3AE7C

Crystal structure of porcine heart mitochondrial complex ii bound with 2-iodo-n-(3-isopropoxy-phenyl)-benzamide
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
total genus 44
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3ae7C01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3ae7C02
4YXDC 1K05A 3AEEC 2WDRC 4YTMC 4YTMD 2G3AA 3VRBC 3AECD 2BS3C 3SFDD 2H88C 1YQ3C 2H89C 2WDQD 2WU2D 3AE4C 3P4QD 3VRAC 5C3JC 2H88D 3AE7C 3P4SC 4YSZD 1KFYC 1E7PC 3AE5D 3AE7D 2B76C 4YSYC 3AE8C 4YSYD 4YTND 3AE8D 1OW8A 1ZP0C 3AE6C 3VR9D 1ZP0D 2WDVD 2ACZD 3AE6D 3S9OA 1QLBC 3AECC 2FBWC 3CIRC 3SFDC 2WDQC 2FBWD 2WU2C 3CIRD 4YTPD 3AEGC 3P4QC 4YSXD 4YSZC 3AEGD 2WP9D 1NEND 3AE5C 3B71A 1NEKC 4YTNC 1NEKD 3AEDD 1PV3A 1KTMA 3VR9C 3AE2D 2WDVC 3AEAD 3ABVD 2ACZC 3P4RC 2BS4C 1L0VD 3P4RD 5C2TD 4YTPC 4YSXC 3AE3D 2WS3D 2WP9C 1NENC 4KX6D 1KF6C 3SFEC 3AE9D 1KF6D 3SFED 3AEDC 1K04A 4YT0D 1YQ4C 1ZOYC 1OW6A 2WU5D 1YQ4D 1ZOYD 3VR8D 3AEAC 3AE2C 3P4PC 4YXDD 3ABVC 3AEBC 3AEED 3P4PD 2WDRD 3AE1C 1L0VC 3AEBD 3AE1D 5C2TC 3VRBD 3AE3C 2WS3C 1YQ3D 2BS2C 2WQYC 2H89D 4KX6C 3AE4D 3VRAD 5C3JD 3P4SD 2WQYD 1KFYD 3AE9C 2B76D 4YT0C 3AEFC 2WU5C 1OW7A 3VR8C 3AEFD
chains in the Genus database with same CATH superfamily
4UB8E 2Q9IA 1FU1A 3M9QA 2R3CA 1LWUA 1L0LD 1BCCD 3L72G 1CI6B 2H88C 4HKZH 1SQVG 2H89C 3L36A 2ZYAA 1KORA 1SP4A 1L0ND 2R5BA 1YITP 1EDJA 1OW8A 1JY3P 1GD2E 1ZP0D 3CXHE 1PPJD 2BEZF 5KLVK 2JDIH 1H8AA 2FY8A 4YSZC 1GW3A 2KZIA 2XU6A 1VF5D 3BRVB 1T3JA 1RF0A 1LTAC 4WY4B 4H0LB 3H1LE 1FZBA 2HYNA 2C9NY 2C0XA 1L0VD 3KZIH 1FOSF 2ZJSE 2PP6A 2KZJA 2ZAEB 3P7KA 3OW2O 3PTZA 3TNUB 1YQ4C 4EDFA 3RGUA 3RK3C 3H1JE 1OFCX 2E76C 3AE3C 1OVRA 1GU5A 3CI9A 1J1EC 3HE4B 3R2PA 1PP9E 5GTIE 2O01H 5DJUB 5AVRB 4YXDC 1VQPP 5M1BA 2CPSA 1H89A 4DHIB 2I1KA 1VDFA 1HUCA 3AE4C 4GIFA 1G2CB 4WY4D 3D71A 4H0LD 1AVOA 1T2KC 3NXSA 3TF5A 1J2JB 2M0BA 2KI7B 1HBWA 1MUUA 1AQTA 2LXBA 2WSCJ 1LTJB 2ACZD 4AYCA 3AECC 3K5BA 2O01N 2WSFJ 2LXCB 1JY2P 1VQOP 4XA4A 2MKVA 5TJHA 1AV1A 1U7MA 5CMZA 2Z4EA 1KTMA 2V7QH 1KZUB 4HYTB 1FS0E 2K9JA 2AEFA 1BDDA 5CHXA 1OX3A 2P1JA 3CXHH 3OJAB 5BU5A 3L70D 2WP9C 3HUSC 3JC22 1FZEA 3B4SA 3SFED 1Q90D 3V2QA 3I55P 3W67A 3L74J 3ABVC 3LIEA 4JQ0D 3AEED 3VP9A 1ZV8A 1GL2C 4NPFX 4DHZA 3WUTA 2HR3A 2P58A 3AE9C 2A45G 4DJGA 1RE3A 1XTGB 4YT0C 2W8ZA 3W68A 1T6AA 4YTMC 4GOEA 3VMXA 4O9BA 1AFOA 1KQFB 4Z1MH 1M1JA 3H1IG 3RK3B 3P4QD 3L72D 2H88D 2O1KA 4D6TD 4N6JA 1SQVD 2E42A 1NTMG 2HODA 5GTIH 3G3ZA 3B5NA 1QX8A 3Q5PA 3L75E 2ITAA 1SQXE 4IFMA 1ZR4A 3WMM0 1P84I 2FFDC 4ZKUA 1T3UA 1QL1A 4KHXA 1JB0J 3H6PA 2JWAA 1URQC 1NU1J 1RE4A 3AEAD 1KB9I 3NTNA 5AW4B 1LNQA 4H13C 2W83C 1L2PA 3IN6A 2GUVA 1SFCB 1ZN5A 3CLQA 1SVFA 2N1TA 4C7RA 1ZOYC 1PGOA 5BU8B 1YQ4D 3A0HH 4LLHA 3CC4P 3RK3D 1J1DC 4U3FG 1M90Q 5DJTB 1JEKA 1NTZG 4GODA 3FXDA 1FC2C 4PD4I 2AEMA 3GHGB 2WWWA 4L76A 3S1KA 4RO0A 3MIWA 3L73E 2KOGA 3MTUE 3VR8C 2FYNC 3HUSB 2M3EA 1DIPA 1BE3E 1W2EA 5AVZB 1NTKG 1BGYG 1KILC 3A2AA 1IZNB 3VRBC 1YI2P 2FYUE 4KT0J 3L75J 2K37A 3D70A 3SFDD 2WDQD 5C39A 1SQQD 1KFYC 1KFNA 1S5LE 1VQKP 3V4QA 1IFIA 1DX7A 1NH4A 3S9OA 2WZ7A 1SFCD 2RN0A 3CMEP 2IYPA 5CCGA 1L0LE 3L71J 1AA0A 4JF7A 1RHZB 2KB7P 4LC1A 3CCVP 3WU2H 1W2BO 1K8AQ 4L75A 1KD1Q 2IZ1A 1GW4A 1OWAA 1L0NE 2XKMA 3H1KG 2V4HA 3EWKA 3P4RC 1SQBJ 2ZYDA 1PPJE 2QEXP 1BDCA 1VF5C 1NKNA 2YXQB 1G2CA 4Y28J 1RF1A 1SQPE 2HLOA 2RKLA 5KLVG 1N7LA 1NU1K 2YMKA 2FXPA 1H88A 1BE3J 2WDRD 3G71P 1L0VC 2Z5IA 1E5WA 4ZNCA 4IL6E 1VQ6P 1YTZT 2YIUB 1OXZA 2QA4P 3CWBG 4DZOA 4H13B 3FWLA 2BCCG 2K88A 4YTMD 1NWQA 1NTMK 1NYHA 3SWFA 2WU2D 2W90A 1YJ9P 1KB9D 3TGUJ 3O6QA 3H1ID 3M06A 2OGUA 2A06D 3VN0A 4YSYC 1KQSO 3SSUA 4C7NB 2LR2A 1VQ7P 1QLBC 4HB1A 1BSHA 4W80A 1GK4A 1QGKB 4WY4C 3V5BA 3M0DC 3E1IA 2M3BA 