE5C 2ACZC 1ZOYC 4YSZD 4KX6D 1QLBC 1ZP0D 3P4SD 3AE2C 3AE3C 3P4PD 5C3JD 3ABVD 3VRAC 3AE8D 1YQ4C 1PV3A 3AECC 3AE2D 3P4QD 2WP9C 4YTPD 1E7PC 4YXDC 2H88D 2G3AA 2WU5D 3SFED 3VRBC 1KF6D 1NEND 3AEGD 4YTNC 2WQYC 3AE6C 3AEED 4YT0D 3AE1C 3AEAD 2WDRD 3VR8C 1K04A 1NEKD 1YQ3D 2ACZD 2B76C 3AE5D 3AEDC 2FBWC 3B71A 1ZOYD 5C2TC 3AE4C 4YSXC 2BS4C 3AE3D 3VRAD 3AE9C 2WDQC 3P4RC 3AEFC 3CIRC 1YQ4D 3AECD 1OW8A 3AE7C 1K05A 2H89C 2WP9D 1KFYC 2WDVC 2WDQD 3AEBC 4YTMC 2WS3C 3VR9C 4YXDD 4YSYC 1L0VC 1OW7A 3VRBD 2WU2C 3SFDC 2BS2C 4YTND 2WQYD 3AE6D 3AE1D 4YSZC 4KX6C 1KTMA 3VR8D 2B76D 1ZP0C 3P4SC
chains in the Genus database with same CATH superfamily
3TDKA 2KI7B 2HR3A 1SVFA 4H44B 4IFFA 4I7ZB 3L37A 2IYOA 2KP8A 2P58A 3P4QC 1FS0E 2N9BA 3H6PA 1SQQG 5KKZB 1HH0A 2HPCB 1H0TA 1NENC 4YTMD 4XE5B 1M57D 3LIDA 4HJGH 1RF1A 2YO3A 3T97A 3AE5C 3WUTA 2E42A 3CMEP 5APTA 2FYNB 1KC8Q 1NTKE 1CW5A 3AE2C 1JMMA 1GK4A 5BU8B 5CBNA 4TT3H 1OFCX 4H0LD 1LGHB 3H1KD 1P84I 5CJ4A 3B5NC 1U57A 1M8OB 1L4AA 3CC2P 1TU3F 4ZMDA 1JB0J 3V5BA 4W80A 4PD4E 5KAIE 1IC2A 5KJ7C 2H89C 3NMDA 4LLHA 4AQRD 1JUNA 1S72P 2Y0EA 3BVHA 3CLQA 4KT0J 2M5AA 5AW0B 1FZCB 5APSA 5KTBA 2XV5A 2QA4P 2CK3H 2DW3A 2WSEH 3BATA 1EQ7A 1KILA 2BEQD 1NTMJ 4PV1C 3JCUE 1NJIQ 2R3SA 1URQC 1L0LK 1SQVJ 1PGQA 1Q90D 3VP8A 1VDFA 4JQ0D 5K5GB 5DJUB 3L74E 3GHGC 2IBZI 2K9JB 3V4WA 1AJYA 2GA1A 5CCGD 2J59M 3AE3C 1S5LH 1RY3A 1HJ0A 3VOPA 3M9QA 3L72J 2Q1KA 2WTYA 2NPSC 2FXOA 2WQYC 1SQQE 2GUVA 2WDRD 2AEMA 4C7RA 4EI2A 3NTNA 3P8CD 1MV8A 3S1KA 4D6TE 2JWDA 1EXIA 3AEFC 1KD1Q 1K73Q 1BE3E 1JCDA 3Q5PA 5B66H 4KJMA 2QEXP 2XZRA 1IZNB 4WVZA 2BCCJ 5CCHA 3QWOC 3A0BE 2BS2C 3R2PA 3L75E 2AXTE 1VQ5P 4DT0A 2Q3EA 3M06A 4KX6C 1JNMA 3I5CA 1GW3A 1R5SA 4WY4D 4C46A 1L2PA 3HUSA 5AW4B 2QJYC 4UB6E 5CCGA 2PP6A 4U3FD 5GTHE 2A45I 2HPCA 1T3JA 1KQGB 3SFEC 1E5WA 1DD4A 1TFFA 2ZT9B 1L0VD 1ZOYC 4DOJA 2N1TC 3CXHE 2ZFYA 3H1KG 3TK1A 2FYUK 3PP5A 4I2LC 3D6ZA 1X79B 1HBWA 3EFFK 1FDMA 3HD7B 2P10A 3CWBG 5APVA 2C0XA 1QVGO 4ASVA 2XNDH 1PPJE 2WSSH 2Y0DA 1N73A 1CSBA 1FJPA 5CHXA 1YHQP 2XKMA 1FZGA 1LTSC 2B89A 1ZR4A 1N8RQ 1VF5B 4JF7A 1NVOA 1Q7YQ 3MD0A 2JKVA 3M0DA 3VR9C 4K35A 3P32A 2WU2C 1PP9E 2R44A 3AE1D 1SQBJ 1LJ2A 3KQGA 4W7YA 2R3CA 1JY3O 2FY8A 2ZYDA 2LKMA 3AE4D 2QM8A 2BASA 3ZDMA 2BEZF 3L73J 4Z1MH 1GL2B 4H13B 4C7NA 2Q3IA 2WPVB 1RF0C 2KS1B 3CCQP 3FWNA 1KQLA 2WSFH 2JP3A 2E75C 2XDJA 1Q86Q 2K9JA 1YQ3C 3RK3E 2ZFCA 2D2CC 1KB9I 4JBZA 1ZP0D 3JCUH 3G3ZA 4WBAA 3VRAC 3G4SP 1BSNA 2Q5UA 1NOHA 3KYQA 3B5NB 2JR8A 1GD2E 4B86A 3LW5J 3HE5B 4YXDC 1OIPA 2H88D 1GMJA 3VRBC 2Z5HA 4PJ0H 1LTAC 1A02J 1KILE 4D6TD 2LXCB 4YXWH 4GOEA 2FBWC 1BE3D 1RQVA 2WDQC 1SFCC 2K3RA 4R4LA 5AW1B 3PLNA 1NTMK 1U7JA 2WDVC 3L75D 2W6BA 3H1KE 1SQVK 2M8RA 2HG5D 2KOGA 2FFDA 4YTND 2HLOA 4PV1B 3VMYA 1RE4A 1URQB 3CWBE 1WT6A 4U3FG 5TJHA 2KXPB 3HTKB 3B4SA 3CIRD 1SQXJ 3MTUE 3GF7A 1N7SD 3GHGB 1JY2N 1L0NJ 3A0BH 2KIKA 4YT0C 2AXTH 2YO2A 2OYHC 3A0HE 4OWFA 3SFDD 1NEKC 3OA7A 4R4MA 3L4FA 5B5EH 3P4SD 2HYNA 2WPSA 1HWTC 4GIFA 1MKMA 3AECC 2WMMA 4UB6H 3AE2D 5GTHH 2NPSB 2E74D 4OVNF 1JM0A 3P7KA 2LR2A 3NFQA 2I1JA 1PPJD 1VPCA 3HD7A 1GTWA 1VQOP 4U7JA 2K1AA 5AVTB 5TISH 4DDGA 3V2RA 2JWAA 3AEED 4LDTA 3AEAD 1KFMA 5APYA 1S9KD 1K04A 3VMXA 3CCLP 3CXHH 2OYIC 3EQ2A 5C2TC 1VQ7P 3RL0C 1LWUC 1LT9C 3L70J 5B66E 3UIAA 2Y9YA 1VQ8P 2WP9D 1KFYC 1PP9D 1EXJA 1MFTA 3BCCJ 3I55P 2HODA 1HUCA 2E76C 1EZVD 4RJTA 1P84E 3TGUJ 3TNUA 1M7LA 4IL6X 5GTIE 1S1CX 3KXDA 1KTMA 1VQPP 1T2KD 2WPQA 3GF3A 3D6YA 1L4AD 2PRRA 2QJYB 3E7KA 3P8CE 2Q7CA 5KLVJ 2OTLP 3D71A 3L74J 1USEA 1DH3A 2H8PD 2PAJA 3AE7D 3H1JJ 1S2EA 3N7NA 1MUUA 3CX5I 1L0LE 1MZ9A 4YSYD 2N1TB 5EFWB 3GG2A 3RBZA 3EFGA 3FGAD 4IOIH 4YSZD 1ZMEC 