3AE7C

Crystal structure of porcine heart mitochondrial complex ii bound with 2-iodo-n-(3-isopropoxy-phenyl)-benzamide
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
138
structure length
138
Chain Sequence
b'TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 44
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3ae7C01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3ae7C02
4YXDC 3VRBC 4YTPC 3AEED 4YSYD 3AEDD 1NEKD 1PV3A 1OW8A 1NEKC 2WP9D 3AECC 2BS2C 3P4QD 2WDVD 3AE1D 3AEBD 3P4QC 2WDVC 3AEBC 2B76D 3CIRD 4YXDD 1NEND 4YTPD 2B76C 2WDRC 3CIRC 4YSXC 3SFDD 1NENC 3ABVD 4YTMD 3SFDC 2WU5D 3ABVC 2H89C 4YTMC 3AECD 2WU5C 4YTND 5C2TC 3S9OA 3AE2C 3AE5C 4YTNC 3P4RC 3AE8D 4YT0C 3B71A 3VR8C 2G3AA 3AE3C 3AE8C 3VR9D 1OW7A 3P4SC 2BS3C 2WDRD 3VRAC 4YSXD 2H88D 2WS3C 3SFED 3VR9C 1ZP0C 1QLBC 3AEAC 2H88C 1ZOYD 3SFEC 2H89D 1YQ4C 1ZOYC 5C2TD 3AE6C 1K04A 3AE2D 3AE5D 3P4RD 4YT0D 1KFYC 3VR8D 2WU2D 1E7PC 3AE3D 2ACZD 3AE7D 1L0VD 2WQYD 3AEFC 2WU2C 1KF6C 3P4PD 3P4SD 3VRAD 2WS3D 3AE7C 1L0VC 2ACZC 2FBWC 2WQYC 1ZP0D 3P4PC 3AEAD 3AE9C 2WDQC 1YQ4D 3AE4D 4KX6D 1YQ3D 3AEEC 3AE4C 4YSYC 3AE6D 3AEDC 4KX6C 1YQ3C 1KTMA 1OW6A 1KFYD 2WP9C 5C3JD 4YSZD 3AEFD 1KF6D 3AEGD 5C3JC 4YSZC 1K05A 2FBWD 3AE1C 3AEGC 2BS4C 3VRBD 3AE9D 2WDQD
chains in the Genus database with same CATH superfamily
3VRBC 2HODA 3OJAB 1IFIA 3H1KJ 1OW8A 2R5DA 1IO4A 4DT0A 2YMKA 3BCCE 3I55P 3E1RA 1GZLA 2AXTE 4YTPD 4RESB 3OAKA 1JY3N 2MJZA 2JR8A 1DEEG 1M90Q 2WU5C 3RL0D 1S3JA 3WUUA 3AE8D 1JTHB 3VR8C 2KNCA 1VDFA 2KP8A 5KAFE 1XTGB 3Q5SA 2MKVA 1S5LX 2OYIC 4WY4D 2FYUJ 3H1IE 1IFJA 5TISH 1ZRTE 3L71J 1ZW0A 1L0LE 3V2NA 3EQ2A 1VQ4P 1MFZA 5APUA 2WDQC 1FE6A 2K9JB 1JY2N 4ASWA 1L0ND 1YTZI 2ZYAA 1KFYD 3S4RA 3HD7A 4N78D 2IZ1A 2N1TB 1KQLA 2R44A 