1KILB 1SQPJ 3OAKA 2KK7A 1IK7A 3M9BA 3KZIE 2ACZC 1N7SC 1N2DC 3H1HG 1EDIA 4XFJA 2YO3A 2DW3A 2XNXA 4H13D 2WPQA 3TSIA 2IBZG 1LGHB 1S1CX 5AW8B 2AXCA 1FZGA 2WU5D 1ZOYD 5B66E 2Y9ZA 2D2CB 3C1LA 5KLIB 1SQBK 4ZKPA 4GOFA 4EIJA 1S9KD 1NTZD 1S5LX 1MZ9A 3M0AA 3P4SD 2Y0CA 3L70E 2ZFYA 1LT9C 4CPGA 3AEEC 4W7ZA 2B87A 2P7JA 2YKPA 1KILD 2YKQA 1NTKD 2IBZI 4WB4A 4UB6E 2NZ2A 3VONA 3AE5D 1LTJC 4IL6H 1PGPA 4DT0A 2VRSA 2K9YA 4DDGA 1JO5A 1HGVA 4H44B 1DD3A 3P4QC 1K73Q 2GA1A 3ZDMA 3VTPC 2QRXA 1BSNA 3L72E 4D6TE 2D2CD 1SQVE 3IAOA 5E79H 2KNCB 4IL6X 3HUSA 2W6JH 2E74C 3P4RD 3SWYA 4Y99B 1VQNP 2OYIC 4AUWA 3U59A 2O01J 1SQPK 3L70J 1GL2A 1K04A 3HD7A 1EZVD 3FXEA 5KLVD 2FXOA 3AEAC 4DHJA 2B89A 4GKGA 3WUUA 5AW7B 3H25A 1VQ5P 1N7SB 1VQ9P 2XZRA 2K1AA 5AVQB 4H44D 1K05A 3M9HA 3GF7A 2Y0EA 5B66H 2BCCD 2WSEH 3MGNA 5CCHD 3RK3E 2R44A 1KYOD 1JTHB 3CXHI 1VQ4P 4HH2A 2V7QJ 4D6TJ 1DH3A 4YSYD 3CX5I 5AVWB 2OTLP 3VR9D 2FFDA 1PP9G 4EI2A 1OVVA 2Q5UA 1FDIA 1LT9B 3SFDC 1LTTC 1VQMP 2WDQC 1URQA 5CBOA 1MV8A 3L74G 3QWOC 2POHA 2AXTH 2IZ0A 4UB6H 2QE7H 2KLUA 1NEKC 1SQQE 3HTKB 4MN4C 3S4RA 3HRNA 3H1LJ 3AE2D 2E5TA 1KMIZ 1M7LA 1SFCC 1N7SD 3CCRP 3H1HD 1JNMA 4JBZA 1OIPA 2FKWB 4KX6D 1NKZB 2WT7A 1R8EA 3A0HE 2SPZA 2WPVB 2M5AB 3H1JJ 3GHGC 4C7NA 1CW5A 5B5EE 1GTWA 2IX7C 1E79H 4R4MA 1Q81Q 1IFNA 4YXWH 2E74B 1IC2A 4R4LA 1KILA 1PP9J 1PIXA 1WMKA 4ASWA 5AW5B 1EXIA 2OYIB 1AQ5A 1NJIQ 1FZCA 2WDRC 1AVYA 2E43A 1NU1G 2FXMA 3PHLA 1JM0A 1WT6A 4YTND 4HJGH 1H0TB 2I8DA 1FBMA 2WU2C 4YSXD 3TDKA 2YKOA 5KKZC 1NEND 3WU2E 3BVHA 1YBKA 1KB9E 1FDMA 1LJ2A 1IFDA 1PFIA 4IFDK 2A06E 1LT1A 1XTCC 3PP5A 4JYCA 3JSVC 1NAYA 5AVVB 2E74D 1X22A 5H2FE 2WMMA 1LP1A 3IR9A 2C0WA 3CMAP 3V4WA 2J59M 3L75G 1U57A 3HE5B 2WVRA 1MKMA 3AEBC 2YIUC 2IFNA 3Q5SA 3CX5D 1RY3A 2BS2C 4JYBA 3VRAD 1CI6A 3EFFK 5C3JD 2IPPA 2HG5D 2B76D 2Q7CA 2WU5C 1YHQP 3VP8A 1GZLA 3L71G 1S72P 1PL5A 2I1JA 3KDPB 3OA7A 5B5EH 3AE7C 3T97B 3P4SC 1NO4A 2RMZA 1S9KE 2W6BA 1NTZE 3WUVA 1SQBG 2M8RA 3CCSP 2GM4A 1YYCA 2QJYB 4WY4A 3M0DA 3II6A 1LWUB 4XE5B 3L73G 2BEQD 4JPZB 4NPDA 1SQXJ 4WWIA 2MJZA 1KILE 1N73C 1NTKE 3AE5C 1BE3G 1N7SA 3L74D 4L74A 1JOCA 4YPCA 1G1JA 1M8OB 4I6MC 1NEKD 2FYUG 3AEDD 3BCCE 3TNUA 1Q82Q 4DCKA 2Y0DA 3B8EB 3N4XA 4FJVA 1IFJA 1FDOA 2NPSC 4GDOA 2A45H 5C2TD 4GT1A 1JTHA 3UIAA 5TISE 1BCCE 3HE4A 1KF6C 2GUSA 3USSA 2H43A 2D2CC 5KLIC 4I7ZB 3RL0C 5KJ7C 3P8CD 1KV4A 1KB9H 5KKZB 3TGUG 5AW9B 4EOTA 3L37A 2KP8A 1X9VA 1HH0A 3FX0A 1LT9A 1KC8Q 1FZFA 1D7MA 5KAFH 1SS1A 5H2FH 1G1IA 3GW6A 1VL2A 1HVVA 1PGJA 3N7NA 3L73J 4KJMA 3C9IA 3D6ZA 1PPJG 2Q6QA 2AEJA 3Q5RA 1PZQA 3GMAA 1EZVE 5AVXB 1IFMA 1SQPG 5KLVE 1LTJA 3U1CA 1QVFO 1UIIA 4TT3H 2FYUJ 1TFFA 1NU1D 2OARA 3KQGA 1Q86Q 4H44C 3AE8C 3IF4A 1M56D 3BCCJ 1TU3F 1P84D 3I56P 1ZR2A 2KS1B 2CK3H 4W7YA 1EDKA 2IYOA 5CCHC 1RE4C 1X0TA 3EQ2A 1QEXA 1L0LJ 1BCCJ 1KYOE 5KTBA 2PGDA 3V6IA 5E79E 2Q3IA 2R32A 4Y99C 5AVUB 2Y9YA 2OYIA 3VR9C 1NTMD 2JKVA 1L0NJ 2C9LY 3V2RA 2N1TC 4RKUJ 5APYA 2OYHC 3Q3DA 4PV1B 1SQXK 2N9YB 2KXPB 1JY3N 2PRRA 1GU4A 3I5CA 3CC2P 2WPSA 1IO4A 4PD4D 1N73B 3AE2C 1ZLLA 3Q1MA 3L75D 3AE1C 2OYOA 2NRGA 5L8RJ 3AEBD 1H0TA 1RQUA 5CBNA 2QIWA 2O3JA 1S4XA 2WQYC 1W5CE 4KX6C 2NPSB 2KSEA 4N78D 1ZW0A 1FZAA 5TISH 5APWA 2UWJE 3C8VA 2E75B 3F5HA 2XNDH 5AW6B 4ASVA 2B9BA 2JEEA 5AW3B 3L71D 2YO2A 3PRJA 4U3FD 3RL0B 1VQ8P 2JP3A 4BXLA 2PFXA 4LGDE 1E7PC 3AE7D 4NPEA 2P67A 2BASA 1SQBD 1MFZA 4PV1D 3HE5A 1Q2NA 2WDVD 2OQQA 4RJTA 3PH0A 3L70G 3CIRC 2FYUK 1BGYD 3AEGC 4WBAA 2AXTE 1BE3D 1SFCA 2Z5HA 4YTNC 3B5NB 3BRTB 2P10A 4YSXC 2NPSD 4M3LA 3CCUP 1NENC 1L0LK 3T97A 3GHGA 2E75D 1KF6D 4U7JA 1YTZI 3MP7B 4QMAA 1JY2O 1KYOH 3KPEA 3TYYA 3CPWO 1JY2N 3RL0D 5KJ7D 1L0NK 1Y8AA 4L73A 2WSEJ 3VYIA 3TGUD 4IOIH 3H1KD 4D6TG 3CCJP 2J58A 1OVUA 1YQ3D 1IJDB 4ZMDA 