3AE2C

Crystal structure of porcine heart mitochondrial complex ii bound with 2-hydroxy-n-phenyl-benzamide
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
138
structure length
138
Chain Sequence
b'TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with 2-Hydroxy-N-phenyl-benzamide
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 47
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3ae2C01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3ae2C02
2WU2D 1QLBC 3VR8D 2BS3C 3AEFD 2WQYD 3AE5C 3AEED 2WP9D 1KFYD 2B76C 3VRBC 3SFEC 3CIRC 3AEDD 3P4QC 3VR9C 2H88C 1OW8A 1ZOYD 3AE3C 3P4RC 3AEBD 3P4PD 4KX6D 3SFDC 1ZP0C 4YSYD 3AEGC 2B76D 3S9OA 1NEKD 2WU5C 2BS2C 1OW6A 3AE9C 3P4RD 4YT0C 2ACZC 4YTMC 4YTPC 1NEND 3AECC 5C3JC 3AE7D 3AEAD 2WDQC 1E7PC 1YQ3D 3AEGD 1L0VC 4YSXC 2WDRD 4YSZD 2ACZD 3VRAC 3AE1C 3AE4C 2H89C 5C2TC 3AECD 3AE5D 3P4SC 3VRBD 3SFED 3CIRD 3P4QD 1YQ4C 3VR9D 2H88D 2FBWC 3AE3D 2WS3C 1K04A 3AE2C 3AE8C 2H89D 3SFDD 3AE6C 1KF6C 1K05A 1ZP0D 3ABVC 2WU2C 1PV3A 3AEFC 2WQYC 2WU5D 4YTNC 3AEEC 1KFYC 3AE9D 4YT0D 3AEDC 4YTMD 4YTPD 3AE8D 5C3JD 1ZOYC 2WDQD 3AEBC 4YXDC 4YTND 3P4PC 4KX6C 1L0VD 4YSXD 4YSYC 1OW7A 3B71A 1NEKC 2WDVC 3AE1D 3VRAD 3AE4D 5C2TD 3P4SD 2BS4C 3VR8C 1NENC 1YQ4D 4YXDD 2FBWD 2G3AA 3AE7C 2WS3D 2WP9C 3AEAC 1YQ3C 3AE2D 1KF6D 1KTMA 2WDVD 3AE6D 2WDRC 4YSZC 3ABVD
chains in the Genus database with same CATH superfamily
1BE3J 2KYVA 2FXOA 1MV8A 2WP9D 1IFJA 2XDJA 3RK2D 1PL5A 4PD4I 4YSYD 3MD0A 1YJ9P 1JO5A 2RH0A 3V2PA 3HRNA 2KSJA 2R32A 2Q3EA 1RF1C 3AE9C 2FYUG 1BE3E 4TLFA 3G71P 3CX5I 5KLVJ 2JKVA 4ZMDA 2YMYA 1OVUA 4IFFA 3O8ZA 4DOJA 3C1LA 1S2EA 3VRAC 1M1JC 3AE5D 2HLOA 5AVXB 1ZR2A 1YQ4C 4D6TE 5AW2B 3GHGA 4WB4A 5KLVE 4I2LC 4RO0A 2FYUD 1PV3A 1RE4C 3M9HA 1S1CX 3BRTB 5AVUB 1KORA 3B8EB 3VN0A 1FE6A 3CCVP 3WUUA 1LTJC 1UIIA 5AW0B 3P4PC 1EDIA 1GD2E 1GL2A 2FYUJ 1HVVA 4U3FG 1IFIA 1GZLA 1BGYG 1SP4A 5KAFE 2L91A 3LIDA 1R5SA 2Q1KA 4H44B 4BWNA 1N7LA 4H0LD 2R3SA 1KF6D 3FWLA 1HGZA 1MKMA 2OGUA 3L72E 1LTBC 3VRBC 2FYUE 1CI6A 1X79B 2H88C 4A7PA 4K3AA 5B66E 4U3FD 1BGYD 1SFCC 1N7SA 3A0HH 1LTIC 3U1AA 1JY3N 1K8AQ 1PPJE 1NEKD 1VF5C 1XTGB 2P58A 2OTJP 3VYIA 1SFCD 2HODA 3WUVA 3MHVA 3FXDA 3TNUA 4U3FJ 3P32A 2QJKC 3W68A 1VQ9P 1BGYJ 3F89A 1KD1Q 2KOGA 5DJUB 1DEEG 3I55P 1FDIA 2Z5HA 3H1KE 3AE6C 3UIAA 4I6LA 4U3FE 1VQMP 5BU5A 1BGYE 2M5AB 1YJNP 5AW9B 1KFYC 3D71A 2R5DA 3BASA 3TSIA 2JWAA 2YO2A 2OYHA 4YXWH 1KILC 4L75A 3B5NA 1U57A 4XA4A 3FXEA 1AJYA 1Z56A 1YTZI 4O9BA 3AE7C 3RL0C 3SWYA 2ZJSE 4H13C 4JYCA 2AEMA 1HBWA 2ZAEB 3II6A 2WVRA 1IFNA 1AQTA 4HKZH 3CIRC 2YIUC 2P2UA 4H13D 3AEBD 4R4LA 5KAIE 2JDIH 2E74B 3SFDC 4BRYB 2FYNC 1JTHA 3N4XA 2BS2C 4K35A 3Q1MA 2K9JA 1EDLA 2LR2A 1URQD 1YQ3D 3HE5B 1L0VC 3C8VA 3L75G 1RF0A 3AE4C 2MJZA 3P4SC 4IOIH 2XU6A 2QJPC 2IFMA 1EDKA 1PP9J 4JYBA 3NFQA 2WS3C 2WSFH 2Z4EA 1K05A 1HTLC 1JM0A 1WT6A 3WUTA 4YTNC 2ZYGA 3Q5SA 3GLMA 4YTMD 3EQ2A 1J1DC 3CCSP 5AVYB 3L75D 3WMM0 3GF3A 1PP9E 4YTND 1BSHA 5E79E 1PZQA 1SQQE 1NTZG 3AE1D 3SSUA 1SQPK 2ZT9D 2Q5UA 3R2PA 3VMZA 3KHUA 1KFNA 2VRSA 2HPCA 4Y28J 1IJDB 3M91A 2WT7B 1BDCA 2QRXA 4UB6E 1N73A 1JEKA 2BS3C 2WQYD 2WTYA 1OVVA 3FX0A 3RBXA 3AEDD 2JR8A 1GK6A 1ZOYD 2KIKA 2KZJA 3EWKA 3RL0B 4GOFA 2O01N 3LIEA 4KX6D 3HTKB 1ZLLA 2E76C 3CX5E 2O1JA 4YT0C 2QSIA 1A02F 3TGUG 3O6QA 5BVZA 2Y0CA 4UB8E 5AVWB 1FBMA 1NTZJ 4PV1B 1SQVK 2YMKA 2FYNB 2IYOA 1IO4A 2H89C 4WY4C 1L0LK 2NPSD 3CMAP 2UWJE 1VQPP 2H89D 1ZP0D 4Y99C 2PAJA 3ABVC 2FXPA 3RK3B 2BASA 3H6PA 2Y9ZA 1NTZE 1YBKA 2Z5IA 3AEFC 3H1HG 4EDFA 1JY2O 1NWQA 2ITAA 1DD4A 3OJAB 2QIWA 3HUSA 3B4SA 1EZVG 1L0NG 1L4AC 3TGUJ 2E75B 3IAOA 1NTMG 3CMEP 2KK7A 1J1DB 2YKPA 2H7HA 1HF9A 3H1HD 2B88A 3NTNA 1AVOA 2CPBA 3ZDMA 1MZ9A 1SQXG 3VP9A 2KZIA 4EYYQ 3TGUE 2I1JA 1EZVD 