2C9LY 1S3JA 3B5NA 3FWLA 1GL2C 3WUUA 3MUDA 4H13C 1VQKP 4L76A 1KILD 2R5DA 4D6TG 1SQQJ 3HE5A 1QEXA 4U3FE 1VL2A 3WUVA 1Q2NA 4L75A 1BE3G 3RK2C 2IBZE 4RO0A 2NZ2A 2WT7B 2ACZD 2KZIA 1OVRA 3MGNA 1EDKA 3GMAA 5KJ7A 1SQBK 3IR9A 3L75G 1NH4A 3A3YB 3RBXA 3M0AA 2H7HA 3OJAB 2JJLA 2WITA 4BRYB 2WS3C 2IFMA 4IFDK 1EC5A 1OW7A 2A06D 3O6QB 3CWBD 3AE6D 1IFJA 2JEEA 1OX3A 1URQA 3A7OA 3AEDD 3TF5A 3HTKA 4OGQD 4WB4A 4ZNCA 1PZQA 1GZLA 1VQMP 4YTPC 3GHGA 2E75B 2L91A 3C1LA 2WSCJ 1LTJC 4L74A 2D2CB 1HVVA 1OW6A 1FDIA 1J1DC 1SQPJ 1G1IA 1RE3C 1W5CE 1QGKB 4AYCA 5CCHD 1YI2P 3PJSK 1GW4A 1GDTA 1N86A 1M56D 3U1CA 3A2AA 3AE8D 1YQ4C 1PPJG 2B87A 1SQBD 2NPSA 2YKOA 4H44D 2IDBA 3OAKA 3FXDA 4PJ0E 1ZN5A 4GDOA 1W2EA 3IAOA 1SLQA 3A0HH 4EDFA 3RK3C 4GT1A 3P8MC 1KZUB 4GOFA 2N9YB 1FE6A 4LGDE 1SFCB 2KYVA 1KYOI 1PP9G 1HF9A 1EZVG 1OW8A 1P84D 1E79H 1K05A 4W7ZA 1SQXK 3Q2YA 4WWIA 2MKVA 4YTMC 4N6JA 1L0NK 1GU5A 1IFIA 3VR8D 2B76D 1JOCA 4YSXD 3H1LJ 4PD4I 1S4XA 3AE9D 3P4RD 4H0LC 1L0LD 3OW2O 4EOTA 2V7QH 2OYHB 1YJNP 1NTZJ 1P84H 1GK6A 5C39A 2N1TA 1LT1A 5GTIH 5B5EE 3HRNA 2QJKC 1PV3A 1FDOA 3L35A 3KDPB 2WWWA 2AXCA 5TISE 1FJKA 3TYYA 2IBZD 2OYIB 2MJZA 3AEGD 3RL0B 1LWUB 1LT9B 1H89A 2WT7A 1QX8A 2YKPA 3KHUA 2Q6QA 1YJWP 4XFJA 3H1KJ 1NYHA 2O1KA 3CC4P 3N4XA 2E76B 2PFXA 2A06G 1J2JB 2FXMA 1BGYJ 3SSUA 1ZV8A 1Q82Q 3VTPC 2WDQD 5KLVK 2WSEJ 4K3AA 2R32A 2YKQA 3O6QA 1S5LX 1SQVE 2P67A 3LIEA 5CCGC 1S9KE 5DJTB 1HGZA 1N7LA 1NAYA 1JEKA 1EDLA 1BDCA 1FOSF 4I6MC 3H1ID 1JY2P 1NU1J 1K9MQ 1VQ9P 1SS1A 1FZCA 1DD3A 1JTHB 2O01H 1EZVE 1SQQK 4UB8H 3E1RA 3L72E 2WDRC 2IZ1A 2WZ7A 3BCCD 1SQBG 2M3EA 2O01N 4XA4A 3P4PD 5C3JD 3ABVD 3H1HJ 1FOSE 2FYUD 2RH0A 1QVFO 1AVYA 2XU6A 3RK2B 1IFMA 1OVVA 3U59A 1N73C 4QMAA 2ZXXA 2WU5D 1KF6D 3VONA 4GKGA 3I56P 4DCKA 2KNCB 2SPZA 3L71J 1RH5B 1SFCA 3PTZA 1ZLLA 5AVQB 2ZT9D 3JSVC 3V2QA 3CXHI 4WY4C 3D70A 4HKZH 2E74B 2P2UA 1OWAA 2K88A 5E79H 5AW8B 2K9YA 2A45H 3O8ZA 1PL5A 1LP1B 1L0VC 5AW5B 2E5TA 1YYCA 1BCCJ 3HD7D 1N2DC 1SQPK 4YPCA 4I1LA 1L0LG 3T97B 1ZR2A 1PIXA 2GUSA 2Y9ZA 2UWJE 4IL6H 5AVXB 1D7MA 1LTJB 4JYCA 5APXA 2E43A 2HFED 2J58A 1K8AQ 1J1DB 2PGDA 2OYHA 4HH2A 1Q81Q 1G1JA 3AEBD 3L36A 2QM7A 1VF5D 2A06E 3Q5RA 1L4AB 1ZXGA 2VRSA 5H2FE 5KLIB 1LNQA 3ITKA 1RHZB 5BU5A 2IBZG 2QJPC 3P4QD 1U7MA 3RK3B 2Q9IA 1NTKJ 1M90Q 4IFMA 4AUWA 1NEND 2OYIA 1QLED 4GODA 2Z4EA 2IZ0A 1KB9D 2QIWA 4DJGA 3CX5E 3AE1C 3SWKA 1LT9A 4ZKPA 1YTZT 3AE5D 4M3LA 3AE4C 4OH8B 1SQPD 2YNYA 2FFDC 1KILB 4MN4C 1NTMD 5AVUB 2LXBA 1RE4C 1SQBE 2OGUA 2W6JH 1HTLC 2C0WA 2XNXA 1SQVD 4N78E 3HE4B 3MHVA 3B5ND 4DHIB 3CL3D 1NTZK 3W68A 2E5YA 1Y47A 1ZP0C 5AVRB 4H0LB 2YIUB 2CPBA 3H1IG 2WSFJ 3IN6A 2WPRA 1M1JC 3BRVB 2KUBA 2NRGA 1A02F 1QL2A 5KJ7D 2H89D 1UIXA 3L72D 2H88C 1CI6B 3Q5SA 5M1BA 3RL0g 3BCCG 5BVZA 4DZOA 1H88A 2QE7H 2Z5IA 2FXPA 2QJKB 2FYUG 2KB7P 2A45G 1BSHA 2W90A 1GL2A 1FZFA 4O9BA 4EIJA 2K37A 4PV1D 1AVOA 2AEFA 1YITP 2KS1A 1URQD 3CCJP 1JO5A 3H1LD 2ZVOB 1X22A 3KZIE 1JCCA 4YTNC 2QG4A 2BCCD 2KNCA 3II6A 2B9BA 4Y99B 5AW3B 1NTZD 1X0TA 3V2PA 2P7JA 3AE3D 3CI9A 5AVYB 3CIRC 1FZEA 1N7SC 3KPEA 1Z56A 1AFOA 3HUSB 4D6TJ 1SP4A 1LP1A 3VMAA 1OZHA 1PGOA 2NPSD 1NU1K 3SFDC 3V2NA 1BE3J 2WQYD 5AW7B 1SQXE 3Q1MA 3WU2E 3P4SC 1L0NE 4Y28J 1KYOE 3L75J 3AEFD 1LTJA 3CC7P 2E74C 3S9OA 5CBOA 1NHLA 5AW6B 1RE3A 1VQ6P 2BS3C 4UB8E 3AEEC 3AEAC 1OVUA 1BGYD 1GU4A 1NWQA 3MUDC 4N3YB 4KX6D 1RF1C 1AV1A 3W67A 1N73B 2ZYGA 3FXEA 2WP9C 3F5HA 4DHZA 3TSIA 3CX5D 3H1IE 4A7PA 2G3AA 3SFED 2ZXEB 2JO1A 1WMKA 3L70E 2W6AA 2IX7C 4WY4B 4BWNA 1SQPG 1T2KC 5H2FH 1ZOYD 1NU1D 1NTMG 3BCCE 1L4AC 2N1TD 5KLIC 2BS4C 3TGUE 1SQVG 4JYBA 4KHXA 1NGMB 4HYTB 5E79E 4N78D 2FYUE 3AE7C 2W83C 4RKUJ 3L73D 3PH0A 1IFPA 4NPFX 1OMIA 