3CCLP 2HPCB 1NGMB 1CSBA 2N1TB 1DEEG 3BASA 3AEFC 4IFFA 2OYHB 1NOHA 1KN7A 3MUDC 4OVNF 3ITKA 3QH9A 5EFWB 3LW5H 2G3AA 1LTIC 1SQPD 2O1JA 3VRAC 5C3JC 2LKMA 1R5LA 2ZT9C 3H1LG 3CX5E 3B5ND 3JCUH 2B76C 2IDBA 3AE8D 3CWBD 2H7HA 1FJPA 3KXDA 4DOJA 2FBWC 4YTPD 2L5GB 1EDLA 4WVZA 3R4YA 1USDA 3H1JG 1RQVA 3FGAD 3L72J 3RL0g 1X8YA 1SQVJ 3E1RA 1FOSE 5AW0B 1SLQA 2BS4C 4OGQB 2N1TD 3V2PA 3CD6P 4OWFA 2WPRA 5APVA 3PJSK 1YJNP 1A02F 2OTKE 3AEDC 5AVTB 1OW6A 2KIKA 2W27A 3L74E 3P4PC 1WRGA 2KS1A 3AE1D 5C2TC 2FYZA 1SQQG 3P8MC 2KYVA 3MHVA 1RF1B 3VMZA 1HWTC 2HFED 2WQYD 3CCEP 2ZFCA 1EQ7A 1IK9A 2IBZD 1L4AC 2QJPB 3RBZA 3IFMA 3P8CE 2H8PD 1Q7YQ 4UB8H 4C46A 3VMAA 1NHLA 1HTLC 3GLMA 1CZQA 2QJYC 1LWUC 2QG4A 4OGQD 3VMYA 5CCGD 1K9MQ 3AE6C 1N73A 3LIDA 2R5DA 3NMDA 3L35A 1R5SA 3CIRD 3O6QB 3RK2C 3AEGD 3CX5H 1NU1E 2NPSA 4K35A 1SQQJ 2ZT9B 1QVGO 3A0BE 2YXRB 2WSCH 1RF0C 1P84E 3HD7C 4I6LA 2WS3D 4I7ZC 5KJ7A 1A02J 2WSFH 1ZRTD 3MZWB 1SQVK 1GK6A 3H1IE 2JJLA 2QVAA 3G4SP 1JCDA 5APSA 2B88A 1Z56A 1NTME 1ZMEC 3D6YA 5KAFE 3CC7P 4RESB 1HJ0A 2H89D 4AQRD 2A06G 2E76B 2E5YA 1LTSC 1J1EB 3CXHD 3AEFD 2ZVOB 1SQXG 2JR8A 4PD4E 2A45I 1VQLP 2QM8A 4YSZD 4BRYB 2ZT9D 3H32B 3KYQA 3H1LD 5GTHE 1JMMA 5CCHA 4N78E 5APQA 2B87B 1LTGC 2KNCA 4OH8B 1IFPA 1L4AB 2FBWD 2N9BA 5APUA 3L71E 4DDIA 3CCMP 1FJKA 3F89A 4U3FE 3B71A 2HPCA 4BWNA 3H1JD 2YNYA 2YMYA 3M91A 3H1IJ 2OYHA 4TLFA 4PV1C 2Q1KA 1U7JA 2WDVC 1HJBA 1JMBA 4K3AA 1SQBE 1QLED 1NTMJ 2E76D 5KAIE 3AE3D 4I2LC 2G8YA 1PP9D 3V2NA 5CJ4A 2L91A 1USEA 1HGZA 1BGYE 1N8RQ 3L4FA 1SQQK 1DEBA 3RK2B 2PAJA 5AW1B 1S2EA 1GDTA 4YXDD 3P4PD 3GF3A 1EXJA 5AVSB 2JO1A 3A0BH 1FZCC 3BCCG 1P84H 3AE4D 1GL2B 2E75C 1OZHA 3O8ZA 1T2KD 1FE6A 3HD7B 2ZYGA 3FWNA 2QSIA 5K5GB 2QJKC 1OW7A 2R3SA 1L4AD 3EFGA 1L0LG 1DD4A 1BCCG 1RE3C 3AECD 1YQ3C 3TGUE 3H1KE 1L0NG 4U3FJ 1YIJP 1QL2A 1NTZJ 1M1JC 1JUNA 4N3YB 3HTKA 1ZP0C 1AJYA 3AE6D 3A7OA 4PJ0E 2P2UA 4PD4H 1KFMA 2KLVA 5AW2B 3Q2YA 3MD0A 1NVOA 2WP9D 3RK2D 3B5NC 1M1KQ 1NTKJ 1BGYJ 1EZVG 1X79B 1MFTA 2RH0A 5GTHH 2FFDB 1N86A 1KQLA 3ABVD 2M5AA 3CWBE 3RBXA 3GG2A 4EYYQ 1GL2D 1URQB 4YTPC 3KHUA 3HD7D 2KUBA 1M57D 1KQGB 2BCCE 2QM7A 1Y9BA 3G6EP 2IFMA 3U1AA 3AE9D 4YT0D 1T8ZA 1GMJA 3CL3D 5CJ0A 1Y47A 3G9RA 2WTYA 1EZVI 1JY3O 3MUDA 1J1DB 3H1KJ 2WT7B 5KAIH 1JCCA 1UIXA 1YJWP 2KSJA 2K9JB 1SQXD 3BATA 3TK1A 5KLVJ 2CPBA 2BS3C 2FYNB 2ZXXA 4H0LC 3JCUE 2W6AA 4B86A 1EC5A 2XDJA 2WITA 5AVYB 3H1HE 3VOPA 1OMIA 3NFQA 2ZVNB 1FZCB 3SWKA 1URQD 2OTJP 1KYOI 1S5LH 2IBZE 1RH5B 2WSSH 3CWBJ 2QJKB 2BCCJ 1NTZK 4OGQC 1NAFA 1PV3A 5CCGC 1FAVA 2Q3EA 2K3RA 3A5TA 1M1JB 1S3JA 3A3YB 3L73D 4PJ0H 5APTA 2ZXEB 1NTKK 3CCQP 1HF9A 4BRYA 2JWDA 3SFEC 3H32A 2HODB 3P32A 1VF5B 3VR8D 3LW5J 5APXA 4A7PA 4LDTA 1RF1C 2FYUD 1PGQA 1LP1B 1ZXGA 3VRBD 2WS3C 1L4AA 2QJPC 1LTBC 3BCCD 1VPCA 1KFYD 3E7KA 3H1HJ 2J5UA 3PLNA 2XV5A 4I1LA 1ZRTE 5BVZA
chains in the Genus database with same CATH topology
3D6ZA 4YXDC 2FYNC 1K05A 3C8VA 1DIPA 2E75B 3AEEC 3Q5RA 5M1BA 3GF7A 2WDRC 3GMAA 1DD4A 4YTMC 3VR8C 1PL5A 4YTMD 2G3AA 3VRBC 1NYHA 3AECD 1KQFB 3RK3E 4Z1MH 2BS3C 4KT0J 4TT3H 3SFDD 2H88C 3D70A 1YQ3C 2H89C 2JP3A 4H0LC 2WDQD 2WU2D 3AE4C 3GLMA 3P4QD 3VRAC 2ZT9C 2H88D 3AE7C 2NZ2A 3T97B 3D71A 4H0LD 3P4SC 4YSZD 2QJYC 3O6QA 1KFYC 1KORA 2ZT9D 1E7PC 3AE7D 3AE5D 1OMIA 2B76C 2V7QJ 4H44C 4YSYC 2IDBA 3AE8C 4OGQD 4YSYD 4YTND 3AE8D 2K9YA 1TU3F 1OW8A 1ZP0C 2WSCJ 3VR8D 3AE6C 4PV1D 3VR9D 1AJYA 1ZP0D 2WDVD 2OQQA 2ACZD 4H44B 3AE6D 2BEZF 3S9OA 3Q5PA 1QLBC 3AECC 2FBWC 1DD3A 2BEQD 3CIRC 1FDIA 3SFDC 2WSFJ 2FBWD 2WDQC 2WU2C 3CIRD 3AEGC 3P4QC 4YTPD 4YSXD 3Q2YA 4YSZC 3AEGD 1KILE 3R4YA 5KKZC 3AE5C 1NEND 2WP9D 1RQVA 1VF5D 3B71A 2MKVA 3FGAD 1JB0J 1NEKC 4OGQC 3RL0g 4YTNC 2D2CD 1NEKD 1IK7A 1PV3A 3AEDD 4H0LB 1KTMA 3IAOA 2ZT9B 4PV1C 