1GU5A 1L0ND 3L71G 3P4RC 3H1HJ 1NTMD 2W6JH 4DCKA 3H1IG 4KJMA 3S9OA 2OYIC 1J2JB 3M0DA 1AA0A 2WPQA 3P4RD 3H32A 1L0NJ 3AEAD 2IYPA 4I6MC 1YIJP 1SQXD 3A5TA 1NTMJ 3H1HE 3R4YA 3L71D 1QVGO 1PGQA 1Q90D 3VR9D 4C7NA 1JMBA 1CW5A 1KB9H 1DD3A 1NAYA 4IFDK 3NXSA 1SQXJ 4JF7A 4XFJA 1EZVE 2IFNA 1L0NE 3MZWB 1SLQA 1VDFA 3KZIH 4WY4B 1NTME 1VQ6P 1ZRTD 1URQA 3L71J 1LWUA 3FWNA 3L37A 4U7JA 5TISH 4YTPD 1KV4A 2WSEH 2KS1A 5B5EH 3U1CA 2J59M 2GUVA 3H1IJ 3A0HE 4DHIB 3GHGB 3LW5H 3JCUH 3A2AA 1OW7A 3V2NA 1SQXE 3CC2P 1LJ2A 4LC1A 3L71E 1AFOA 1LTTC 1S9KD 3L36A 1NOHA 2FFDC 4WVZA 1GL2B 3H1IE 4RESB 1JY3P 3AEED 2QEXP 1OX3A 2B89A 3MIWA 1LT9A 1FZGA 4JQ0D 1DX7A 2WWWA 4DT0A 4H44D 1JB0J 2KXPB 3TYYA 2CPSA 1GU4A 1LT1A 2N9YB 1K9MQ 2FY8A 2QJYC 3E7KA 2YKOA 2LXBA 3OAKA 1R5LA 2QM8A 1CI6B 1NEND 1MUUA 5C3JC 2M3EA 3MUDA 1RH5B 1BSNA 2MKVA 2IDBA 2OYIB 1S9KE 1NO4A 1QVFO 1CZQA 1KYOH 2HODB 3CLQA 4CPGA 1JCCA 2O1KA 2YKQA 1SS1A 2WU2C 1WMKA 1GTWA 2WMMA 3AE9D 4L76A 3G9RA 1NTKK 1NTKG 3W67A 5KLIB 4OGQC 3I56P 2KSEA 2RN0A 1D7MA 3PTZA 3VRAD 4HYTB 2WSFJ 2NPSA 2XNDH 3VR8C 2Q7CA 1VQLP 1YQ4D 5AW7B 2OYHB 2KB7P 2O3JA 3MTUE 1IK7A 1IFMA 1QLBC 3VR8D 1VQ5P 1NTKD 3P4QC 2LXCB 2ZVOB 3IN6A 3P8CD 5APWA 1KYOI 3P4PD 3CCLP 2FFDB 3E1RA 1KQLA 1VQ7P 5C39A 2Q9IA 5APSA 2E74C 2AXCA 2QE7H 3V5BA 2JO1A 2OQQA 2Y0DA 4MN4C 3Q2YA 5GTIH 1JTHB 3VMXA 2QJYB 1J1EB 3SWFA 1Y9BA 4OH8B 2K9JB 2N9BA 3VRBD 2K88A 3BRVB 1AVYA 2H88D 1RQUA 1K04A 1USDA 4JPZB 1H89A 1M7LA 5CCGC 3L74G 3H1LG 1QEXA 1LP1A 4IL6H 2P7JA 3P8CE 1VF5D 3N7NA 3I5CA 3GW6A 1OXZA 2JJLA 3CCUP 2KNCA 3TF5A 1HJ0A 3CCJP 1EXIA 1R8EA 1NKNA 3H1JG 2GUSA 2W90A 2C0XA 3RBZA 1QL2A 1T8ZA 3USSA 4EI2A 3L74D 1AQ5A 3H1LD 1EZVI 3RL0g 3AE6D 1BCCD 4OGQB 2Y0EA 1ZR4A 1HWTC 2AXTH 1ZMEC 2R5BA 4EIJA 2N1TC 1KFYD 1MFTA 3H1JD 3L74J 2HPCB 3VMYA 3H1LJ 3AE3C 1DIPA 3VTPC 1KILD 3AEGC 3KYQA 1KQFB 1T6AA 2WU5C 4OVNF 3FGAD 2R3CA 4WWIA 2OARA 1OMIA 2HFED 3H1JJ 3V2QA 3TDKA 1M57D 3AE7D 3AEGD 4L73A 3HD7C 3RL0D 3L74E 2BEQD 3H1LE 1AV1A 3V4QA 4PV1C 4AYCA 2D2CB 4H0LB 3CIRD 4RKUJ 5KJ7C 3O6QB 2FBWC 3VONA 1NGMB 1NU1K 1RE3A 1T2KC 3AE2C 4PV1D 3SFDD 2IBZI 3CC7P 1Q2NA 4IL6X 1KILE 1KB9D 1FU1A 3RK3C 4DDGA 1FZCA 1IZNB 2W27A 5CCHC 1L0VD 2GM4A 4AQRD 5L8RJ 3B71A 3AE4D 3P4SD 1YYCA 1ZW0A 3OA7A 5CCHD 2E75C 3IF4A 4M3LA 2WS3D 2H8PD 3BVHA 1ZN5A 3HUSB 1S72P 1FAVA 1RF1A 2WSEJ 3BCCG 1YI2P 1OIPA 2A06D 3LW5J 3OW2O 1SQPG 4HJGH 3HE4B 3A7OA 3F5HA 2WPRA 1M1JA 2ZVNB 3L75J 2POHA 2N1TB 5TISE 2NRGA 3A0BH 5B5EE 3G6EP 3GF7A 2A45H 1SQBK 3BCCD 2WDQC 4EOTA 4YSXC 1RE4A 2B87A 1SQPD 1MFZA 3L75E 1EC5A 3H25A 5EFWB 1LTJA 3H32B 3WU2H 1FS0E 3BCCJ 3HD7B 4LGDE 2JWDA 3SWKA 1LTSC 2E76D 1KYOD 2NZ2A 3CCMP 4NPEA 1SQPJ 1SQVG 5AW6B 4YT0D 3C9IA 4BRYA 1EQ7A 1L0LG 4GODA 3D70A 3BCCE 3S1KA 3GHGC 5APQA 3T97A 4WY4D 1GW4A 2K9YA 3HE5A 2KS1B 1H88A 1FDOA 1SFCA 1SQPE 3Q5PA 1IFDA 3CL3D 5APVA 1JY2N 1SQVD 1OWAA 5AW3B 3ABVD 2C9NY 1FDMA 3AEFD 1YHQP 1GL2C 1KYOE 1L0LD 1QGKB 4OWFA 1HH0A 2CK3H 1RY3A 1SQVJ 5AVTB 2WSCH 1PGOA 1LGHB 1HJBA 1QL1A 1L4AD 3KPEA 1IK9A 5CHXA 1NH4A 1LT9B 2ACZC 1L0LJ 4N3YB 3CI9A 1S5LH 1EXJA 1E7PC 4L74A 2ZT9B 5CJ0A 3M9QA 1M56D 1NKZB 3E1IA 1N7SC 2ACZD 1G2CB 1SQVE 5C2TC 1QLED 1IFPA 1WRGA 3PHLA 4KHXA 2K37A 1KILA 5DJTB 2E5TA 3K5BA 3VP8A 3AE8C 1L0LE 4RJTA 2IPPA 2WZ7A 4XE5B 5CBOA 3JSVC 3AE8D 2IBZG 5APXA 3HTKA 1K73Q 2AEFA 4NPFX 1P84H 3JC22 5KLIC 1NJIQ 1KFMA 3MP7B 1BDDA 1H0TA 2G3AA 2HG5D 1L2PA 5CBNA 5GTIE 2WDRC 2ZFYA 4YSZC 2OYHC 2IBZD 1N86A 1VL2A 3B5NC 3SFEC 2L5GB 4PJ0H 1HUCA 1M1KQ 5AW8B 2YO3A 4IL6E 3KDPB 4PD4H 1YJWP 1Q82Q 3KQGA 1GMJA 3D6YA 2QM7A 3IR9A 2P10A 1YTZT 1S5LX 1LTAC 2GA1A 2E5YA 1ZRTE 2FYZA 5AVRB 1KB9I 4D6TG 4W7ZA 2IBZE 1J1EC 1HGVA 2W6AA 5KLVK 2C9LY 5KLVG 2E43A 2BEZF 3S4RA 5BU8B 1N7SB 2XZRA 5GTHH 2AXTE 2DW3A 2SPZA 1RF0C 2V7QH 2WITA 