3HE4A 4C7NB 3H1HD 4YSYC 3CX5H 2YXQB 2IPPA 5KLVE 4YSZC 3H1JE 2M0BA 3QH9A 2ZYAA 2M3BA 1KFNA 4IL6E 3L72G 5AVZB 1PP9J 2QRXA 3PRJA 3L71D 1KILC 2ZVNB 3PHLA 1BDDA 3G9RA 1IFNA 1CI6A 1DIPA 3VR9D 1NTKK 3V6IA 2WU2D 1DEBA 2ACZC 1FZBA 2IFNA 2KLUA 2OYOA 2QJPB 1LTIC 3MIWA 1QLBC 2YIUC 3M9HA 1G2CB 3F89A 4TLFA 2FKWB 3H1LG 3B8EB 3G6EP 1BCCD 2CPSA 2BCCG 1KQSO 1VQNP 1H8AA 2W8ZA 1NTZG 1LTGC 3AE6C 2E75D 1Y9BA 1T8ZA 3C8VA 4BXLA 1YQ3D 4ASWA 3M91A 3LW5H 3AEDC 1KMIZ 3B71A 1WRGA 2D2CD 2FFDB 1FZAA 1EDIA 3RGUA 4OGQC 2KSEA 2ZJSE 5AVSB 3VRAD 1KV4A 3EWKA 1JY2O 2KSJA 2GM4A 1T6AA 5APWA 2JDIH 2C9NY 1HGVA 1SQXD 3KZIH 4YXDD 1YTZI 1ZRTE 1KN7A 3VRBD 1L0ND 1X8YA 3CCVP 4RESB 4I6LA 1KB9E 5CCHC 1KYOD 1J1EC 3H25A 2O1JA 1M1JB 1NTKD 2FBWD 4Y99C 1JMBA 2YMKA 3AE8C 3FX0A 4BRYA 1SQPE 1SFCD 4H44C 3VP9A 1YBKA 1Y8AA 1NTME 2H43A 2I1KA 4I7ZC 2WDVD 1BGYG 3CWBJ 5KAFE 2RKLA 3HUSC 3SWFA 4CPGA 5KKZC 2L5GB 1IJDB 3WU2H 5AW2B 2OTKE 1KQFB 1RF0A 4PD4D 3GLMA 1KYOH 5APQA 1EDJA 1IFDA 2FYNC 3IF4A 3L70D 2OTJP 2I8DA 2V4HA 2KZJA 1NU1G 4DHJA 4YT0D 4WY4A 2HODB 1NKNA 3VR8C 3TGUD 2RN0A 1AQ5A 3TNUB 1NEKD 3H32B 2B76C 3C9IA 1R5LA 3G71P 3VN0A 4YSXC 1N7SB 3L73G 5APUA 3AE9C 3P4RC 3CMAP 3CCMP 5L8RJ 1W2BO 4PD4H 3AECD 3H1HG 2O3JA 3GW6A 2R5BA 5KAIH 2AEJA 3MP7B 5KLVD 3L74D 1FU1A 3H1JD 3H1LE 2WVRA 4HB1A 1NAFA 2OARA 1ZW0A 2B88A 5CJ0A 3CCRP 2BCCE 3M0DC 2V7QJ 1YJ9P 2ITAA 3L71G 3U1AA 5C2TD 1RQUA 1NTZE 1FZCC 3RL0D 3S4RA 1OXZA 1NO4A 4JPZB 1KFYD 1KORA 1H0TB 1VQLP 1LTTC 2E76D 1IK9A 3AEGC 1SQQD 2Y0CA 2KK7A 1RF1B 3WMM0 1BCCG 3K5BA 1PGJA 1G2CA 4L73A 1L0LJ 1JY3P 1VQ4P 2IYPA 3USSA 1FC2C 1UIIA 1MFZA 1R8EA 1YIJP 2ZAEB 1QL1A 1EZVI 1AQTA 3CPWO 3BRTB 2OQQA 2P1JA 1BGYE 4NPDA 1X9VA 4U3FJ 3CCSP 1IK7A 3CCEP 1SQXG 5CMZA 2G8YA 1NKZB 1ZRTD 4DDIA 1GL2D 1LTBC 3CD6P 1L0NG 4H13D 2YMYA 3SWYA 5AVVB 3E1IA 1NTKG 3JC22 1PGPA 1T3UA 1LWUA 3RK2D 1FBMA 3IFMA 2M5AB 1M1JA 3MZWB 3CXHD 1DX7A 3R4YA 1DEEG 3P4PC 4FJVA 3ABVC 5C3JC 1NU1E 2POHA 3A5TA 1CZQA 1S5LE 2O01J 5AVWB 3VYIA 1IO4A 1AA0A 2WU5C 2B87B 3BASA 3L73E 1KF6C 2J5UA 2WS3D 1M1KQ 3H1HE 1KB9H 3CCUP 2ZT9C 2WSCH 1XTGB 3L70G 3Q3DA 2QVAA 3H1IJ 1FAVA 3VMZA 2FYZA 4ZKUA 1JTHA 2RMZA 3L71E 4YTPD 5KAFH 4EYYQ 1E7PC 3TGUG 5AW9B 3M9BA 1USDA 4OGQB 3HD7C 4LC1A 3H32A 1JY3N 4NPEA 2FYUJ 1N7SA 3V4QA 5KLVG 2W27A 3L74G 1YQ4D 2QSIA 3H1JG 2YXRB 1BCCE 3AEBC 1J1EB 1PFIA 1VF5C 2KLVA 1HJBA 3RK3D 3NXSA 1XTCC
chains in the Genus database with same CATH topology
3AEDD 2FBWD 3D6YA 3P4PC 3ABVC 5C2TD 1RQUA 3AE4D 3T97B 5C3JC 4Y28J 2BEQD 4H44B 4PV1C 2YMKA 2WSFJ 3AE8C 4YSXD 3IN6A 4OGQD 1PIXA 2O01J 2BEZF 4I7ZB 3AE9D 4Z1MH 3P4RD 3AEFD 4H0LC 3CIRD 3P4QC 3D71A 2E74C 4H13B 3S9OA 3GF3A 1Q90D 2QJYC 4H44C 4YTPC 3GF7A 3AE7D 2E75B 3G9RA 2H89D 1KFYD 1KORA 1UIXA 2WPVB 4I7ZC 2WDVD 2H88C 3Q5SA 1KQGB 3SFEC 2WU5C 2WSCJ 1KF6C 5M1BA 1DIPA 3RL0g 1NENC 2BS3C 3AEBD 1DD3A 4YTMD 2D2CB 2J5UA 2E76D 3AEGC 1DD4A 2WS3D 1OW6A 2JP3A 3VR9D 5KKZC 3AEEC 4YSYD 4YT0C 1FDIA 2E75C 2ZT9B 1VF5D 1L0VD 2WU2D 3Q5RA 3AEAC 2WDRC 3SFDD 1YQ3C 2FXPA 1NEKC 3RK3E 3AE5C 2ACZC 4R4MA 2D2CC 1ZOYC 3FGAD 1AJYA 4YSZD 1KQFB 4KX6D 2ZT9C 1QLBC 1ZP0D 1ZMEC 3AE2C 3P4SD 3GLMA 2YIUC 3AE3C 3Q3DA 3P4PD 3ABVD 5C3JD 3VRAC 2QJKC 1HJ0A 4PV1D 3AE8D 1YQ4C 1PV3A 1FDOA 1MKMA 3AECC 2QJPC 2FYNC 4TT3H 3D6ZA 3AE2D 4H0LD 3P4QD 2WP9C 2E74D 4H13C 4H44D 2IDBA 3LW5J 4YTPD 1E7PC 1VL2A 4YXDC 2H88D 2G3AA 4GDOA 4U7JA 2WU5D 2P10A 1GMJA 1R8EA 1U57A 1KF6D 3SFED 1NEND 3VRBC 3IAOA 2JO1A 1WMKA 3AEGD 1KILE 2WQYC 4YTNC 3AE6C 3AEED 4YT0D 2QIWA 2E75D 1Y9BA 3AE1C 4OGQB 3AEAD 3C8VA 2WDRD 3VR8C 1K04A 1NEKD 1YQ3D 2NZ2A 2OQQA 1TU3F 2ACZD 2B76C 3AE5D 3AEDC 1KMIZ 2FBWC 2D2CD 3B71A 1ZOYD 5C2TC 3AE4C 1IK7A 