5C3JC 4IL6X 3VR9C 3AE2D 2WDVC 3AEAD 3ABVD 2ACZC 3EWKA 3P4RC 1KMIZ 2P10A 4OGQB 2BS4C 1L0VD 1FDOA 2E74C 3P4RD 4GDOA 4RKUJ 5C2TD 4YTPC 2E76D 4YSXC 4XFJA 2E74D 3Q3DA 4H13C 4PV1B 3AE3D 2WS3D 2G8YA 4I7ZC 1KQGB 2WP9C 1NENC 4H13D 1VF5C 4KX6D 3IN6A 2O01J 4Y28J 1HF9A 1KF6C 1Y9BA 2E75D 3SFEC 3AE9D 1KF6D 2D2CC 1S1CX 4U7JA 5KLIC 3SFED 3AEDC 1K04A 1Q90D 1YQ4C 1R8EA 1ZOYC 1OW6A 4I7ZB 4YT0D 2WU5D 1YQ4D 2YMKA 1VF5B 2WPVB 1ZOYD 1U57A 3AEAC 3AE2C 3LW5J 2FXPA 3P4PC 1MKMA 1GMJA 3ABVC 3Q1MA 4YXDD 3AEBC 3AEED 3P4PD 2WDRD 2YIUC 2WSEJ 3AE1C 3GF3A 1L0VC 2D2CB 5L8RJ 3H25A 1EXJA 3AEBD 2JO1A 3AE1D 5C2TC 3Q5SA 2E76C 1ZMEC 3D6YA 3VRBD 1RQUA 3AE3C 2WS3C 2QIWA 3G9RA 1S5LX 1HJ0A 1YQ3D 2BS2C 2WQYC 2QJPC 2H89D 4KX6C 3AE4D 3VRAD 5C3JD 4R4MA 3P4SD 2WQYD 2E75C 1VL2A 1KFYD 3AE9C 1NGMB 2E76B 2E74B 4R4LA 2B76D 2J5UA 1PIXA 2QSIA 4YT0C 4H44D 2QJKC 1UIXA 3AEFC 1ZRTE 1WMKA 4H13B 2WU5C 1OW7A 1EXIA 3AEFD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YXD C;  1K05 A;  3AEE C;  2WDR C;  4YTM C;  4YTM D;  2G3A A;  3VRB C;  3AEC D;  2BS3 C;  3SFD D;  2H88 C;  1YQ3 C;  2H89 C;  2WDQ D;  2WU2 D;  3AE4 C;  3P4Q D;  3VRA C;  5C3J C;  2H88 D;  3AE7 C;  3P4S C;  4YSZ D;  1KFY C;  1E7P C;  3AE5 D;  3AE7 D;  2B76 C;  4YSY C;  3AE8 C;  4YSY D;  4YTN D;  3AE8 D;  1OW8 A;  1ZP0 C;  3AE6 C;  3VR9 D;  1ZP0 D;  2WDV D;  2ACZ D;  3AE6 D;  3S9O A;  1QLB C;  3AEC C;  2FBW C;  3CIR C;  3SFD C;  2WDQ C;  2FBW D;  2WU2 C;  3CIR D;  4YTP D;  3AEG C;  3P4Q C;  4YSX D;  4YSZ C;  3AEG D;  2WP9 D;  1NEN D;  3AE5 C;  3B71 A;  1NEK C;  4YTN C;  1NEK D;  3AED D;  1PV3 A;  1KTM A;  3VR9 C;  3AE2 D;  2WDV C;  3AEA D;  3ABV D;  2ACZ C;  3P4R C;  2BS4 C;  1L0V D;  3P4R D;  5C2T D;  4YTP C;  4YSX C;  3AE3 D;  2WS3 D;  2WP9 C;  1NEN C;  4KX6 D;  1KF6 C;  3SFE C;  3AE9 D;  1KF6 D;  3SFE D;  3AED C;  1K04 A;  4YT0 D;  1YQ4 C;  1ZOY C;  1OW6 A;  2WU5 D;  1YQ4 D;  1ZOY D;  3VR8 D;  3AEA C;  3AE2 C;  3P4P C;  4YXD D;  3ABV C;  3AEB C;  3AEE D;  3P4P D;  2WDR D;  3AE1 C;  1L0V C;  3AEB D;  3AE1 D;  5C2T C;  3VRB D;  3AE3 C;  2WS3 C;  1YQ3 D;  2BS2 C;  2WQY C;  2H89 D;  4KX6 C;  3AE4 D;  3VRA D;  5C3J D;  3P4S D;  2WQY D;  1KFY D;  3AE9 C;  2B76 D;  4YT0 C;  3AEF C;  2WU5 C;  1OW7 A;  3VR8 C;  3AEF D; 
#chains in the Genus database with same CATH topology
 4UB8 E;  2Q9I A;  1FU1 A;  3M9Q A;  2R3C A;  1LWU A;  1L0L D;  1BCC D;  3L72 G;  1CI6 B;  2H88 C;  4HKZ H;  1SQV G;  2H89 C;  3L36 A;  2ZYA A;  1KOR A;  1SP4 A;  1L0N D;  2R5B A;  1YIT P;  1EDJ A;  1OW8 A;  1JY3 P;  1GD2 E;  1ZP0 D;  3CXH E;  1PPJ D;  2BEZ F;  5KLV K;  2JDI H;  1H8A A;  2FY8 A;  4YSZ C;  1GW3 A;  2KZI A;  2XU6 A;  1VF5 D;  3BRV B;  1T3J A;  1RF0 A;  1LTA C;  4WY4 B;  4H0L B;  3H1L E;  1FZB A;  2HYN A;  2C9N Y;  2C0X A;  1L0V D;  3KZI H;  1FOS F;  2ZJS E;  2PP6 A;  2KZJ A;  2ZAE B;  3P7K A;  3OW2 O;  3PTZ A;  3TNU B;  1YQ4 C;  4EDF A;  3RGU A;  3RK3 C;  3H1J E;  1OFC X;  2E76 C;  3AE3 C;  1OVR A;  1GU5 A;  3CI9 A;  1J1E C;  3HE4 B;  3R2P A;  1PP9 E;  5GTI E;  2O01 H;  5DJU B;  5AVR B;  4YXD C;  1VQP P;  5M1B A;  2CPS A;  1H89 A;  4DHI B;  2I1K A;  1VDF A;  1HUC A;  3AE4 C;  4GIF A;  1G2C B;  4WY4 D;  3D71 A;  4H0L D;  1AVO A;  1T2K C;  3NXS A;  3TF5 A;  1J2J B;  2M0B A;  2KI7 B;  1HBW A;  1MUU A;  1AQT A;  2LXB A;  2WSC J;  1LTJ B;  2ACZ D;  4AYC A;  3AEC C;  3K5B A;  2O01 N;  2WSF J;  2LXC B;  1JY2 P;  1VQO P;  4XA4 A;  2MKV A;  5TJH A;  1AV1 A;  1U7M A;  5CMZ A;  2Z4E A;  1KTM A;  2V7Q H;  1KZU B;  4HYT B;  1FS0 E;  2K9J A;  2AEF A;  1BDD A;  5CHX A;  1OX3 A;  2P1J A;  3CXH H;  3OJA B;  5BU5 A;  3L70 D;  2WP9 C;  3HUS C;  3JC2 2;  1FZE A;  3B4S A;  3SFE D;  1Q90 D;  3V2Q A;  