5C3JD 2FKWB 1M8OB 1RHZB 1LP1B 4D6TD 4YSYC 3TNUB 3VOPA 4DJGA 5KLVD 2KNCB 4GT1A 2OYOA 3L72G 3KXDA 2V4HA 1S4XA 1NYHA 1LNQA 4KT0J 2WU2D 4D6TJ 2FYUK 2BCCG 4JBZA 4HB1A 2B9BA 3AE5C 3PH0A 1VQNP 3V2RA 2A45G 3D6ZA 1IC2A 3CXHH 2IZ0A 1LTGC 1PPJG 1FZAA 4OGQD 4WY4A 1N73C 3B5NB 2XV5A 3L72D 2ZXXA 1OZHA 1ZXGA 2BCCD 2J5UA 3PJSK 2ZYDA 4ZNCA 3L70G 2KP8A 1PPJD 2P1JA 3L72J 3P4QD 3H1KG 5H2FH 2D2CC 1NTKJ 1VQ8P 4H0LC 2BCCJ 2W83C 2JP3A 1L4AA 2PP6A 1KF6C 4N78D 4C7RA 4DHJA 2E74D 2KI7B 2D2CD 1KMIZ 1FOSF 3L70D 3CCEP 1VPCA 4YXDC 1FOSE 4DHZA 5KKZB 2J58A 3CXHI 4BXLA 1NTKE 2Y9YA 2BCCE 1T3JA 1M90Q 3H1KD 1NEKC 2WDVC 4YPCA 2P67A 4W80A 1TU3F 5M1BA 1DEBA 3A0BE 4YXDD 1FZCB 3RK2B 3L70J 1BCCG 5CCGD 1KC8Q 2WDVD 1JY3O 2OYIA 1XTCC 3HUSC 1TFFA 3H1KJ 4GKGA 4N78E 3WU2E 1PIXA 4FJVA 2M0BA 3M9BA 2IX7C 3CPWO 3G3ZA 3L70E 1RF1B 1Q81Q 2WPSA 3P7KA 1OW6A 3M0AA 1DH3A 1FC2C 2E42A 5K5GB 1FZFA 1M1JB 1PGPA 2C0WA 5AVQB 1N73B 1BCCJ 2N1TD 3IFMA 3TK1A 2WSCJ 3M0DC 3AE3D 3V6IA 4LLHA 5APTA 3BATA 1PGJA 2K3RA 2B87B 3CC4P 2WU5D 1NHLA 2O01H 2YXQB 1GDTA 1LTJB 3PP5A 2YXRB 1PP9G 2FFDA 1BCCE 4R4MA 2HR3A 1SQQK 3AEBC 1SQQG 3HD7D 4GDOA 1U7MA 1FJKA 2QVAA 1JY2P 1VQ4P 1W2EA 1U7JA 3G4SP 1FZEA 2M8RA 2FXMA 1NU1G 3H1JE 4QMAA 4GOEA 3L73G 1FZBA 2KUBA 1P84D 5APUA 2R44A 2ZYAA 5KJ7D 3M06A 1KN7A 2FBWD 1S5LE 1URQC 1LWUC 1YQ3C 1T2KD 3AE2D 1KTMA 5AW5B 3GG2A 1KZUB 1PP9D 3MGNA 3T97B 1UIXA 2A06G 3CWBG 1SQQD 3RK3D 5KTBA 3EFFK 1SFCB 1OW8A 1NU1D 4GIFA 3CCRP 2W6BA 3L73D 1VF5B 1OVRA 4ZKUA 1X0TA 1N8RQ 4IFMA 3L35A 1JCDA 1USEA 1SQQJ 4YTMC 2E75D 5KAFH 2QJKB 1X8YA 1LT9C 1NU1J 4PD4D 1X22A 2I1KA 5TJHA 1P84E 3CWBD 3L73J 1KB9E 2ZFCA 4ZKPA 4I7ZC 4I1LA 2I8DA 3AE1C 2ZT9C 2M5AA 3CX5D 1E79H 3KZIE 3Q3DA 5B66H 3RK3E 1NTZK 3CWBJ 3MUDC 1SQBG 1NU1E 2WQYC 3JCUE 3L73E 1CSBA 2PGDA 1GW3A 3AEDC 4N6JA 1KILB 3EFGA 4PJ0E 2KLVA 1ZOYC 4HH2A 2WDQD 4KX6C 4YSXD 1W2BO 4PD4E 1A02J 2A06E 2PFXA 3CWBE 4W7YA 2IZ1A 4ASVA 1NTZD 1SQBD 2WPVB 1KQGB 1NVOA 1RQVA 4H13B 1Q7YQ 2HYNA 4C7NB 1E5WA 1KQSO 1X9VA 1Y8AA 2V7QJ 1VQKP 4WBAA 4NPDA 2YIUB 3PLNA 1H0TB 3Q5RA 3CD6P 1SQBJ 1URQB 2NPSC 3CCQP 1LWUB 1ZP0C 1S3JA 2WSSH 5GTHE 3CXHD 3PRJA 2A45I 1W5CE 3VMAA 2K1AA 5CCGA 2H43A 2W8ZA 2OTLP 5AVZB 3TGUD 1YITP 1QX8A 1SQBE 2QJPB 1GL2D 1OFCX 1Q86Q 2XKMA 1L0NK 5AVSB 2QG4A 4C46A 2KLUA 5KAIH 5AW1B 2G8YA 1NTMK 4I7ZB 3NMDA 1GK4A 2RMZA 3HE4A 3L4FA 3CXHE 2M3BA 2WT7A 5APYA 1T3UA 1SQXK 3ITKA 2N1TA 1Y47A 1NAFA 1N7SD 1H8AA 3A3YB 5C2TD 3RGUA 1VQOP 4DDIA 3AEAC 1PFIA 4TT3H 4Z1MH 1G1IA 2B76C 2Q6QA 3VR9C 3HD7A 5H2FE 2QA4P 2E76B 2PRRA 3QH9A 5E79H 5AW4B 2B76D 1SVFA 1JUNA 5KJ7A 2OTKE 1JNMA 3H1ID 4LDTA 1EDJA 4YTPC 2LKMA 3QWOC 2JEEA 3AECC 4DZOA 2NPSB 1JMMA 4B86A 4UB6H 2WDRD 4YSZD 3V4WA 3B5ND 3AECD 2XNXA 3SFED 2ZXEB 5CCHA 1BE3G 4Y99B 2Q3IA 5CMZA 3P8MC 1N2DC 2AEJA 1ZV8A 3CX5H 3AEEC 5CJ4A 1P84I 2YNYA 4AUWA 4H44C 4UB8H 1JOCA 3U59A 1L4AB 5AVVB 1G1JA 1RE3C 3GMAA 2RKLA 1BE3D 1FJPA 5KKZC 2BS4C 1NENC 2WP9C 1FZCC 4ASWA 1G2CA 3RK2C 2O01J
chains in the Genus database with same CATH topology
1MKMA 1IK7A 1NYHA 4KT0J 4H13C 1QLBC 2WU2D 3VR8D 2WSEJ 2BS3C 2V7QJ 1VL2A 3T97B 2WQYD 3AEFD 1UIXA 3AE5C 1ZMEC 3AEED 2WP9D 1KFYD 2B76C 3VRBC 3SFEC 3CIRC 3AEDD 3P4QC 3VR9C 3LW5J 2H88C 3D6ZA 1PIXA 1OW8A 3Q5RA 1ZOYD 3AE3C 2E76B 2YIUC 4H44D 3EWKA 1DIPA 3IN6A 1PL5A 4H13D 3P4RC 1JB0J 3AEBD 4R4LA 1VF5B 3P4PD 4KX6D 2E74B 3SFDC 4OGQD 1ZP0C 2E76C 4YSYD 3AEGC 2B76D 2FYNC 3S9OA 1VF5C 1KQFB 1NEKD 2WU5C 2QJYC 2E74C 2BS2C 3FGAD 1OMIA 1OW6A 1GMJA 3AE9C 3Q1MA 2QSIA 3D6YA 2ACZC 3P4RD 4YTPC 1NEND 4YT0C 2P10A 2E75D 4YTMC 3GF7A 3O6QA 3AECC 5C3JC 2JO1A 2OQQA 2J5UA 1S5LX 3AE7D 3AEAD 1EXJA 1E7PC 1YQ3D 2WDQC 3AEGD 4PV1B 2BEQD 2QJKC 1L0VC 4YSXC 2ZT9B 2YMKA 3C8VA 3Q2YA 2WDRD 4YSZD 1ZRTE 4I7ZC 2MKVA 4PV1C 2ACZD 2IDBA 3R4YA 