1JB0J 2ZT9D 3GMAA 4YSXC 4OGQC 3D70A 1EXIA 4XFJA 1RQVA 5KLIC 2BS4C 3AE3D 3VRAD 3AE9C 1NYHA 2WDQC 3P4RC 3AEFC 3EWKA 5L8RJ 1HF9A 2E74B 1YQ4D 3CIRC 4R4LA 1NGMB 3AECD 2G8YA 2QSIA 3Q5PA 1OW8A 2E76B 3AE7C 1K05A 1VF5B 2H89C 2WP9D 4RKUJ 1KFYC 2WDVC 4H13D 1EXJA 2WDQD 2WSEJ 2K9YA 3Q2YA 2MKVA 3AEBC 4YTMC 1OMIA 2E76C 2WS3C 3VR9C 4YXDD 1PL5A 1ZRTE 4YSYC 1L0VC 1OW7A 1VF5C 3VRBD 2WU2C 2V7QJ 3O6QA 4KT0J 3SFDC 2BS2C 4YTND 2WQYD 3AE6D 4IL6X 4PV1B 1S5LX 1S1CX 3AE1D 3Q1MA 4YSZC 3H25A 4KX6C 1KTMA 3VR8D 3R4YA 2B76D 1ZP0C 4H0LB 3P4SC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AED D;  2FBW D;  3P4P C;  5C2T D;  3ABV C;  5C3J C;  3AE4 D;  3AE8 C;  4YSX D;  3AE9 D;  3P4R D;  3AEF D;  3CIR D;  3P4Q C;  3S9O A;  4YTP C;  3AE7 D;  2H89 D;  1KFY D;  2WDV D;  2H88 C;  3SFE C;  2WU5 C;  1KF6 C;  1NEN C;  2BS3 C;  3AEB D;  4YTM D;  2WS3 D;  3AEG C;  3VR9 D;  1OW6 A;  3AEE C;  4YSY D;  4YT0 C;  1L0V D;  2WU2 D;  3AEA C;  2WDR C;  3SFD D;  1YQ3 C;  1NEK C;  3AE5 C;  2ACZ C;  1ZOY C;  4YSZ D;  4KX6 D;  1QLB C;  1ZP0 D;  3P4S D;  3AE2 C;  3AE3 C;  3P4P D;  5C3J D;  3ABV D;  3VRA C;  3AE8 D;  1YQ4 C;  1PV3 A;  3AEC C;  3AE2 D;  3P4Q D;  2WP9 C;  4YTP D;  1E7P C;  4YXD C;  2H88 D;  2G3A A;  2WU5 D;  3SFE D;  3VRB C;  1KF6 D;  1NEN D;  3AEG D;  4YTN C;  2WQY C;  3AE6 C;  3AEE D;  4YT0 D;  3AE1 C;  3AEA D;  2WDR D;  3VR8 C;  1K04 A;  1NEK D;  1YQ3 D;  2ACZ D;  2B76 C;  3AE5 D;  3AED C;  2FBW C;  3B71 A;  1ZOY D;  5C2T C;  3AE4 C;  4YSX C;  2BS4 C;  3AE3 D;  3VRA D;  3AE9 C;  2WDQ C;  3P4R C;  3AEF C;  3CIR C;  1YQ4 D;  3AEC D;  1OW8 A;  3AE7 C;  1K05 A;  2H89 C;  2WP9 D;  1KFY C;  2WDV C;  2WDQ D;  3AEB C;  4YTM C;  2WS3 C;  3VR9 C;  4YXD D;  4YSY C;  1L0V C;  1OW7 A;  3VRB D;  2WU2 C;  3SFD C;  2BS2 C;  4YTN D;  2WQY D;  3AE6 D;  3AE1 D;  4YSZ C;  4KX6 C;  1KTM A;  3VR8 D;  2B76 D;  1ZP0 C;  3P4S C; 
#chains in the Genus database with same CATH topology
 3TDK A;  2KI7 B;  2HR3 A;  1SVF A;  4H44 B;  4IFF A;  4I7Z B;  3L37 A;  2IYO A;  2KP8 A;  2P58 A;  3P4Q C;  1FS0 E;  2N9B A;  3H6P A;  1SQQ G;  5KKZ B;  1HH0 A;  2HPC B;  1H0T A;  1NEN C;  4YTM D;  4XE5 B;  1M57 D;  3LID A;  4HJG H;  1RF1 A;  2YO3 A;  3T97 A;  3AE5 C;  3WUT A;  2E42 A;  3CME P;  5APT A;  2FYN B;  1KC8 Q;  1NTK E;  1CW5 A;  3AE2 C;  1JMM A;  1GK4 A;  5BU8 B;  5CBN A;  4TT3 H;  1OFC X;  4H0L D;  1LGH B;  3H1K D;  1P84 I;  5CJ4 A;  3B5N C;  1U57 A;  1M8O B;  1L4A A;  3CC2 P;  1TU3 F;  4ZMD A;  1JB0 J;  3V5B A;  4W80 A;  4PD4 E;  5KAI E;  1IC2 A;  5KJ7 C;  2H89 C;  3NMD A;  4LLH A;  4AQR D;  1JUN A;  1S72 P;  2Y0E A;  3BVH A;  3CLQ A;  4KT0 J;  2M5A A;  5AW0 B;  1FZC B;  5APS A;  5KTB A;  2XV5 A;  2QA4 P;  2CK3 H;  2DW3 A;  2WSE H;  3BAT A;  1EQ7 A;  1KIL A;  2BEQ D;  1NTM J;  4PV1 C;  3JCU E;  1NJI Q;  2R3S A;  1URQ C;  1L0L K;  1SQV J;  1PGQ A;  1Q90 D;  3VP8 A;  1VDF A;  4JQ0 D;  5K5G B;  5DJU B;  3L74 E;  3GHG C;  2IBZ I;  2K9J B;  3V4W A;  1AJY A;  2GA1 A;  5CCG D;  2J59 M;  3AE3 C;  1S5L H;  1RY3 A;  1HJ0 A;  3VOP A;  3M9Q A;  3L72 J;  2Q1K A;  2WTY A;  2NPS C;  2FXO A;  2WQY C;  1SQQ E;  2GUV A;  2WDR D;  2AEM A;  4C7R A;  4EI2 A;  3NTN A;  3P8C D;  1MV8 A;  3S1K A;  4D6T E;  2JWD A;  1EXI A;  3AEF C;  1KD1 Q;  1K73 Q;  1BE3 E;  1JCD A;  3Q5P A;  5B66 H;  4KJM A;  2QEX P;  2XZR A;  1IZN B;  4WVZ A;  2BCC J;  5CCH A;  3QWO C;  3A0B E;  2BS2 C;  3R2P A;  3L75 E;  2AXT E;  1VQ5 P;  4DT0 A;  2Q3E A;  3M06 A;  4KX6 C;  1JNM A;  3I5C A;  1GW3 A;  1R5S A;  4WY4 D;  4C46 A;  1L2P A;  3HUS A;  5AW4 B;  2QJY C;  4UB6 E;  5CCG A;  2PP6 A;  4U3F D;  5GTH E;  2A45 