3I55 P;  3W67 A;  3L74 J;  3ABV C;  3LIE A;  4JQ0 D;  3AEE D;  3VP9 A;  1ZV8 A;  1GL2 C;  4NPF X;  4DHZ A;  3WUT A;  2HR3 A;  2P58 A;  3AE9 C;  2A45 G;  4DJG A;  1RE3 A;  1XTG B;  4YT0 C;  2W8Z A;  3W68 A;  1T6A A;  4YTM C;  4GOE A;  3VMX A;  4O9B A;  1AFO A;  1KQF B;  4Z1M H;  1M1J A;  3H1I G;  3RK3 B;  3P4Q D;  3L72 D;  2H88 D;  2O1K A;  4D6T D;  4N6J A;  1SQV D;  2E42 A;  1NTM G;  2HOD A;  5GTI H;  3G3Z A;  3B5N A;  1QX8 A;  3Q5P A;  3L75 E;  2ITA A;  1SQX E;  4IFM A;  1ZR4 A;  3WMM 0;  1P84 I;  2FFD C;  4ZKU A;  1T3U A;  1QL1 A;  4KHX A;  1JB0 J;  3H6P A;  2JWA A;  1URQ C;  1NU1 J;  1RE4 A;  3AEA D;  1KB9 I;  3NTN A;  5AW4 B;  1LNQ A;  4H13 C;  2W83 C;  1L2P A;  3IN6 A;  2GUV A;  1SFC B;  1ZN5 A;  3CLQ A;  1SVF A;  2N1T A;  4C7R A;  1ZOY C;  1PGO A;  5BU8 B;  1YQ4 D;  3A0H H;  4LLH A;  3CC4 P;  3RK3 D;  1J1D C;  4U3F G;  1M90 Q;  5DJT B;  1JEK A;  1NTZ G;  4GOD A;  3FXD A;  1FC2 C;  4PD4 I;  2AEM A;  3GHG B;  2WWW A;  4L76 A;  3S1K A;  4RO0 A;  3MIW A;  3L73 E;  2KOG A;  3MTU E;  3VR8 C;  2FYN C;  3HUS B;  2M3E A;  1DIP A;  1BE3 E;  1W2E A;  5AVZ B;  1NTK G;  1BGY G;  1KIL C;  3A2A A;  1IZN B;  3VRB C;  1YI2 P;  2FYU E;  4KT0 J;  3L75 J;  2K37 A;  3D70 A;  3SFD D;  2WDQ D;  5C39 A;  1SQQ D;  1KFY C;  1KFN A;  1S5L E;  1VQK P;  3V4Q A;  1IFI A;  1DX7 A;  1NH4 A;  3S9O A;  2WZ7 A;  1SFC D;  2RN0 A;  3CME P;  2IYP A;  5CCG A;  1L0L E;  3L71 J;  1AA0 A;  4JF7 A;  1RHZ B;  2KB7 P;  4LC1 A;  3CCV P;  3WU2 H;  1W2B O;  1K8A Q;  4L75 A;  1KD1 Q;  2IZ1 A;  1GW4 A;  1OWA A;  1L0N E;  2XKM A;  3H1K G;  2V4H A;  3EWK A;  3P4R C;  1SQB J;  2ZYD A;  1PPJ E;  2QEX P;  1BDC A;  1VF5 C;  1NKN A;  2YXQ B;  1G2C A;  4Y28 J;  1RF1 A;  1SQP E;  2HLO A;  2RKL A;  5KLV G;  1N7L A;  1NU1 K;  2YMK A;  2FXP A;  1H88 A;  1BE3 J;  2WDR D;  3G71 P;  1L0V C;  2Z5I A;  1E5W A;  4ZNC A;  4IL6 E;  1VQ6 P;  1YTZ T;  2YIU B;  1OXZ A;  2QA4 P;  3CWB G;  4DZO A;  4H13 B;  3FWL A;  2BCC G;  2K88 A;  4YTM D;  1NWQ A;  1NTM K;  1NYH A;  3SWF A;  2WU2 D;  2W90 A;  1YJ9 P;  1KB9 D;  3TGU J;  3O6Q A;  3H1I D;  3M06 A;  2OGU A;  2A06 D;  3VN0 A;  4YSY C;  1KQS O;  3SSU A;  4C7N B;  2LR2 A;  1VQ7 P;  1QLB C;  4HB1 A;  1BSH A;  4W80 A;  1GK4 A;  1QGK B;  4WY4 C;  3V5B A;  3M0D C;  3E1I A;  2M3B A;  1KIL B;  1SQP J;  3OAK A;  2KK7 A;  1IK7 A;  3M9B A;  3KZI E;  2ACZ C;  1N7S C;  1N2D C;  3H1H G;  1EDI A;  4XFJ A;  2YO3 A;  2DW3 A;  2XNX A;  4H13 D;  2WPQ A;  3TSI A;  2IBZ G;  1LGH B;  1S1C X;  5AW8 B;  2AXC A;  1FZG A;  2WU5 D;  1ZOY D;  5B66 E;  2Y9Z A;  2D2C B;  3C1L A;  5KLI B;  1SQB K;  4ZKP A;  4GOF A;  4EIJ A;  1S9K D;  1NTZ D;  1S5L X;  1MZ9 A;  3M0A A;  3P4S D;  2Y0C A;  3L70 E;  2ZFY A;  1LT9 C;  4CPG A;  3AEE C;  4W7Z A;  2B87 A;  2P7J A;  2YKP A;  1KIL D;  2YKQ A;  1NTK D;  2IBZ I;  4WB4 A;  4UB6 E;  2NZ2 A;  3VON A;  3AE5 D;  1LTJ C;  4IL6 H;  1PGP A;  4DT0 A;  2VRS A;  2K9Y A;  4DDG A;  1JO5 A;  1HGV A;  4H44 B;  1DD3 A;  3P4Q C;  1K73 Q;  2GA1 A;  3ZDM A;  3VTP C;  2QRX A;  1BSN A;  3L72 E;  4D6T E;  2D2C D;  1SQV E;  3IAO A;  5E79 H;  2KNC B;  4IL6 X;  3HUS A;  2W6J H;  2E74 C;  3P4R D;  3SWY A;  4Y99 B;  1VQN P;  2OYI C;  4AUW A;  3U59 A;  2O01 J;  1SQP K;  3L70 J;  1GL2 A;  1K04 A;  3HD7 A;  1EZV D;  3FXE A;  5KLV D;  2FXO A;  3AEA C;  4DHJ A;  2B89 A;  4GKG A;  3WUU A;  5AW7 B;  3H25 A;  1VQ5 P;  1N7S B;  1VQ9 P;  2XZR A;  2K1A A;  5AVQ B;  4H44 D;  1K05 A;  3M9H A;  3GF7 A;  2Y0E A;  5B66 H;  2BCC D;  2WSE H;  3MGN A;  5CCH D;  3RK3 E;  2R44 A;  1KYO D;  1JTH B;  3CXH I;  1VQ4 P;  4HH2 A;  2V7Q J;  4D6T J;  1DH3 A;  4YSY D;  3CX5 I;  5AVW B;  2OTL P;  3VR9 D;  2FFD A;  1PP9 G;  4EI2 A;  