3VRAC 3AE1C 3AE4C 2H89C 5C2TC 2ZT9C 3AECD 3AE5D 3P4SC 1Y9BA 2D2CB 4H0LB 3VRBD 3SFED 2QJPC 3CIRD 3H25A 4RKUJ 3P4QD 1YQ4C 3VR9D 1Q90D 2H88D 2FBWC 2WSCJ 1RQUA 3Q3DA 1NGMB 2D2CC 3AE3D 2WS3C 4H0LC 1K04A 3AE2C 3RK3E 2JP3A 1DD3A 1FDIA 3AE8C 4PV1D 2H89D 3SFDD 3AE6C 2BEZF 1K05A 2G8YA 4XFJA 2E76D 1KF6C 3ABVC 1ZP0D 2WU2C 4IL6X 2FXPA 1WMKA 2NZ2A 4I7ZB 1PV3A 1VF5D 2WQYC 3AEFC 2WU5D 2E74D 4YTNC 1KILE 3AEEC 2D2CD 1KMIZ 3Q5SA 1KFYC 3GLMA 3AE9D 1S1CX 4U7JA 3D71A 3AEDC 4YT0D 4YTMD 4YTPD 3AE8D 3G9RA 1HJ0A 1KORA 5C3JD 1ZOYC 4H44C 4R4MA 2WDRC 2WDQD 1EXIA 3AEBC 1R8EA 4GDOA 3GF3A 4YXDC 3ABVD 1DD4A 4YTND 3P4PC 2QIWA 1L0VD 4KX6C 4YSXD 4OGQC 4YSYC 3GMAA 5L8RJ 1U57A 1OW7A 3D70A 1AJYA 3B71A 5KKZC 1NEKC 2E75B 2WDVC 3AE1D 3AE4D 3VRAD 5C2TD 2ZT9D 1TU3F 2WSFJ 3IAOA 5KLIC 5M1BA 2BS4C 3P4SD 3VR8C 2K9YA 1NENC 1YQ4D 4YXDD 2E75C 1FDOA 2FBWD 3Q5PA 2WPVB 4Y28J 4TT3H 1KQGB 2G3AA 3AE7C 4H44B 2WP9C 2WS3D 3AEAC 4H0LD 1YQ3C 1RQVA 4H13B 1HF9A 3AE2D 3RL0g 1KTMA 2WDVD 3AE6D 1KF6D 4OGQB 2O01J 4YSZC 4Z1MH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WU2 D;  1QLB C;  3VR8 D;  2BS3 C;  3AEF D;  2WQY D;  3AE5 C;  3AEE D;  2WP9 D;  1KFY D;  2B76 C;  3VRB C;  3SFE C;  3CIR C;  3AED D;  3P4Q C;  3VR9 C;  2H88 C;  1OW8 A;  1ZOY D;  3AE3 C;  3P4R C;  3AEB D;  3P4P D;  4KX6 D;  3SFD C;  1ZP0 C;  4YSY D;  3AEG C;  2B76 D;  3S9O A;  1NEK D;  2WU5 C;  2BS2 C;  1OW6 A;  3AE9 C;  3P4R D;  4YT0 C;  2ACZ C;  4YTM C;  4YTP C;  1NEN D;  3AEC C;  5C3J C;  3AE7 D;  3AEA D;  2WDQ C;  1E7P C;  1YQ3 D;  3AEG D;  1L0V C;  4YSX C;  2WDR D;  4YSZ D;  2ACZ D;  3VRA C;  3AE1 C;  3AE4 C;  2H89 C;  5C2T C;  3AEC D;  3AE5 D;  3P4S C;  3VRB D;  3SFE D;  3CIR D;  3P4Q D;  1YQ4 C;  3VR9 D;  2H88 D;  2FBW C;  3AE3 D;  2WS3 C;  1K04 A;  3AE2 C;  3AE8 C;  2H89 D;  3SFD D;  3AE6 C;  1KF6 C;  1K05 A;  1ZP0 D;  3ABV C;  2WU2 C;  1PV3 A;  3AEF C;  2WQY C;  2WU5 D;  4YTN C;  3AEE C;  1KFY C;  3AE9 D;  4YT0 D;  3AED C;  4YTM D;  4YTP D;  3AE8 D;  5C3J D;  1ZOY C;  2WDQ D;  3AEB C;  4YXD C;  4YTN D;  3P4P C;  4KX6 C;  1L0V D;  4YSX D;  4YSY C;  1OW7 A;  3B71 A;  1NEK C;  2WDV C;  3AE1 D;  3VRA D;  3AE4 D;  5C2T D;  3P4S D;  2BS4 C;  3VR8 C;  1NEN C;  1YQ4 D;  4YXD D;  2FBW D;  2G3A A;  3AE7 C;  2WS3 D;  2WP9 C;  3AEA C;  1YQ3 C;  3AE2 D;  1KF6 D;  1KTM A;  2WDV D;  3AE6 D;  2WDR C;  4YSZ C;  3ABV D; 
#chains in the Genus database with same CATH topology
 1BE3 J;  2KYV A;  2FXO A;  1MV8 A;  2WP9 D;  1IFJ A;  2XDJ A;  3RK2 D;  1PL5 A;  4PD4 I;  4YSY D;  3MD0 A;  1YJ9 P;  1JO5 A;  2RH0 A;  3V2P A;  3HRN A;  2KSJ A;  2R32 A;  2Q3E A;  1RF1 C;  3AE9 C;  2FYU G;  1BE3 E;  4TLF A;  3G71 P;  3CX5 I;  5KLV J;  2JKV A;  4ZMD A;  2YMY A;  1OVU A;  4IFF A;  3O8Z A;  4DOJ A;  3C1L A;  1S2E A;  3VRA C;  1M1J C;  3AE5 D;  2HLO A;  5AVX B;  1ZR2 A;  1YQ4 C;  4D6T E;  5AW2 B;  3GHG A;  4WB4 A;  5KLV E;  4I2L C;  4RO0 A;  2FYU D;  1PV3 A;  1RE4 C;  3M9H A;  1S1C X;  3BRT B;  5AVU B;  1KOR A;  3B8E B;  3VN0 A;  1FE6 A;  3CCV P;  3WUU A;  1LTJ C;  1UII A;  5AW0 B;  3P4P C;  1EDI A;  1GD2 E;  1GL2 A;  2FYU J;  1HVV A;  4U3F G;  1IFI A;  1GZL A;  1BGY G;  1SP4 A;  5KAF E;  2L91 A;  3LID A;  1R5S A;  2Q1K A;  4H44 B;  4BWN A;  1N7L A;  4H0L D;  2R3S A;  1KF6 D;  3FWL A;  1HGZ A;  1MKM A;  2OGU A;  3L72 E;  1LTB C;  3VRB C;  2FYU E;  1CI6 A;  1X79 B;  2H88 C;  4A7P A;  4K3A A;  5B66 E;  4U3F D;  1BGY D;  1SFC C;  1N7S A;  3A0H H;  1LTI C;  3U1A A;  1JY3 N;  1K8A Q;  1PPJ E;  1NEK D;  1VF5 C;  1XTG B;  2P58 A;  2OTJ P;  3VYI A;  1SFC D;  2HOD A;  3WUV A;  3MHV A;  3FXD A;  3TNU A;  4U3F J;  3P32 A;  2QJK C;  3W68 A;  1VQ9 P;  1BGY J;  3F89 A;  1KD1 Q;  2KOG A;  5DJU B;  1DEE G;  3I55 P;  1FDI