3WUTA 1ZXGA 2IZ0A 4GOEA 1PP9J 1EDIA 4PD4D 3MUDC 4U7JA 2E5TA 3RK2C 1NU1J 4MN4C 2Q3IA 2XKMA 1EC5A 1NEKD 4HB1A 2KS1A 3H1KE 4DDGA 1LTJB 1NU1D 1YJNP 1DD4A 1SQQK 1EQ7A 5K5GB 1JNMA 1GL2B 3ABVD 4YTMD 4H0LB 1SQBD 4H13D 5B5EE 5CBOA 1KB9I 1Q90D 2E76D 1AQ5A 1XTCC 1OZHA 4EI2A 4DHJA 3CXHH 3V5BA 3LW5H 2I8DA 1USDA 3VMAA 3M06A 2H88D 1FJKA 1LGHB 4R4MA 1S5LH 3M9QA 1H88A 1X0TA 3CD6P 1CSBA 3AE5D 2WU2D 2WWWA 1VPCA 2BASA 2FYUE 4YXWH 4OGQC 5APQA 2GM4A 4KT0J 3HE5B 3SWYA 3L71E 2NPSB 3MGNA 3D71A 1T8ZA 3CPWO 3GF7A 1OW6A 4H44D 2W27A 1VF5D 4PD4E 1FZCB 3AEGD 1H0TA 1K05A 3RL0B 2B9BA 2HPCB 3CL3D 1A02J 4EIJA 4YSYD 3H25A 1PP9E 1SLQA 3KPEA 2A06G 2D2CB 1NU1E 1JY3P 2AXCA 4C7NB 1KFNA 3TDKA 3KYQA 2Q1KA 2IBZI 1NTMJ 4YXDD 1FOSE 1NEND 1OIPA 4C7RA 5AW2B 1KYOE 1PL5A 1NTMD 1LT1A 3B71A 3CCSP 3HE4B 3H1HD 1M57D 2KUBA 1GTWA 3B4SA 4UB6H 2H43A 2C9LY 4M3LA 1URQC 1BSNA 3TGUG 2FYNB 3VMZA 2YO2A 3QWOC 1SFCA 2J58A 1JY2P 2CPSA 2JWAA 3IFMA 1RF0C 4EOTA 1PZQA 2ACZC 1BGYD 1CW5A 3OW2O 1DEBA 2M3EA 3G71P 3CMEP 4BRYA 2W83C 1KV4A 2RN0A 3BVHA 1Q81Q 1KTMA 3LW5J 1AVOA 1LWUC 1FBMA 4YSZD 1KB9H 1M1JA 5H2FH 3A7OA 2P7JA 3HUSA 2W8ZA 1AQTA 3MP7B 3CXHD 5APTA 3AEED 5TISE 2Y9YA 1P84D 4AYCA 4WY4A 3VMXA 3AECC 2E5YA 1NTKD 3RK3D 2WDVD 3AEBD 1FOSF 1U7JA 1LTAC 2B76D 1FZBA 3L75D 4GIFA 4YSXC 2WDRC 1LTSC 4OH8B 1RF1B 1NTME 4AUWA 4PV1C 1N7SC 2QRXA 3L74J 5KLIC 1OVUA 3B5ND 3TNUA 3MIWA 1VF5B 1N73B 2KXPB 3PTZA 1NTZD 2XNXA 2WS3C 2QVAA 4FJVA 2ZYDA 5AVUB 1RH5B 3FX0A 2BEQD 1W2BO 3L74D 5AW9B 1T6AA 1IFNA 3A0HH 2B89A 1E7PC 1PGJA 2A45I 3L72J 2B88A 2KOGA 3VRAD 1CI6A 2WQYC 5KLVJ 3P4PC 1QVGO 1SQQG 1BE3G 2QIWA 1FDMA 3L72D 2IBZG 2AEFA 1L4AA 5KLVD 2WPRA 5C3JC 1X8YA 3CXHE 3H6PA 1KILC 4EYYQ 1S5LE 3E7KA 4I7ZC 1SQVD 3RGUA 5CCHA 1A02F 1S4XA 3L70D 1KQFB 2QJKC 1G2CA 1ZR2A 2J59M 