1OVV A;  2Q5U A;  1FDI A;  1LT9 B;  3SFD C;  1LTT C;  1VQM P;  2WDQ C;  1URQ A;  5CBO A;  1MV8 A;  3L74 G;  3QWO C;  2POH A;  2AXT H;  2IZ0 A;  4UB6 H;  2QE7 H;  2KLU A;  1NEK C;  1SQQ E;  3HTK B;  4MN4 C;  3S4R A;  3HRN A;  3H1L J;  3AE2 D;  2E5T A;  1KMI Z;  1M7L A;  1SFC C;  1N7S D;  3CCR P;  3H1H D;  1JNM A;  4JBZ A;  1OIP A;  2FKW B;  4KX6 D;  1NKZ B;  2WT7 A;  1R8E A;  3A0H E;  2SPZ A;  2WPV B;  2M5A B;  3H1J J;  3GHG C;  4C7N A;  1CW5 A;  5B5E E;  1GTW A;  2IX7 C;  1E79 H;  4R4M A;  1Q81 Q;  1IFN A;  4YXW H;  2E74 B;  1IC2 A;  4R4L A;  1KIL A;  1PP9 J;  1PIX A;  1WMK A;  4ASW A;  5AW5 B;  1EXI A;  2OYI B;  1AQ5 A;  1NJI Q;  1FZC A;  2WDR C;  1AVY A;  2E43 A;  1NU1 G;  2FXM A;  3PHL A;  1JM0 A;  1WT6 A;  4YTN D;  4HJG H;  1H0T B;  2I8D A;  1FBM A;  2WU2 C;  4YSX D;  3TDK A;  2YKO A;  5KKZ C;  1NEN D;  3WU2 E;  3BVH A;  1YBK A;  1KB9 E;  1FDM A;  1LJ2 A;  1IFD A;  1PFI A;  4IFD K;  2A06 E;  1LT1 A;  1XTC C;  3PP5 A;  4JYC A;  3JSV C;  1NAY A;  5AVV B;  2E74 D;  1X22 A;  5H2F E;  2WMM A;  1LP1 A;  3IR9 A;  2C0W A;  3CMA P;  3V4W A;  2J59 M;  3L75 G;  1U57 A;  3HE5 B;  2WVR A;  1MKM A;  3AEB C;  2YIU C;  2IFN A;  3Q5S A;  3CX5 D;  1RY3 A;  2BS2 C;  4JYB A;  3VRA D;  1CI6 A;  3EFF K;  5C3J D;  2IPP A;  2HG5 D;  2B76 D;  2Q7C A;  2WU5 C;  1YHQ P;  3VP8 A;  1GZL A;  3L71 G;  1S72 P;  1PL5 A;  2I1J A;  3KDP B;  3OA7 A;  5B5E H;  3AE7 C;  3T97 B;  3P4S C;  1NO4 A;  2RMZ A;  1S9K E;  2W6B A;  1NTZ E;  3WUV A;  1SQB G;  2M8R A;  3CCS P;  2GM4 A;  1YYC A;  2QJY B;  4WY4 A;  3M0D A;  3II6 A;  1LWU B;  4XE5 B;  3L73 G;  2BEQ D;  4JPZ B;  4NPD A;  1SQX J;  4WWI A;  2MJZ A;  1KIL E;  1N73 C;  1NTK E;  3AE5 C;  1BE3 G;  1N7S A;  3L74 D;  4L74 A;  1JOC A;  4YPC A;  1G1J A;  1M8O B;  4I6M C;  1NEK D;  2FYU G;  3AED D;  3BCC E;  3TNU A;  1Q82 Q;  4DCK A;  2Y0D A;  3B8E B;  3N4X A;  4FJV A;  1IFJ A;  1FDO A;  2NPS C;  4GDO A;  2A45 H;  5C2T D;  4GT1 A;  1JTH A;  3UIA A;  5TIS E;  1BCC E;  3HE4 A;  1KF6 C;  2GUS A;  3USS A;  2H43 A;  2D2C C;  5KLI C;  4I7Z B;  3RL0 C;  5KJ7 C;  3P8C D;  1KV4 A;  1KB9 H;  5KKZ B;  3TGU G;  5AW9 B;  4EOT A;  3L37 A;  2KP8 A;  1X9V A;  1HH0 A;  3FX0 A;  1LT9 A;  1KC8 Q;  1FZF A;  1D7M A;  5KAF H;  1SS1 A;  5H2F H;  1G1I A;  3GW6 A;  1VL2 A;  1HVV A;  1PGJ A;  3N7N A;  3L73 J;  4KJM A;  3C9I A;  3D6Z A;  1PPJ G;  2Q6Q A;  2AEJ A;  3Q5R A;  1PZQ A;  3GMA A;  1EZV E;  5AVX B;  1IFM A;  1SQP G;  5KLV E;  1LTJ A;  3U1C A;  1QVF O;  1UII A;  4TT3 H;  2FYU J;  1TFF A;  1NU1 D;  2OAR A;  3KQG A;  1Q86 Q;  4H44 C;  3AE8 C;  3IF4 A;  1M56 D;  3BCC J;  1TU3 F;  1P84 D;  3I56 P;  1ZR2 A;  2KS1 B;  2CK3 H;  4W7Y A;  1EDK A;  2IYO A;  5CCH C;  1RE4 C;  1X0T A;  3EQ2 A;  1QEX A;  1L0L J;  1BCC J;  1KYO E;  5KTB A;  2PGD A;  3V6I A;  5E79 E;  2Q3I A;  2R32 A;  4Y99 C;  5AVU B;  2Y9Y A;  2OYI A;  3VR9 C;  1NTM D;  2JKV A;  1L0N J;  2C9L Y;  3V2R A;  2N1T C;  4RKU J;  5APY A;  2OYH C;  3Q3D A;  4PV1 B;  1SQX K;  2N9Y B;  2KXP B;  1JY3 N;  2PRR A;  1GU4 A;  3I5C A;  3CC2 P;  2WPS A;  1IO4 A;  4PD4 D;  1N73 B;  3AE2 C;  1ZLL A;  3Q1M A;  3L75 D;  3AE1 C;  2OYO A;  2NRG A;  5L8R J;  3AEB D;  1H0T A;  1RQU A;  5CBN A;  2QIW A;  2O3J A;  1S4X A;  2WQY C;  1W5C E;  4KX6 C;  2NPS B;  2KSE A;  4N78 D;  1ZW0 A;  1FZA A;  5TIS H;  5APW A;  2UWJ E;  3C8V A;  2E75 B;  3F5H A;  2XND H;  5AW6 B;  4ASV A;  2B9B A;  2JEE A;  5AW3 B;  3L71 D;  2YO2 A;  3PRJ A;  4U3F D;  3RL0 B;  1VQ8 P;  2JP3 A;  4BXL A;  2PFX A;  4LGD E;  1E7P C;  3AE7 D;  4NPE A;  2P67 A;  2BAS A;  1SQB D;  1MFZ A;  4PV1 D;  3HE5 A;  1Q2N A;  2WDV D;  2OQQ A;  4RJT A;  3PH0 A;  3L70 G;  3CIR C;  2FYU K;  1BGY