A;  2Z5H A;  3H1K E;  3AE6 C;  3UIA A;  4I6L A;  4U3F E;  1VQM P;  5BU5 A;  1BGY E;  2M5A B;  1YJN P;  5AW9 B;  1KFY C;  3D71 A;  2R5D A;  3BAS A;  3TSI A;  2JWA A;  2YO2 A;  2OYH A;  4YXW H;  1KIL C;  4L75 A;  3B5N A;  1U57 A;  4XA4 A;  3FXE A;  1AJY A;  1Z56 A;  1YTZ I;  4O9B A;  3AE7 C;  3RL0 C;  3SWY A;  2ZJS E;  4H13 C;  4JYC A;  2AEM A;  1HBW A;  2ZAE B;  3II6 A;  2WVR A;  1IFN A;  1AQT A;  4HKZ H;  3CIR C;  2YIU C;  2P2U A;  4H13 D;  3AEB D;  4R4L A;  5KAI E;  2JDI H;  2E74 B;  3SFD C;  4BRY B;  2FYN C;  1JTH A;  3N4X A;  2BS2 C;  4K35 A;  3Q1M A;  2K9J A;  1EDL A;  2LR2 A;  1URQ D;  1YQ3 D;  3HE5 B;  1L0V C;  3C8V A;  3L75 G;  1RF0 A;  3AE4 C;  2MJZ A;  3P4S C;  4IOI H;  2XU6 A;  2QJP C;  2IFM A;  1EDK A;  1PP9 J;  4JYB A;  3NFQ A;  2WS3 C;  2WSF H;  2Z4E A;  1K05 A;  1HTL C;  1JM0 A;  1WT6 A;  3WUT A;  4YTN C;  2ZYG A;  3Q5S A;  3GLM A;  4YTM D;  3EQ2 A;  1J1D C;  3CCS P;  5AVY B;  3L75 D;  3WMM 0;  3GF3 A;  1PP9 E;  4YTN D;  1BSH A;  5E79 E;  1PZQ A;  1SQQ E;  1NTZ G;  3AE1 D;  3SSU A;  1SQP K;  2ZT9 D;  2Q5U A;  3R2P A;  3VMZ A;  3KHU A;  1KFN A;  2VRS A;  2HPC A;  4Y28 J;  1IJD B;  3M91 A;  2WT7 B;  1BDC A;  2QRX A;  4UB6 E;  1N73 A;  1JEK A;  2BS3 C;  2WQY D;  2WTY A;  1OVV A;  3FX0 A;  3RBX A;  3AED D;  2JR8 A;  1GK6 A;  1ZOY D;  2KIK A;  2KZJ A;  3EWK A;  3RL0 B;  4GOF A;  2O01 N;  3LIE A;  4KX6 D;  3HTK B;  1ZLL A;  2E76 C;  3CX5 E;  2O1J A;  4YT0 C;  2QSI A;  1A02 F;  3TGU G;  3O6Q A;  5BVZ A;  2Y0C A;  4UB8 E;  5AVW B;  1FBM A;  1NTZ J;  4PV1 B;  1SQV K;  2YMK A;  2FYN B;  2IYO A;  1IO4 A;  2H89 C;  4WY4 C;  1L0L K;  2NPS D;  3CMA P;  2UWJ E;  1VQP P;  2H89 D;  1ZP0 D;  4Y99 C;  2PAJ A;  3ABV C;  2FXP A;  3RK3 B;  2BAS A;  3H6P A;  2Y9Z A;  1NTZ E;  1YBK A;  2Z5I A;  3AEF C;  3H1H G;  4EDF A;  1JY2 O;  1NWQ A;  2ITA A;  1DD4 A;  3OJA B;  2QIW A;  3HUS A;  3B4S A;  1EZV G;  1L0N G;  1L4A C;  3TGU J;  2E75 B;  3IAO A;  1NTM G;  3CME P;  2KK7 A;  1J1D B;  2YKP A;  2H7H A;  1HF9 A;  3H1H D;  2B88 A;  3NTN A;  1AVO A;  2CPB A;  3ZDM A;  1MZ9 A;  1SQX G;  3VP9 A;  2KZI A;  4EYY Q;  3TGU E;  2I1J A;  1EZV D;  1GU5 A;  1L0N D;  3L71 G;  3P4R C;  3H1H J;  1NTM D;  2W6J H;  4DCK A;  3H1I G;  4KJM A;  3S9O A;  2OYI C;  1J2J B;  3M0D A;  1AA0 A;  2WPQ A;  3P4R D;  3H32 A;  1L0N J;  3AEA D;  2IYP A;  4I6M C;  1YIJ P;  1SQX D;  3A5T A;  1NTM J;  3H1H E;  3R4Y A;  3L71 D;  1QVG O;  1PGQ A;  1Q90 D;  3VR9 D;  4C7N A;  1JMB A;  1CW5 A;  1KB9 H;  1DD3 A;  1NAY A;  4IFD K;  3NXS A;  1SQX J;  4JF7 A;  4XFJ A;  1EZV E;  2IFN A;  1L0N E;  3MZW B;  1SLQ A;  1VDF A;  3KZI H;  4WY4 B;  1NTM E;  1VQ6 P;  1ZRT D;  1URQ A;  3L71 J;  1LWU A;  3FWN A;  3L37 A;  4U7J A;  5TIS H;  4YTP D;  1KV4 A;  2WSE H;  2KS1 A;  5B5E H;  3U1C A;  2J59 M;  2GUV A;  3H1I J;  3A0H E;  4DHI B;  3GHG B;  3LW5 H;  3JCU H;  3A2A A;  1OW7 A;  3V2N A;  1SQX E;  3CC2 P;  1LJ2 A;  4LC1 A;  3L71 E;  1AFO A;  1LTT C;  1S9K D;  3L36 A;  1NOH A;  2FFD C;  4WVZ A;  1GL2 B;  3H1I E;  4RES B;  1JY3 P;  3AEE D;  2QEX P;  1OX3 A;  2B89 A;  3MIW A;  1LT9 A;  1FZG A;  4JQ0 D;  1DX7 A;  2WWW A;  4DT0 A;  4H44 D;  1JB0 J;  2KXP B;  3TYY A;  2CPS A;  1GU4 A;  1LT1 A;  2N9Y B;  1K9M Q;  2FY8 A;  2QJY C;  3E7K A;  2YKO A;  2LXB A;  3OAK A;  1R5L A;  2QM8 A;  1CI6 B;  1NEN D;  1MUU A;  5C3J C;  2M3E A;  3MUD A;  1RH5 B;  1BSN A;  2MKV A;  2IDB A;  2OYI B;  1S9K E;  1NO4 A;  1QVF O;  1CZQ A;  1KYO H;  2HOD B;  3CLQ A;  4CPG A;  1JCC A;  2O1K A;  2YKQ A;  1SS1 A;  2WU2 C;  1WMK A;  1GTW A;  2WMM A;  3AE9 D;  4L76 A;  3G9R A;  1NTK K;  1NTK G;  3W67 A;  5KLI B;  4OGQ C;  3I56 P;  2KSE A;  2RN0 A;  1D7M A;  3PTZ A;  3VRA D;  4HYT B;  