1NJIQ 3P8CD 3CC7P 2AEMA 3CIRD 1ZV8A 4LGDE 1FZEA 1BCCD 2Z5HA 1KQGB 4HKZH 3WMM0 3O6QB 5AW6B 3CCUP 3H1LJ 2QM8A 2YKOA 5TJHA 3II6A 4DHZA 3VR9D 3L74E 1Y8AA 3BCCD 2M8RA 1NHLA 4L75A 4L73A 4XE5B 2ZJSE 1KILE 2N1TD 2PRRA 3HTKB 1QL1A 1N7SB 3M0DC 1Q7YQ 5KJ7A 3A5TA 2K88A 2QJPC 5AVTB 3JCUE 5APSA 3L72E 3ZDMA 4BXLA 5KLVE 2IPPA 4JF7A 2JWDA 3T97B 1L0NG 2P67A 1LTGC 3P32A 1Q2NA 4UB6E 3VRBD 3I56P 1GL2D 1ZRTD 2K3RA 3RBZA 3MTUE 3G4SP 1SQQJ 3IN6A 1L0LD 3CX5I 1NKNA 3M9BA 1SQXK 4H0LD 4D6TJ 4GDOA 4KJMA 3PH0A 3L4FA 3P8CE 3MZWB 1FC2C 1VQ6P 1FZAA 1R5SA 2NZ2A 1KILB 3RL0g 1USEA 3L36A 2OYHB 2WU5D 3KZIH 4ZNCA 2K37A 2A45G 1KB9E 1OVVA 3FXDA 4IFMA 5H2FE 1JCDA 1FS0E 4W7YA 2NPSD 3GW6A 3H1LE 2ZXXA 1HTLC 3H1KD 2IFMA 1FDIA 2HG5D 2WVRA 3AE2D 4NPDA 3GHGA 3CI9A 4LC1A 1SVFA 1YJWP 1KF6C 1GU5A 4OWFA 1DX7A 2D2CD 3P7KA 1HH0A 3AE6D 1NAFA 1SFCC 3CMAP 1GW4A 2R3CA 1N8RQ 5AW4B 2R32A 2PP6A 4L76A 1LT9C 2YXQB 3B5NA 3AE9D 4U3FJ 4YTPC 4PJ0H 2V7QH 2FYUD 3AEDD 2IFNA 1IFPA 3L71D 1SQQE 2L91A 2QE7H 1MKMA 3A0HE 1M1JC 2BS2C 3Q5PA 4D6TE 4U3FD 3HUSC 1AA0A 1OFCX 3GF3A 1N2DC 1HUCA 4IOIH 2ZT9C 2FFDB 4WWIA 3SFDC 4ZMDA 4ZKUA 1EZVG 2FXOA 1BDCA 4A7PA 1NGMB 1PP9D 1CZQA 1NAYA 1AV1A 2HYNA 5AVQB 1Y47A 3K5BA 2G3AA 2Y0DA 1HJ0A 2JKVA 3H1HG 2WMMA 3CX5H 5C39A 3SFEC 5CJ0A 3CWBG 1RE4A 5APXA 5C2TD 3A0BH 1VQNP 1KFYC 1ZN5A 2BCCG 4OGQD 1K73Q 1JTHA 2XV5A 1KYOD 3N4XA 5AVSB 1ZP0D 3L37A 5KAIH 1PPJE 5GTHH 4HYTB 1E5WA 4Z1MH 1FZFA 4N3YB 3C9IA 4DCKA 1HJBA 1BGYG 1J1DC 3WU2H 3AE4C 1EXIA 1YQ3C 1RHZB 3BASA 1PGQA 3AEFD 1GW3A 2FBWD 1D7MA 5CBNA 1Y9BA 1JEKA 3V2PA 2HFED 3RBXA 2K9JA 2OYIB 2IDBA 5APVA 1JOCA 4U3FE 1Z56A 3VTPC 1L4AC 2CK3H 2E74C 4H13C 1UIIA 1MFTA 4TT3H 3KDPB 2N1TA 2E76C 4LDTA 1LT9B 1SQPG 3NXSA 2B87B 1K9MQ 1NTKG 1SP4A 1NH4A 1TFFA 5CCHC 4ASVA 3CC4P 3CLQA 