I;  2HPC A;  1T3J A;  1KQG B;  3SFE C;  1E5W A;  1DD4 A;  1TFF A;  2ZT9 B;  1L0V D;  1ZOY C;  4DOJ A;  2N1T C;  3CXH E;  2ZFY A;  3H1K G;  3TK1 A;  2FYU K;  3PP5 A;  4I2L C;  3D6Z A;  1X79 B;  1HBW A;  3EFF K;  1FDM A;  3HD7 B;  2P10 A;  3CWB G;  5APV A;  2C0X A;  1QVG O;  4ASV A;  2XND H;  1PPJ E;  2WSS H;  2Y0D A;  1N73 A;  1CSB A;  1FJP A;  5CHX A;  1YHQ P;  2XKM A;  1FZG A;  1LTS C;  2B89 A;  1ZR4 A;  1N8R Q;  1VF5 B;  4JF7 A;  1NVO A;  1Q7Y Q;  3MD0 A;  2JKV A;  3M0D A;  3VR9 C;  4K35 A;  3P32 A;  2WU2 C;  1PP9 E;  2R44 A;  3AE1 D;  1SQB J;  1LJ2 A;  3KQG A;  4W7Y A;  2R3C A;  1JY3 O;  2FY8 A;  2ZYD A;  2LKM A;  3AE4 D;  2QM8 A;  2BAS A;  3ZDM A;  2BEZ F;  3L73 J;  4Z1M H;  1GL2 B;  4H13 B;  4C7N A;  2Q3I A;  2WPV B;  1RF0 C;  2KS1 B;  3CCQ P;  3FWN A;  1KQL A;  2WSF H;  2JP3 A;  2E75 C;  2XDJ A;  1Q86 Q;  2K9J A;  1YQ3 C;  3RK3 E;  2ZFC A;  2D2C C;  1KB9 I;  4JBZ A;  1ZP0 D;  3JCU H;  3G3Z A;  4WBA A;  3VRA C;  3G4S P;  1BSN A;  2Q5U A;  1NOH A;  3KYQ A;  3B5N B;  2JR8 A;  1GD2 E;  4B86 A;  3LW5 J;  3HE5 B;  4YXD C;  1OIP A;  2H88 D;  1GMJ A;  3VRB C;  2Z5H A;  4PJ0 H;  1LTA C;  1A02 J;  1KIL E;  4D6T D;  2LXC B;  4YXW H;  4GOE A;  2FBW C;  1BE3 D;  1RQV A;  2WDQ C;  1SFC C;  2K3R A;  4R4L A;  5AW1 B;  3PLN A;  1NTM K;  1U7J A;  2WDV C;  3L75 D;  2W6B A;  3H1K E;  1SQV K;  2M8R A;  2HG5 D;  2KOG A;  2FFD A;  4YTN D;  2HLO A;  4PV1 B;  3VMY A;  1RE4 A;  1URQ B;  3CWB E;  1WT6 A;  4U3F G;  5TJH A;  2KXP B;  3HTK B;  3B4S A;  3CIR D;  1SQX J;  3MTU E;  3GF7 A;  1N7S D;  3GHG B;  1JY2 N;  1L0N J;  3A0B H;  2KIK A;  4YT0 C;  2AXT H;  2YO2 A;  2OYH C;  3A0H E;  4OWF A;  3SFD D;  1NEK C;  3OA7 A;  4R4M A;  3L4F A;  5B5E H;  3P4S D;  2HYN A;  2WPS A;  1HWT C;  4GIF A;  1MKM A;  3AEC C;  2WMM A;  4UB6 H;  3AE2 D;  5GTH H;  2NPS B;  2E74 D;  4OVN F;  1JM0 A;  3P7K A;  2LR2 A;  3NFQ A;  2I1J A;  1PPJ D;  1VPC A;  3HD7 A;  1GTW A;  1VQO P;  4U7J A;  2K1A A;  5AVT B;  5TIS H;  4DDG A;  3V2R A;  2JWA A;  3AEE D;  4LDT A;  3AEA D;  1KFM A;  5APY A;  1S9K D;  1K04 A;  3VMX A;  3CCL P;  3CXH H;  2OYI C;  3EQ2 A;  5C2T C;  1VQ7 P;  3RL0 C;  1LWU C;  1LT9 C;  3L70 J;  5B66 E;  3UIA A;  2Y9Y A;  1VQ8 P;  2WP9 D;  1KFY C;  1PP9 D;  1EXJ A;  1MFT A;  3BCC J;  3I55 P;  2HOD A;  1HUC A;  2E76 C;  1EZV D;  4RJT A;  1P84 E;  3TGU J;  3TNU A;  1M7L A;  4IL6 X;  5GTI E;  1S1C X;  3KXD A;  1KTM A;  1VQP P;  1T2K D;  2WPQ A;  3GF3 A;  3D6Y A;  1L4A D;  2PRR A;  2QJY B;  3E7K A;  3P8C E;  2Q7C A;  5KLV J;  2OTL P;  3D71 A;  3L74 J;  1USE A;  1DH3 A;  2H8P D;  2PAJ A;  3AE7 D;  3H1J J;  1S2E A;  3N7N A;  1MUU A;  3CX5 I;  1L0L E;  1MZ9 A;  4YSY D;  2N1T B;  5EFW B;  3GG2 A;  3RBZ A;  3EFG A;  3FGA D;  4IOI H;  4YSZ D;  1ZME C;  2C9L Y;  1S3J A;  3B5N A;  3FWL A;  1GL2 C;  3WUU A;  3MUD A;  4H13 C;  1VQK P;  4L76 A;  1KIL D;  2R5D A;  4D6T G;  1SQQ J;  3HE5 A;  1QEX A;  4U3F E;  1VL2 A;  3WUV A;  1Q2N A;  4L75 A;  1BE3 G;  3RK2 C;  2IBZ E;  4RO0 A;  2NZ2 A;  2WT7 B;  2ACZ D;  2KZI A;  1OVR A;  3MGN A;  1EDK A;  3GMA A;  5KJ7 A;  1SQB K;  3IR9 A;  3L75 G;  1NH4 A;  3A3Y B;  3RBX A;  3M0A A;  2H7H A;  3OJA B;  2JJL A;  2WIT A;  4BRY B;  2WS3 C;  2IFM A;  4IFD K;  1EC5 A;  1OW7 A;  2A06 D;  3O6Q B;  3CWB D;  3AE6 D;  1IFJ A;  2JEE A;  1OX3 A;  1URQ A;  3A7O A;  3AED D;  3TF5 A;  3HTK A;  4OGQ D;  4WB4 A;  4ZNC A;  1PZQ A;  1GZL A;  1VQM P;  4YTP C;  3GHG A;  2E75 B;  2L91 A;  3C1L A;  2WSC J;  1LTJ C;  4L74 A;  2D2C B;  1HVV A;  1OW6 A;  1FDI A;  1J1D C;  1SQP J;  1G1I A;  1RE3 C;  1W5C E;  1QGK B;  4AYC A;  5CCH D;  1YI2 