2WSF J;  2NPS A;  2XND H;  3VR8 C;  2Q7C A;  1VQL P;  1YQ4 D;  5AW7 B;  2OYH B;  2KB7 P;  2O3J A;  3MTU E;  1IK7 A;  1IFM A;  1QLB C;  3VR8 D;  1VQ5 P;  1NTK D;  3P4Q C;  2LXC B;  2ZVO B;  3IN6 A;  3P8C D;  5APW A;  1KYO I;  3P4P D;  3CCL P;  2FFD B;  3E1R A;  1KQL A;  1VQ7 P;  5C39 A;  2Q9I A;  5APS A;  2E74 C;  2AXC A;  2QE7 H;  3V5B A;  2JO1 A;  2OQQ A;  2Y0D A;  4MN4 C;  3Q2Y A;  5GTI H;  1JTH B;  3VMX A;  2QJY B;  1J1E B;  3SWF A;  1Y9B A;  4OH8 B;  2K9J B;  2N9B A;  3VRB D;  2K88 A;  3BRV B;  1AVY A;  2H88 D;  1RQU A;  1K04 A;  1USD A;  4JPZ B;  1H89 A;  1M7L A;  5CCG C;  3L74 G;  3H1L G;  1QEX A;  1LP1 A;  4IL6 H;  2P7J A;  3P8C E;  1VF5 D;  3N7N A;  3I5C A;  3GW6 A;  1OXZ A;  2JJL A;  3CCU P;  2KNC A;  3TF5 A;  1HJ0 A;  3CCJ P;  1EXI A;  1R8E A;  1NKN A;  3H1J G;  2GUS A;  2W90 A;  2C0X A;  3RBZ A;  1QL2 A;  1T8Z A;  3USS A;  4EI2 A;  3L74 D;  1AQ5 A;  3H1L D;  1EZV I;  3RL0 g;  3AE6 D;  1BCC D;  4OGQ B;  2Y0E A;  1ZR4 A;  1HWT C;  2AXT H;  1ZME C;  2R5B A;  4EIJ A;  2N1T C;  1KFY D;  1MFT A;  3H1J D;  3L74 J;  2HPC B;  3VMY A;  3H1L J;  3AE3 C;  1DIP A;  3VTP C;  1KIL D;  3AEG C;  3KYQ A;  1KQF B;  1T6A A;  2WU5 C;  4OVN F;  3FGA D;  2R3C A;  4WWI A;  2OAR A;  1OMI A;  2HFE D;  3H1J J;  3V2Q A;  3TDK A;  1M57 D;  3AE7 D;  3AEG D;  4L73 A;  3HD7 C;  3RL0 D;  3L74 E;  2BEQ D;  3H1L E;  1AV1 A;  3V4Q A;  4PV1 C;  4AYC A;  2D2C B;  4H0L B;  3CIR D;  4RKU J;  5KJ7 C;  3O6Q B;  2FBW C;  3VON A;  1NGM B;  1NU1 K;  1RE3 A;  1T2K C;  3AE2 C;  4PV1 D;  3SFD D;  2IBZ I;  3CC7 P;  1Q2N A;  4IL6 X;  1KIL E;  1KB9 D;  1FU1 A;  3RK3 C;  4DDG A;  1FZC A;  1IZN B;  2W27 A;  5CCH C;  1L0V D;  2GM4 A;  4AQR D;  5L8R J;  3B71 A;  3AE4 D;  3P4S D;  1YYC A;  1ZW0 A;  3OA7 A;  5CCH D;  2E75 C;  3IF4 A;  4M3L A;  2WS3 D;  2H8P D;  3BVH A;  1ZN5 A;  3HUS B;  1S72 P;  1FAV A;  1RF1 A;  2WSE J;  3BCC G;  1YI2 P;  1OIP A;  2A06 D;  3LW5 J;  3OW2 O;  1SQP G;  4HJG H;  3HE4 B;  3A7O A;  3F5H A;  2WPR A;  1M1J A;  2ZVN B;  3L75 J;  2POH A;  2N1T B;  5TIS E;  2NRG A;  3A0B H;  5B5E E;  3G6E P;  3GF7 A;  2A45 H;  1SQB K;  3BCC D;  2WDQ C;  4EOT A;  4YSX C;  1RE4 A;  2B87 A;  1SQP D;  1MFZ A;  3L75 E;  1EC5 A;  3H25 A;  5EFW B;  1LTJ A;  3H32 B;  3WU2 H;  1FS0 E;  3BCC J;  3HD7 B;  4LGD E;  2JWD A;  3SWK A;  1LTS C;  2E76 D;  1KYO D;  2NZ2 A;  3CCM P;  4NPE A;  1SQP J;  1SQV G;  5AW6 B;  4YT0 D;  3C9I A;  4BRY A;  1EQ7 A;  1L0L G;  4GOD A;  3D70 A;  3BCC E;  3S1K A;  3GHG C;  5APQ A;  3T97 A;  4WY4 D;  1GW4 A;  2K9Y A;  3HE5 A;  2KS1 B;  1H88 A;  1FDO A;  1SFC A;  1SQP E;  3Q5P A;  1IFD A;  3CL3 D;  5APV A;  1JY2 N;  1SQV D;  1OWA A;  5AW3 B;  3ABV D;  2C9N Y;  1FDM A;  3AEF D;  1YHQ P;  1GL2 C;  1KYO E;  1L0L D;  1QGK B;  4OWF A;  1HH0 A;  2CK3 H;  1RY3 A;  1SQV J;  5AVT B;  2WSC H;  1PGO A;  1LGH B;  1HJB A;  1QL1 A;  1L4A D;  3KPE A;  1IK9 A;  5CHX A;  1NH4 A;  1LT9 B;  2ACZ C;  1L0L J;  4N3Y B;  3CI9 A;  1S5L H;  1EXJ A;  1E7P C;  4L74 A;  2ZT9 B;  5CJ0 A;  3M9Q A;  1M56 D;  1NKZ B;  3E1I A;  1N7S C;  2ACZ D;  1G2C B;  1SQV E;  5C2T C;  1QLE D;  1IFP A;  1WRG A;  3PHL A;  4KHX A;  2K37 A;  1KIL A;  5DJT B;  2E5T A;  3K5B A;  3VP8 A;  3AE8 C;  1L0L E;  4RJT A;  2IPP A;  2WZ7 A;  4XE5 B;  5CBO A;  3JSV C;  3AE8 D;  2IBZ G;  5APX A;  3HTK A;  1K73 Q;  2AEF A;  4NPF X;  1P84 H;  3JC2 2;  5KLI C;  1NJI Q;  1KFM A;  3MP7 B;  1BDD A;  1H0T A;  2G3A A;  2HG5 D;  1L2P A;  5CBN A;  5GTI E;  2WDR C;  2ZFY A;  4YSZ C;  2OYH C;  2IBZ D;  1N86 A;  1VL2 A;  3B5N C;  3SFE C;  2L5G B;  4PJ0 H;  1HUC A;  1M1K Q;  5AW8 B;  2YO3 A;  4IL6 E;  3KDP B;  4PD4 H;  1YJW P;  1Q82 Q;  3KQG A;  1GMJ A;  3D6Y A;  2QM7 A;  3IR9 A;  