D;  3AEG C;  4WBA A;  2AXT E;  1BE3 D;  1SFC A;  2Z5H A;  4YTN C;  3B5N B;  3BRT B;  2P10 A;  4YSX C;  2NPS D;  4M3L A;  3CCU P;  1NEN C;  1L0L K;  3T97 A;  3GHG A;  2E75 D;  1KF6 D;  4U7J A;  1YTZ I;  3MP7 B;  4QMA A;  1JY2 O;  1KYO H;  3KPE A;  3TYY A;  3CPW O;  1JY2 N;  3RL0 D;  5KJ7 D;  1L0N K;  1Y8A A;  4L73 A;  2WSE J;  3VYI A;  3TGU D;  4IOI H;  3H1K D;  4D6T G;  3CCJ P;  2J58 A;  1OVU A;  1YQ3 D;  1IJD B;  4ZMD A;  3CCL P;  2HPC B;  1NGM B;  1CSB A;  2N1T B;  1DEE G;  3BAS A;  3AEF C;  4IFF A;  2OYH B;  1NOH A;  1KN7 A;  3MUD C;  4OVN F;  3ITK A;  3QH9 A;  5EFW B;  3LW5 H;  2G3A A;  1LTI C;  1SQP D;  2O1J A;  3VRA C;  5C3J C;  2LKM A;  1R5L A;  2ZT9 C;  3H1L G;  3CX5 E;  3B5N D;  3JCU H;  2B76 C;  2IDB A;  3AE8 D;  3CWB D;  2H7H A;  1FJP A;  3KXD A;  4DOJ A;  2FBW C;  4YTP D;  2L5G B;  1EDL A;  4WVZ A;  3R4Y A;  1USD A;  3H1J G;  1RQV A;  3FGA D;  3L72 J;  3RL0 g;  1X8Y A;  1SQV J;  3E1R A;  1FOS E;  5AW0 B;  1SLQ A;  2BS4 C;  4OGQ B;  2N1T D;  3V2P A;  3CD6 P;  4OWF A;  2WPR A;  5APV A;  3PJS K;  1YJN P;  1A02 F;  2OTK E;  3AED C;  5AVT B;  1OW6 A;  2KIK A;  2W27 A;  3L74 E;  3P4P C;  1WRG A;  2KS1 A;  3AE1 D;  5C2T C;  2FYZ A;  1SQQ G;  3P8M C;  2KYV A;  3MHV A;  1RF1 B;  3VMZ A;  1HWT C;  2HFE D;  2WQY D;  3CCE P;  2ZFC A;  1EQ7 A;  1IK9 A;  2IBZ D;  1L4A C;  2QJP B;  3RBZ A;  3IFM A;  3P8C E;  2H8P D;  1Q7Y Q;  4UB8 H;  4C46 A;  3VMA A;  1NHL A;  1HTL C;  3GLM A;  1CZQ A;  2QJY C;  1LWU C;  2QG4 A;  4OGQ D;  3VMY A;  5CCG D;  1K9M Q;  3AE6 C;  1N73 A;  3LID A;  2R5D A;  3NMD A;  3L35 A;  1R5S A;  3CIR D;  3O6Q B;  3RK2 C;  3AEG D;  3CX5 H;  1NU1 E;  2NPS A;  4K35 A;  1SQQ J;  2ZT9 B;  1QVG O;  3A0B E;  2YXR B;  2WSC H;  1RF0 C;  1P84 E;  3HD7 C;  4I6L A;  2WS3 D;  4I7Z C;  5KJ7 A;  1A02 J;  2WSF H;  1ZRT D;  3MZW B;  1SQV K;  1GK6 A;  3H1I E;  2JJL A;  2QVA A;  3G4S P;  1JCD A;  5APS A;  2B88 A;  1Z56 A;  1NTM E;  1ZME C;  3D6Y A;  5KAF E;  3CC7 P;  4RES B;  1HJ0 A;  2H89 D;  4AQR D;  2A06 G;  2E76 B;  2E5Y A;  1LTS C;  1J1E B;  3CXH D;  3AEF D;  2ZVO B;  1SQX G;  2JR8 A;  4PD4 E;  2A45 I;  1VQL P;  2QM8 A;  4YSZ D;  4BRY B;  2ZT9 D;  3H32 B;  3KYQ A;  3H1L D;  5GTH E;  1JMM A;  5CCH A;  4N78 E;  5APQ A;  2B87 B;  1LTG C;  2KNC A;  4OH8 B;  1IFP A;  1L4A B;  2FBW D;  2N9B A;  5APU A;  3L71 E;  4DDI A;  3CCM P;  1FJK A;  3F89 A;  4U3F E;  3B71 A;  2HPC A;  4BWN A;  3H1J D;  2YNY A;  2YMY A;  3M91 A;  3H1I J;  2OYH A;  4TLF A;  4PV1 C;  2Q1K A;  1U7J A;  2WDV C;  1HJB A;  1JMB A;  4K3A A;  1SQB E;  1QLE D;  1NTM J;  2E76 D;  5KAI E;  3AE3 D;  4I2L C;  2G8Y A;  1PP9 D;  3V2N A;  5CJ4 A;  2L91 A;  1USE A;  1HGZ A;  1BGY E;  1N8R Q;  3L4F A;  1SQQ K;  1DEB A;  3RK2 B;  2PAJ A;  5AW1 B;  1S2E A;  1GDT A;  4YXD D;  3P4P D;  3GF3 A;  1EXJ A;  5AVS B;  2JO1 A;  3A0B H;  1FZC C;  3BCC G;  1P84 H;  3AE4 D;  1GL2 B;  2E75 C;  1OZH A;  3O8Z A;  1T2K D;  1FE6 A;  3HD7 B;  2ZYG A;  3FWN A;  2QSI A;  5K5G B;  2QJK C;  1OW7 A;  2R3S A;  1L4A D;  3EFG A;  1L0L G;  1DD4 A;  1BCC G;  1RE3 C;  3AEC D;  1YQ3 C;  3TGU E;  3H1K E;  1L0N G;  4U3F J;  1YIJ P;  1QL2 A;  1NTZ J;  1M1J C;  1JUN A;  4N3Y B;  3HTK A;  1ZP0 C;  1AJY A;  3AE6 D;  3A7O A;  4PJ0 E;  2P2U A;  4PD4 H;  1KFM A;  2KLV A;  5AW2 B;  3Q2Y A;  3MD0 A;  1NVO A;  2WP9 D;  3RK2 D;  3B5N C;  1M1K Q;  1NTK J;  1BGY J;  1EZV G;  1X79 B;  1MFT A;  2RH0 A;  5GTH H;  2FFD B;  1N86 A;  1KQL A;  3ABV D;  2M5A A;  3CWB E;  3RBX A;  3GG2 A;  4EYY Q;  1GL2 D;  1URQ B;  4YTP C;  3KHU A;  3HD7 D;  2KUB A;  1M57 D;  1KQG B;  2BCC E;  2QM7 A;  1Y9B A;  3G6E P;  2IFM A;  3U1A A;  3AE9 D;  4YT0 D;  1T8Z A;  1GMJ A;  3CL3 D;  5CJ0 