P;  3PJS K;  1GW4 A;  1GDT A;  1N86 A;  1M56 D;  3U1C A;  3A2A A;  3AE8 D;  1YQ4 C;  1PPJ G;  2B87 A;  1SQB D;  2NPS A;  2YKO A;  4H44 D;  2IDB A;  3OAK A;  3FXD A;  4PJ0 E;  1ZN5 A;  4GDO A;  1W2E A;  3IAO A;  1SLQ A;  3A0H H;  4EDF A;  3RK3 C;  4GT1 A;  3P8M C;  1KZU B;  4GOF A;  2N9Y B;  1FE6 A;  4LGD E;  1SFC B;  2KYV A;  1KYO I;  1PP9 G;  1HF9 A;  1EZV G;  1OW8 A;  1P84 D;  1E79 H;  1K05 A;  4W7Z A;  1SQX K;  3Q2Y A;  4WWI A;  2MKV A;  4YTM C;  4N6J A;  1L0N K;  1GU5 A;  1IFI A;  3VR8 D;  2B76 D;  1JOC A;  4YSX D;  3H1L J;  4PD4 I;  1S4X A;  3AE9 D;  3P4R D;  4H0L C;  1L0L D;  3OW2 O;  4EOT A;  2V7Q H;  2OYH B;  1YJN P;  1NTZ J;  1P84 H;  1GK6 A;  5C39 A;  2N1T A;  1LT1 A;  5GTI H;  5B5E E;  3HRN A;  2QJK C;  1PV3 A;  1FDO A;  3L35 A;  3KDP B;  2WWW A;  2AXC A;  5TIS E;  1FJK A;  3TYY A;  2IBZ D;  2OYI B;  2MJZ A;  3AEG D;  3RL0 B;  1LWU B;  1LT9 B;  1H89 A;  2WT7 A;  1QX8 A;  2YKP A;  3KHU A;  2Q6Q A;  1YJW P;  4XFJ A;  3H1K J;  1NYH A;  2O1K A;  3CC4 P;  3N4X A;  2E76 B;  2PFX A;  2A06 G;  1J2J B;  2FXM A;  1BGY J;  3SSU A;  1ZV8 A;  1Q82 Q;  3VTP C;  2WDQ D;  5KLV K;  2WSE J;  4K3A A;  2R32 A;  2YKQ A;  3O6Q A;  1S5L X;  1SQV E;  2P67 A;  3LIE A;  5CCG C;  1S9K E;  5DJT B;  1HGZ A;  1N7L A;  1NAY A;  1JEK A;  1EDL A;  1BDC A;  1FOS F;  4I6M C;  3H1I D;  1JY2 P;  1NU1 J;  1K9M Q;  1VQ9 P;  1SS1 A;  1FZC A;  1DD3 A;  1JTH B;  2O01 H;  1EZV E;  1SQQ K;  4UB8 H;  3E1R A;  3L72 E;  2WDR C;  2IZ1 A;  2WZ7 A;  3BCC D;  1SQB G;  2M3E A;  2O01 N;  4XA4 A;  3P4P D;  5C3J D;  3ABV D;  3H1H J;  1FOS E;  2FYU D;  2RH0 A;  1QVF O;  1AVY A;  2XU6 A;  3RK2 B;  1IFM A;  1OVV A;  3U59 A;  1N73 C;  4QMA A;  2ZXX A;  2WU5 D;  1KF6 D;  3VON A;  4GKG A;  3I56 P;  4DCK A;  2KNC B;  2SPZ A;  3L71 J;  1RH5 B;  1SFC A;  3PTZ A;  1ZLL A;  5AVQ B;  2ZT9 D;  3JSV C;  3V2Q A;  3CXH I;  4WY4 C;  3D70 A;  4HKZ H;  2E74 B;  2P2U A;  1OWA A;  2K88 A;  5E79 H;  5AW8 B;  2K9Y A;  2A45 H;  3O8Z A;  1PL5 A;  1LP1 B;  1L0V C;  5AW5 B;  2E5T A;  1YYC A;  1BCC J;  3HD7 D;  1N2D C;  1SQP K;  4YPC A;  4I1L A;  1L0L G;  3T97 B;  1ZR2 A;  1PIX A;  2GUS A;  2Y9Z A;  2UWJ E;  4IL6 H;  5AVX B;  1D7M A;  1LTJ B;  4JYC A;  5APX A;  2E43 A;  2HFE D;  2J58 A;  1K8A Q;  1J1D B;  2PGD A;  2OYH A;  4HH2 A;  1Q81 Q;  1G1J A;  3AEB D;  3L36 A;  2QM7 A;  1VF5 D;  2A06 E;  3Q5R A;  1L4A B;  1ZXG A;  2VRS A;  5H2F E;  5KLI B;  1LNQ A;  3ITK A;  1RHZ B;  5BU5 A;  2IBZ G;  2QJP C;  3P4Q D;  1U7M A;  3RK3 B;  2Q9I A;  1NTK J;  1M90 Q;  4IFM A;  4AUW A;  1NEN D;  2OYI A;  1QLE D;  4GOD A;  2Z4E A;  2IZ0 A;  1KB9 D;  2QIW A;  4DJG A;  3CX5 E;  3AE1 C;  3SWK A;  1LT9 A;  4ZKP A;  1YTZ T;  3AE5 D;  4M3L A;  3AE4 C;  4OH8 B;  1SQP D;  2YNY A;  2FFD C;  1KIL B;  4MN4 C;  1NTM D;  5AVU B;  2LXB A;  1RE4 C;  1SQB E;  2OGU A;  2W6J H;  1HTL C;  2C0W A;  2XNX A;  1SQV D;  4N78 E;  3HE4 B;  3MHV A;  3B5N D;  4DHI B;  3CL3 D;  1NTZ K;  3W68 A;  2E5Y A;  1Y47 A;  1ZP0 C;  5AVR B;  4H0L B;  2YIU B;  2CPB A;  3H1I G;  2WSF J;  3IN6 A;  2WPR A;  1M1J C;  3BRV B;  2KUB A;  2NRG A;  1A02 F;  1QL2 A;  5KJ7 D;  2H89 D;  1UIX A;  3L72 D;  2H88 C;  1CI6 B;  3Q5S A;  5M1B A;  3RL0 g;  3BCC G;  5BVZ A;  4DZO A;  1H88 A;  2QE7 H;  2Z5I A;  2FXP A;  2QJK B;  2FYU G;  2KB7 P;  2A45 G;  1BSH A;  2W90 A;  1GL2 A;  1FZF A;  4O9B A;  4EIJ A;  2K37 A;  4PV1 D;  1AVO A;  2AEF A;  1YIT P;  2KS1 A;  1URQ D;  3CCJ P;  1JO5 A;  3H1L D;  2ZVO B;  1X22 A;  3KZI E;  1JCC A;  4YTN C;  2QG4 A;  2BCC D;  2KNC A;  3II6 A;  2B9B A;  4Y99 B;  5AW3 B;  1NTZ D;  1X0T A;  3V2P A;  2P7J A;  