2P10 A;  1YTZ T;  1S5L X;  1LTA C;  2GA1 A;  2E5Y A;  1ZRT E;  2FYZ A;  5AVR B;  1KB9 I;  4D6T G;  4W7Z A;  2IBZ E;  1J1E C;  1HGV A;  2W6A A;  5KLV K;  2C9L Y;  5KLV G;  2E43 A;  2BEZ F;  3S4R A;  5BU8 B;  1N7S B;  2XZR A;  5GTH H;  2AXT E;  2DW3 A;  2SPZ A;  1RF0 C;  2V7Q H;  2WIT A;  5C3J D;  2FKW B;  1M8O B;  1RHZ B;  1LP1 B;  4D6T D;  4YSY C;  3TNU B;  3VOP A;  4DJG A;  5KLV D;  2KNC B;  4GT1 A;  2OYO A;  3L72 G;  3KXD A;  2V4H A;  1S4X A;  1NYH A;  1LNQ A;  4KT0 J;  2WU2 D;  4D6T J;  2FYU K;  2BCC G;  4JBZ A;  4HB1 A;  2B9B A;  3AE5 C;  3PH0 A;  1VQN P;  3V2R A;  2A45 G;  3D6Z A;  1IC2 A;  3CXH H;  2IZ0 A;  1LTG C;  1PPJ G;  1FZA A;  4OGQ D;  4WY4 A;  1N73 C;  3B5N B;  2XV5 A;  3L72 D;  2ZXX A;  1OZH A;  1ZXG A;  2BCC D;  2J5U A;  3PJS K;  2ZYD A;  4ZNC A;  3L70 G;  2KP8 A;  1PPJ D;  2P1J A;  3L72 J;  3P4Q D;  3H1K G;  5H2F H;  2D2C C;  1NTK J;  1VQ8 P;  4H0L C;  2BCC J;  2W83 C;  2JP3 A;  1L4A A;  2PP6 A;  1KF6 C;  4N78 D;  4C7R A;  4DHJ A;  2E74 D;  2KI7 B;  2D2C D;  1KMI Z;  1FOS F;  3L70 D;  3CCE P;  1VPC A;  4YXD C;  1FOS E;  4DHZ A;  5KKZ B;  2J58 A;  3CXH I;  4BXL A;  1NTK E;  2Y9Y A;  2BCC E;  1T3J A;  1M90 Q;  3H1K D;  1NEK C;  2WDV C;  4YPC A;  2P67 A;  4W80 A;  1TU3 F;  5M1B A;  1DEB A;  3A0B E;  4YXD D;  1FZC B;  3RK2 B;  3L70 J;  1BCC G;  5CCG D;  1KC8 Q;  2WDV D;  1JY3 O;  2OYI A;  1XTC C;  3HUS C;  1TFF A;  3H1K J;  4GKG A;  4N78 E;  3WU2 E;  1PIX A;  4FJV A;  2M0B A;  3M9B A;  2IX7 C;  3CPW O;  3G3Z A;  3L70 E;  1RF1 B;  1Q81 Q;  2WPS A;  3P7K A;  1OW6 A;  3M0A A;  1DH3 A;  1FC2 C;  2E42 A;  5K5G B;  1FZF A;  1M1J B;  1PGP A;  2C0W A;  5AVQ B;  1N73 B;  1BCC J;  2N1T D;  3IFM A;  3TK1 A;  2WSC J;  3M0D C;  3AE3 D;  3V6I A;  4LLH A;  5APT A;  3BAT A;  1PGJ A;  2K3R A;  2B87 B;  3CC4 P;  2WU5 D;  1NHL A;  2O01 H;  2YXQ B;  1GDT A;  1LTJ B;  3PP5 A;  2YXR B;  1PP9 G;  2FFD A;  1BCC E;  4R4M A;  2HR3 A;  1SQQ K;  3AEB C;  1SQQ G;  3HD7 D;  4GDO A;  1U7M A;  1FJK A;  2QVA A;  1JY2 P;  1VQ4 P;  1W2E A;  1U7J A;  3G4S P;  1FZE A;  2M8R A;  2FXM A;  1NU1 G;  3H1J E;  4QMA A;  4GOE A;  3L73 G;  1FZB A;  2KUB A;  1P84 D;  5APU A;  2R44 A;  2ZYA A;  5KJ7 D;  3M06 A;  1KN7 A;  2FBW D;  1S5L E;  1URQ C;  1LWU C;  1YQ3 C;  1T2K D;  3AE2 D;  1KTM A;  5AW5 B;  3GG2 A;  1KZU B;  1PP9 D;  3MGN A;  3T97 B;  1UIX A;  2A06 G;  3CWB G;  1SQQ D;  3RK3 D;  5KTB A;  3EFF K;  1SFC B;  1OW8 A;  1NU1 D;  4GIF A;  3CCR P;  2W6B A;  3L73 D;  1VF5 B;  1OVR A;  4ZKU A;  1X0T A;  1N8R Q;  4IFM A;  3L35 A;  1JCD A;  1USE A;  1SQQ J;  4YTM C;  2E75 D;  5KAF H;  2QJK B;  1X8Y A;  1LT9 C;  1NU1 J;  4PD4 D;  1X22 A;  2I1K A;  5TJH A;  1P84 E;  3CWB D;  3L73 J;  1KB9 E;  2ZFC A;  4ZKP A;  4I7Z C;  4I1L A;  2I8D A;  3AE1 C;  2ZT9 C;  2M5A A;  3CX5 D;  1E79 H;  3KZI E;  3Q3D A;  5B66 H;  3RK3 E;  1NTZ K;  3CWB J;  3MUD C;  1SQB G;  1NU1 E;  2WQY C;  3JCU E;  3L73 E;  1CSB A;  2PGD A;  1GW3 A;  3AED C;  4N6J A;  1KIL B;  3EFG A;  4PJ0 E;  2KLV A;  1ZOY C;  4HH2 A;  2WDQ D;  4KX6 C;  4YSX D;  1W2B O;  4PD4 E;  1A02 J;  2A06 E;  2PFX A;  3CWB E;  4W7Y A;  2IZ1 A;  4ASV A;  1NTZ D;  1SQB D;  2WPV B;  1KQG B;  1NVO A;  1RQV A;  4H13 B;  1Q7Y Q;  2HYN A;  4C7N B;  1E5W A;  1KQS O;  1X9V A;  1Y8A A;  2V7Q J;  1VQK P;  4WBA A;  4NPD A;  2YIU B;  3PLN A;  1H0T B;  3Q5R A;  3CD6 P;  1SQB J;  1URQ B;  2NPS C;  3CCQ P;  1LWU B;  1ZP0 C;  1S3J A;  2WSS H;  5GTH E;  3CXH D;  3PRJ A;  2A45 I;  1W5C E;  3VMA A;  2K1A A;  5CCG A;  2H43 A;  2W8Z A;  2OTL P;  5AVZ B;  3TGU D;  1YIT P;  1QX8 A;  1SQB E;  2QJP B;  1GL2 D;  1OFC X;  1Q86 Q;  2XKM A;  1L0N K;  5AVS B;  2QG4 A;  4C46 A;  2KLU A;  5KAI H;  5AW1 B;  2G8Y A;  