A;  1Y47 A;  3G9R A;  2WTY A;  1EZV I;  1JY3 O;  3MUD A;  1J1D B;  3H1K J;  2WT7 B;  5KAI H;  1JCC A;  1UIX A;  1YJW P;  2KSJ A;  2K9J B;  1SQX D;  3BAT A;  3TK1 A;  5KLV J;  2CPB A;  2BS3 C;  2FYN B;  2ZXX A;  4H0L C;  3JCU E;  2W6A A;  4B86 A;  1EC5 A;  2XDJ A;  2WIT A;  5AVY B;  3H1H E;  3VOP A;  1OMI A;  3NFQ A;  2ZVN B;  1FZC B;  3SWK A;  1URQ D;  2OTJ P;  1KYO I;  1S5L H;  2IBZ E;  1RH5 B;  2WSS H;  3CWB J;  2QJK B;  2BCC J;  1NTZ K;  4OGQ C;  1NAF A;  1PV3 A;  5CCG C;  1FAV A;  2Q3E A;  2K3R A;  3A5T A;  1M1J B;  1S3J A;  3A3Y B;  3L73 D;  4PJ0 H;  5APT A;  2ZXE B;  1NTK K;  3CCQ P;  1HF9 A;  4BRY A;  2JWD A;  3SFE C;  3H32 A;  2HOD B;  3P32 A;  1VF5 B;  3VR8 D;  3LW5 J;  5APX A;  4A7P A;  4LDT A;  1RF1 C;  2FYU D;  1PGQ A;  1LP1 B;  1ZXG A;  3VRB D;  2WS3 C;  1L4A A;  2QJP C;  1LTB C;  3BCC D;  1VPC A;  1KFY D;  3E7K A;  3H1H J;  2J5U A;  3PLN A;  2XV5 A;  4I1L A;  1ZRT E;  5BVZ A; 
#chains in the Genus database with same CATH homology
 3D6Z A;  4YXD C;  2FYN C;  1K05 A;  3C8V A;  1DIP A;  2E75 B;  3AEE C;  3Q5R A;  5M1B A;  3GF7 A;  2WDR C;  3GMA A;  1DD4 A;  4YTM C;  3VR8 C;  1PL5 A;  4YTM D;  2G3A A;  3VRB C;  1NYH A;  3AEC D;  1KQF B;  3RK3 E;  4Z1M H;  2BS3 C;  4KT0 J;  4TT3 H;  3SFD D;  2H88 C;  3D70 A;  1YQ3 C;  2H89 C;  2JP3 A;  4H0L C;  2WDQ D;  2WU2 D;  3AE4 C;  3GLM A;  3P4Q D;  3VRA C;  2ZT9 C;  2H88 D;  3AE7 C;  2NZ2 A;  3T97 B;  3D71 A;  4H0L D;  3P4S C;  4YSZ D;  2QJY C;  3O6Q A;  1KFY C;  1KOR A;  2ZT9 D;  1E7P C;  3AE7 D;  3AE5 D;  1OMI A;  2B76 C;  2V7Q J;  4H44 C;  4YSY C;  2IDB A;  3AE8 C;  4OGQ D;  4YSY D;  4YTN D;  3AE8 D;  2K9Y A;  1TU3 F;  1OW8 A;  1ZP0 C;  2WSC J;  3VR8 D;  3AE6 C;  4PV1 D;  3VR9 D;  1AJY A;  1ZP0 D;  2WDV D;  2OQQ A;  2ACZ D;  4H44 B;  3AE6 D;  2BEZ F;  3S9O A;  3Q5P A;  1QLB C;  3AEC C;  2FBW C;  1DD3 A;  2BEQ D;  3CIR C;  1FDI A;  3SFD C;  2WSF J;  2FBW D;  2WDQ C;  2WU2 C;  3CIR D;  3AEG C;  3P4Q C;  4YTP D;  4YSX D;  3Q2Y A;  4YSZ C;  3AEG D;  1KIL E;  3R4Y A;  5KKZ C;  3AE5 C;  1NEN D;  2WP9 D;  1RQV A;  1VF5 D;  3B71 A;  2MKV A;  3FGA D;  1JB0 J;  1NEK C;  4OGQ C;  3RL0 g;  4YTN C;  2D2C D;  1NEK D;  1IK7 A;  1PV3 A;  3AED D;  4H0L B;  1KTM A;  3IAO A;  2ZT9 B;  4PV1 C;  5C3J C;  4IL6 X;  3VR9 C;  3AE2 D;  2WDV C;  3AEA D;  3ABV D;  2ACZ C;  3EWK A;  3P4R C;  1KMI Z;  2P10 A;  4OGQ B;  2BS4 C;  1L0V D;  1FDO A;  2E74 C;  3P4R D;  4GDO A;  4RKU J;  5C2T D;  4YTP C;  2E76 D;  4YSX C;  4XFJ A;  2E74 D;  3Q3D A;  4H13 C;  4PV1 B;  3AE3 D;  2WS3 D;  2G8Y A;  4I7Z C;  1KQG B;  2WP9 C;  1NEN C;  4H13 D;  1VF5 C;  4KX6 D;  3IN6 A;  2O01 J;  4Y28 J;  1HF9 A;  1KF6 C;  1Y9B A;  2E75 D;  3SFE C;  3AE9 D;  1KF6 D;  2D2C C;  1S1C X;  4U7J A;  5KLI C;  3SFE D;  3AED C;  1K04 A;  1Q90 D;  1YQ4 C;  1R8E A;  1ZOY C;  1OW6 A;  4I7Z B;  4YT0 D;  2WU5 D;  1YQ4 D;  2YMK A;  1VF5 B;  2WPV B;  1ZOY D;  1U57 A;  3AEA C;  3AE2 C;  3LW5 J;  2FXP A;  3P4P C;  1MKM A;  1GMJ A;  3ABV C;  3Q1M A;  4YXD D;  3AEB C;  3AEE D;  3P4P D;  2WDR D;  2YIU C;  2WSE J;  3AE1 C;  3GF3 A;  1L0V C;  2D2C B;  5L8R J;  3H25 A;  1EXJ A;  3AEB D;  2JO1 A;  3AE1 D;  5C2T C;  3Q5S A;  2E76 C;  1ZME C;  3D6Y A;  3VRB D;  1RQU A;  3AE3 C;  2WS3 C;  2QIW A;  3G9R A;  1S5L X;  1HJ0 A;  1YQ3 D;  2BS2 C;  2WQY C;  2QJP C;  2H89 D;  4KX6 C;  3AE4 D;  3VRA D;  5C3J D;  4R4M A;  3P4S D;  2WQY D;  2E75 C;  1VL2 A;  1KFY D;  3AE9 C;  1NGM B;  2E76 B;  2E74 B;  4R4L A;  2B76 D;  2J5U A;  1PIX A;  2QSI A;  4YT0 C;  4H44 D;  2QJK C;  1UIX A;  3AEF C;  1ZRT E;  1WMK A;  4H13 B;  2WU5 C;  1OW7 A;  1EXI A;  3AEF D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...