3AE3 D;  3CI9 A;  5AVY B;  3CIR C;  1FZE A;  1N7S C;  3KPE A;  1Z56 A;  1AFO A;  3HUS B;  4D6T J;  1SP4 A;  1LP1 A;  3VMA A;  1OZH A;  1PGO A;  2NPS D;  1NU1 K;  3SFD C;  3V2N A;  1BE3 J;  2WQY D;  5AW7 B;  1SQX E;  3Q1M A;  3WU2 E;  3P4S C;  1L0N E;  4Y28 J;  1KYO E;  3L75 J;  3AEF D;  1LTJ A;  3CC7 P;  2E74 C;  3S9O A;  5CBO A;  1NHL A;  5AW6 B;  1RE3 A;  1VQ6 P;  2BS3 C;  4UB8 E;  3AEE C;  3AEA C;  1OVU A;  1BGY D;  1GU4 A;  1NWQ A;  3MUD C;  4N3Y B;  4KX6 D;  1RF1 C;  1AV1 A;  3W67 A;  1N73 B;  2ZYG A;  3FXE A;  2WP9 C;  3F5H A;  4DHZ A;  3TSI A;  3CX5 D;  3H1I E;  4A7P A;  2G3A A;  3SFE D;  2ZXE B;  2JO1 A;  1WMK A;  3L70 E;  2W6A A;  2IX7 C;  4WY4 B;  4BWN A;  1SQP G;  1T2K C;  5H2F H;  1ZOY D;  1NU1 D;  1NTM G;  3BCC E;  1L4A C;  2N1T D;  5KLI C;  2BS4 C;  3TGU E;  1SQV G;  4JYB A;  4KHX A;  1NGM B;  4HYT B;  5E79 E;  4N78 D;  2FYU E;  3AE7 C;  2W83 C;  4RKU J;  3L73 D;  3PH0 A;  1IFP A;  4NPF X;  1OMI A;  3HE4 A;  4C7N B;  3H1H D;  4YSY C;  3CX5 H;  2YXQ B;  2IPP A;  5KLV E;  4YSZ C;  3H1J E;  2M0B A;  3QH9 A;  2ZYA A;  2M3B A;  1KFN A;  4IL6 E;  3L72 G;  5AVZ B;  1PP9 J;  2QRX A;  3PRJ A;  3L71 D;  1KIL C;  2ZVN B;  3PHL A;  1BDD A;  3G9R A;  1IFN A;  1CI6 A;  1DIP A;  3VR9 D;  1NTK K;  3V6I A;  2WU2 D;  1DEB A;  2ACZ C;  1FZB A;  2IFN A;  2KLU A;  2OYO A;  2QJP B;  1LTI C;  3MIW A;  1QLB C;  2YIU C;  3M9H A;  1G2C B;  3F89 A;  4TLF A;  2FKW B;  3H1L G;  3B8E B;  3G6E P;  1BCC D;  2CPS A;  2BCC G;  1KQS O;  1VQN P;  1H8A A;  2W8Z A;  1NTZ G;  1LTG C;  3AE6 C;  2E75 D;  1Y9B A;  1T8Z A;  3C8V A;  4BXL A;  1YQ3 D;  4ASW A;  3M91 A;  3LW5 H;  3AED C;  1KMI Z;  3B71 A;  1WRG A;  2D2C D;  2FFD B;  1FZA A;  1EDI A;  3RGU A;  4OGQ C;  2KSE A;  2ZJS E;  5AVS B;  3VRA D;  1KV4 A;  3EWK A;  1JY2 O;  2KSJ A;  2GM4 A;  1T6A A;  5APW A;  2JDI H;  2C9N Y;  1HGV A;  1SQX D;  3KZI H;  4YXD D;  1YTZ I;  1ZRT E;  1KN7 A;  3VRB D;  1L0N D;  1X8Y A;  3CCV P;  4RES B;  4I6L A;  1KB9 E;  5CCH C;  1KYO D;  1J1E C;  3H25 A;  2O1J A;  1M1J B;  1NTK D;  2FBW D;  4Y99 C;  1JMB A;  2YMK A;  3AE8 C;  3FX0 A;  4BRY A;  1SQP E;  1SFC D;  4H44 C;  3VP9 A;  1YBK A;  1Y8A A;  1NTM E;  2H43 A;  2I1K A;  4I7Z C;  2WDV D;  1BGY G;  3CWB J;  5KAF E;  2RKL A;  3HUS C;  3SWF A;  4CPG A;  5KKZ C;  2L5G B;  1IJD B;  3WU2 H;  5AW2 B;  2OTK E;  1KQF B;  1RF0 A;  4PD4 D;  3GLM A;  1KYO H;  5APQ A;  1EDJ A;  1IFD A;  2FYN C;  3IF4 A;  3L70 D;  2OTJ P;  2I8D A;  2V4H A;  2KZJ A;  1NU1 G;  4DHJ A;  4YT0 D;  4WY4 A;  2HOD B;  1NKN A;  3VR8 C;  3TGU D;  2RN0 A;  1AQ5 A;  3TNU B;  1NEK D;  3H32 B;  2B76 C;  3C9I A;  1R5L A;  3G71 P;  3VN0 A;  4YSX C;  1N7S B;  3L73 G;  5APU A;  3AE9 C;  3P4R C;  3CMA P;  3CCM P;  5L8R J;  1W2B O;  4PD4 H;  3AEC D;  3H1H G;  2O3J A;  3GW6 A;  2R5B A;  5KAI H;  2AEJ A;  3MP7 B;  5KLV D;  3L74 D;  1FU1 A;  3H1J D;  3H1L E;  2WVR A;  4HB1 A;  1NAF A;  2OAR A;  1ZW0 A;  2B88 A;  5CJ0 A;  3CCR P;  2BCC E;  3M0D C;  2V7Q J;  1YJ9 P;  2ITA A;  3L71 G;  3U1A A;  5C2T D;  1RQU A;  1NTZ E;  1FZC C;  3RL0 D;  3S4R A;  1OXZ A;  1NO4 A;  4JPZ B;  1KFY D;  1KOR A;  1H0T B;  1VQL P;  1LTT C;  2E76 D;  1IK9 A;  3AEG C;  1SQQ D;  2Y0C A;  2KK7 A;  1RF1 B;  3WMM 0;  1BCC G;  3K5B A;  1PGJ A;  1G2C A;  4L73 A;  1L0L J;  1JY3 P;  1VQ4 P;  2IYP A;  3USS A;  1FC2 C;  1UII A;  1MFZ A;  1R8E A;  1YIJ P;  2ZAE B;  1QL1 A;  1EZV I;  1AQT A;  3CPW O;  3BRT B;  2OQQ A;  2P1J A;  1BGY E;  4NPD A;  1X9V A;  4U3F J;  3CCS P;  1IK7 A;  3CCE P;  1SQX G;  5CMZ A;  2G8Y A;  1NKZ B;  1ZRT D;  4DDI A;  1GL2 D;  1LTB C;  3CD6 P;  1L0N G;  