1NTM K;  4I7Z B;  3NMD A;  1GK4 A;  2RMZ A;  3HE4 A;  3L4F A;  3CXH E;  2M3B A;  2WT7 A;  5APY A;  1T3U A;  1SQX K;  3ITK A;  2N1T A;  1Y47 A;  1NAF A;  1N7S D;  1H8A A;  3A3Y B;  5C2T D;  3RGU A;  1VQO P;  4DDI A;  3AEA C;  1PFI A;  4TT3 H;  4Z1M H;  1G1I A;  2B76 C;  2Q6Q A;  3VR9 C;  3HD7 A;  5H2F E;  2QA4 P;  2E76 B;  2PRR A;  3QH9 A;  5E79 H;  5AW4 B;  2B76 D;  1SVF A;  1JUN A;  5KJ7 A;  2OTK E;  1JNM A;  3H1I D;  4LDT A;  1EDJ A;  4YTP C;  2LKM A;  3QWO C;  2JEE A;  3AEC C;  4DZO A;  2NPS B;  1JMM A;  4B86 A;  4UB6 H;  2WDR D;  4YSZ D;  3V4W A;  3B5N D;  3AEC D;  2XNX A;  3SFE D;  2ZXE B;  5CCH A;  1BE3 G;  4Y99 B;  2Q3I A;  5CMZ A;  3P8M C;  1N2D C;  2AEJ A;  1ZV8 A;  3CX5 H;  3AEE C;  5CJ4 A;  1P84 I;  2YNY A;  4AUW A;  4H44 C;  4UB8 H;  1JOC A;  3U59 A;  1L4A B;  5AVV B;  1G1J A;  1RE3 C;  3GMA A;  2RKL A;  1BE3 D;  1FJP A;  5KKZ C;  2BS4 C;  1NEN C;  2WP9 C;  1FZC C;  4ASW A;  1G2C A;  3RK2 C;  2O01 J; 
#chains in the Genus database with same CATH homology
 1MKM A;  1IK7 A;  1NYH A;  4KT0 J;  4H13 C;  1QLB C;  2WU2 D;  3VR8 D;  2WSE J;  2BS3 C;  2V7Q J;  1VL2 A;  3T97 B;  2WQY D;  3AEF D;  1UIX A;  3AE5 C;  1ZME C;  3AEE D;  2WP9 D;  1KFY D;  2B76 C;  3VRB C;  3SFE C;  3CIR C;  3AED D;  3P4Q C;  3VR9 C;  3LW5 J;  2H88 C;  3D6Z A;  1PIX A;  1OW8 A;  3Q5R A;  1ZOY D;  3AE3 C;  2E76 B;  2YIU C;  4H44 D;  3EWK A;  1DIP A;  3IN6 A;  1PL5 A;  4H13 D;  3P4R C;  1JB0 J;  3AEB D;  4R4L A;  1VF5 B;  3P4P D;  4KX6 D;  2E74 B;  3SFD C;  4OGQ D;  1ZP0 C;  2E76 C;  4YSY D;  3AEG C;  2B76 D;  2FYN C;  3S9O A;  1VF5 C;  1KQF B;  1NEK D;  2WU5 C;  2QJY C;  2E74 C;  2BS2 C;  3FGA D;  1OMI A;  1OW6 A;  1GMJ A;  3AE9 C;  3Q1M A;  2QSI A;  3D6Y A;  2ACZ C;  3P4R D;  4YTP C;  1NEN D;  4YT0 C;  2P10 A;  2E75 D;  4YTM C;  3GF7 A;  3O6Q A;  3AEC C;  5C3J C;  2JO1 A;  2OQQ A;  2J5U A;  1S5L X;  3AE7 D;  3AEA D;  1EXJ A;  1E7P C;  1YQ3 D;  2WDQ C;  3AEG D;  4PV1 B;  2BEQ D;  2QJK C;  1L0V C;  4YSX C;  2ZT9 B;  2YMK A;  3C8V A;  3Q2Y A;  2WDR D;  4YSZ D;  1ZRT E;  4I7Z C;  2MKV A;  4PV1 C;  2ACZ D;  2IDB A;  3R4Y A;  3VRA C;  3AE1 C;  3AE4 C;  2H89 C;  5C2T C;  2ZT9 C;  3AEC D;  3AE5 D;  3P4S C;  1Y9B A;  2D2C B;  4H0L B;  3VRB D;  3SFE D;  2QJP C;  3CIR D;  3H25 A;  4RKU J;  3P4Q D;  1YQ4 C;  3VR9 D;  1Q90 D;  2H88 D;  2FBW C;  2WSC J;  1RQU A;  3Q3D A;  1NGM B;  2D2C C;  3AE3 D;  2WS3 C;  4H0L C;  1K04 A;  3AE2 C;  3RK3 E;  2JP3 A;  1DD3 A;  1FDI A;  3AE8 C;  4PV1 D;  2H89 D;  3SFD D;  3AE6 C;  2BEZ F;  1K05 A;  2G8Y A;  4XFJ A;  2E76 D;  1KF6 C;  3ABV C;  1ZP0 D;  2WU2 C;  4IL6 X;  2FXP A;  1WMK A;  2NZ2 A;  4I7Z B;  1PV3 A;  1VF5 D;  2WQY C;  3AEF C;  2WU5 D;  2E74 D;  4YTN C;  1KIL E;  3AEE C;  2D2C D;  1KMI Z;  3Q5S A;  1KFY C;  3GLM A;  3AE9 D;  1S1C X;  4U7J A;  3D71 A;  3AED C;  4YT0 D;  4YTM D;  4YTP D;  3AE8 D;  3G9R A;  1HJ0 A;  1KOR A;  5C3J D;  1ZOY C;  4H44 C;  4R4M A;  2WDR C;  2WDQ D;  1EXI A;  3AEB C;  1R8E A;  4GDO A;  3GF3 A;  4YXD C;  3ABV D;  1DD4 A;  4YTN D;  3P4P C;  2QIW A;  1L0V D;  4KX6 C;  4YSX D;  4OGQ C;  4YSY C;  3GMA A;  5L8R J;  1U57 A;  1OW7 A;  3D70 A;  1AJY A;  3B71 A;  5KKZ C;  1NEK C;  2E75 B;  2WDV C;  3AE1 D;  3AE4 D;  3VRA D;  5C2T D;  2ZT9 D;  1TU3 F;  2WSF J;  3IAO A;  5KLI C;  5M1B A;  2BS4 C;  3P4S D;  3VR8 C;  2K9Y A;  1NEN C;  1YQ4 D;  4YXD D;  2E75 C;  1FDO A;  2FBW D;  3Q5P A;  2WPV B;  4Y28 J;  4TT3 H;  1KQG B;  2G3A A;  3AE7 C;  4H44 B;  2WP9 C;  2WS3 D;  3AEA C;  4H0L D;  1YQ3 C;  1RQV A;  4H13 B;  1HF9 A;  3AE2 D;  3RL0 g;  1KTM A;  2WDV D;  3AE6 D;  1KF6 D;  4OGQ B;  2O01 J;  4YSZ C;  4Z1M H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...