4H13 D;  2YMY A;  3SWY A;  5AVV B;  3E1I A;  1NTK G;  3JC2 2;  1PGP A;  1T3U A;  1LWU A;  3RK2 D;  1FBM A;  3IFM A;  2M5A B;  1M1J A;  3MZW B;  3CXH D;  1DX7 A;  3R4Y A;  1DEE G;  3P4P C;  4FJV A;  3ABV C;  5C3J C;  1NU1 E;  2POH A;  3A5T A;  1CZQ A;  1S5L E;  2O01 J;  5AVW B;  3VYI A;  1IO4 A;  1AA0 A;  2WU5 C;  2B87 B;  3BAS A;  3L73 E;  1KF6 C;  2J5U A;  2WS3 D;  1M1K Q;  3H1H E;  1KB9 H;  3CCU P;  2ZT9 C;  2WSC H;  1XTG B;  3L70 G;  3Q3D A;  2QVA A;  3H1I J;  1FAV A;  3VMZ A;  2FYZ A;  4ZKU A;  1JTH A;  2RMZ A;  3L71 E;  4YTP D;  5KAF H;  4EYY Q;  1E7P C;  3TGU G;  5AW9 B;  3M9B A;  1USD A;  4OGQ B;  3HD7 C;  4LC1 A;  3H32 A;  1JY3 N;  4NPE A;  2FYU J;  1N7S A;  3V4Q A;  5KLV G;  2W27 A;  3L74 G;  1YQ4 D;  2QSI A;  3H1J G;  2YXR B;  1BCC E;  3AEB C;  1J1E B;  1PFI A;  1VF5 C;  2KLV A;  1HJB A;  3RK3 D;  3NXS A;  1XTC C; 
#chains in the Genus database with same CATH homology
 3AED D;  2FBW D;  3D6Y A;  3P4P C;  3ABV C;  5C2T D;  1RQU A;  3AE4 D;  3T97 B;  5C3J C;  4Y28 J;  2BEQ D;  4H44 B;  4PV1 C;  2YMK A;  2WSF J;  3AE8 C;  4YSX D;  3IN6 A;  4OGQ D;  1PIX A;  2O01 J;  2BEZ F;  4I7Z B;  3AE9 D;  4Z1M H;  3P4R D;  3AEF D;  4H0L C;  3CIR D;  3P4Q C;  3D71 A;  2E74 C;  4H13 B;  3S9O A;  3GF3 A;  1Q90 D;  2QJY C;  4H44 C;  4YTP C;  3GF7 A;  3AE7 D;  2E75 B;  3G9R A;  2H89 D;  1KFY D;  1KOR A;  1UIX A;  2WPV B;  4I7Z C;  2WDV D;  2H88 C;  3Q5S A;  1KQG B;  3SFE C;  2WU5 C;  2WSC J;  1KF6 C;  5M1B A;  1DIP A;  3RL0 g;  1NEN C;  2BS3 C;  3AEB D;  1DD3 A;  4YTM D;  2D2C B;  2J5U A;  2E76 D;  3AEG C;  1DD4 A;  2WS3 D;  1OW6 A;  2JP3 A;  3VR9 D;  5KKZ C;  3AEE C;  4YSY D;  4YT0 C;  1FDI A;  2E75 C;  2ZT9 B;  1VF5 D;  1L0V D;  2WU2 D;  3Q5R A;  3AEA C;  2WDR C;  3SFD D;  1YQ3 C;  2FXP A;  1NEK C;  3RK3 E;  3AE5 C;  2ACZ C;  4R4M A;  2D2C C;  1ZOY C;  3FGA D;  1AJY A;  4YSZ D;  1KQF B;  4KX6 D;  2ZT9 C;  1QLB C;  1ZP0 D;  1ZME C;  3AE2 C;  3P4S D;  3GLM A;  2YIU C;  3AE3 C;  3Q3D A;  3P4P D;  3ABV D;  5C3J D;  3VRA C;  2QJK C;  1HJ0 A;  4PV1 D;  3AE8 D;  1YQ4 C;  1PV3 A;  1FDO A;  1MKM A;  3AEC C;  2QJP C;  2FYN C;  4TT3 H;  3D6Z A;  3AE2 D;  4H0L D;  3P4Q D;  2WP9 C;  2E74 D;  4H13 C;  4H44 D;  2IDB A;  3LW5 J;  4YTP D;  1E7P C;  1VL2 A;  4YXD C;  2H88 D;  2G3A A;  4GDO A;  4U7J A;  2WU5 D;  2P10 A;  1GMJ A;  1R8E A;  1U57 A;  1KF6 D;  3SFE D;  1NEN D;  3VRB C;  3IAO A;  2JO1 A;  1WMK A;  3AEG D;  1KIL E;  2WQY C;  4YTN C;  3AE6 C;  3AEE D;  4YT0 D;  2QIW A;  2E75 D;  1Y9B A;  3AE1 C;  4OGQ B;  3AEA D;  3C8V A;  2WDR D;  3VR8 C;  1K04 A;  1NEK D;  1YQ3 D;  2NZ2 A;  2OQQ A;  1TU3 F;  2ACZ D;  2B76 C;  3AE5 D;  3AED C;  1KMI Z;  2FBW C;  2D2C D;  3B71 A;  1ZOY D;  5C2T C;  3AE4 C;  1IK7 A;  1JB0 J;  2ZT9 D;  3GMA A;  4YSX C;  4OGQ C;  3D70 A;  1EXI A;  4XFJ A;  1RQV A;  5KLI C;  2BS4 C;  3AE3 D;  3VRA D;  3AE9 C;  1NYH A;  2WDQ C;  3P4R C;  3AEF C;  3EWK A;  5L8R J;  1HF9 A;  2E74 B;  1YQ4 D;  3CIR C;  4R4L A;  1NGM B;  3AEC D;  2G8Y A;  2QSI A;  3Q5P A;  1OW8 A;  2E76 B;  3AE7 C;  1K05 A;  1VF5 B;  2H89 C;  2WP9 D;  4RKU J;  1KFY C;  2WDV C;  4H13 D;  1EXJ A;  2WDQ D;  2WSE J;  2K9Y A;  3Q2Y A;  2MKV A;  3AEB C;  4YTM C;  1OMI A;  2E76 C;  2WS3 C;  3VR9 C;  4YXD D;  1PL5 A;  1ZRT E;  4YSY C;  1L0V C;  1OW7 A;  1VF5 C;  3VRB D;  2WU2 C;  2V7Q J;  3O6Q A;  4KT0 J;  3SFD C;  2BS2 C;  4YTN D;  2WQY D;  3AE6 D;  4IL6 X;  4PV1 B;  1S5L X;  1S1C X;  3AE1 D;  3Q1M A;  4YSZ C;  3H25 A;  4KX6 C;  1KTM A;  3VR8 D;  3R4Y A;  2B76 D;  1ZP0 C;  4H0L B;  3P4S C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...