3L75G 2QG4A 2RKLA 3PP5A 1GDTA 1PFIA 2O1JA 4IFFA 3AE5C 4YTNC 2V7QJ 1NOHA 5CCGD 1LTJA 1GMJA 3U59A 3LIDA 2E75C 4DHIB 1U7MA 3JCUH 3RK2B 2ZT9B 1GL2A 2DW3A 3V2RA 5CMZA 1SQXG 1EDLA 1L0NK 2KLUA 1KZUB 4H44C 3AE3D 2ACZD 5B66H 1L0VC 1PIXA 5GTIH 3AEAD 3JC22 2Q3EA 2YO3A 3BRVB 4WBAA 1MUUA 1NYHA 3KZIE 4YSYC 5AVXB 5M1BA 2P10A 5KJ7C 4I6LA 3GMAA 2FYZA 2PFXA 3BATA 3HE5A 4YXDC 1IJDB 2PGDA 2NPSA 1OVRA 1DD3A 4HH2A 1HF9A 1DH3A 1FZCA 4XA4A 3P4QC 3PHLA 4OGQB 2HPCA 2WT7B 4QMAA 3N7NA 1JCCA 1N7SD 1KN7A 3CC2P 1BCCG 2E74B 3H1JG 3L35A 4C7NA 4JQ0D 1VQ8P 2IYOA 3L73G 1S1CX 2NRGA 1QL2A 3MUDA 4PJ0E 1QVFO 2HR3A 3Q2YA 3M91A 2LXCB 4HJGH 2H89D 3BCCG 1Q82Q 2O01N 2Y0CA 1VQOP 3P4RD 4YT0D 1YIJP 1EZVE 2OGUA 2QJYC 2YKPA 4PD4I 2FXPA 3HE4A 5E79H 5L8RJ 2WQYD 3P4PD 3P4SD 4GODA 2A06D 2YKQA 3WUVA 2E75B 1T2KC 1LTIC 3H32B 2Q5UA 3NMDA 1SQXJ 3AEEC 4I1LA 4KX6C 3VYIA 1QGKB 1QEXA 3GHGC 5C3JD 3TSIA 3RK3C 1KILD 1VQMP 2KB7P 1IK9A 3CX5E 3H1IG 2JEEA 3TGUJ 1URQB 2C0XA 2P58A 1KYOI 3A0BE 2WP9D 2WPVB 2RH0A 1QLED 1R5LA 1IFDA 1YHQP 1MZ9A 3MD0A 3P8MC 1SS1A 2JP3A 2XDJA 2M5AB 3S1KA 1X22A 2QSIA 1NWQA 5KAIE 1JMBA 5GTHE 2WSFJ 3WU2E 1WRGA 1JUNA 1VQPP 4JBZA 2M0BA 5BU5A 2WZ7A 3HD7C 3OA7A 1LWUB 1RQVA 3UIAA 1KC8Q 4OVNF 2QM7A 3VRAC 3BRTB 2YNYA 4LLHA 1QLBC 3SSUA 1RF1A 2VRSA 3CCEP 3H1KG 2WPQA 3H1JJ 1K04A 3L73J 5AW8B 2A06E 2H8PD 1N73A 1YBKA 2Q7CA 3AE7C 1KB9D 3KHUA 1EXJA 1OMIA 4IL6X 2HODB 2R5BA 3LIEA 3Q5RA 1YQ4D 4TLFA 2SPZA 3D6YA 1RE4C 2P1JA 3HRNA 3H1LD 1EDKA 4PV1B 1JY3O 1PGPA 1SQXE 3SWFA 1M7LA 1SQPK 2XU6A 5KLIB 1NTKK 5KKZC 2C9NY 5CCGA 4K3AA 3IF4A 2YIUC 2O01H 1MV8A 1G1JA 1PV3A 3CCJP 2FYUG 3PJSK 1IZNB 3TGUE 2ZVNB 2KNCB 5B66E 3AE1D 3TF5A 1ZLLA 5GTIE 2WITA 1NTZK 2ZAEB 1BE3J 1J1EC 1X9VA 1NO4A 2QEXP 2Q9IA 1LP1A 3G3ZA 1BDDA 1AFOA 1PGOA 2GA1A 2N1TC 4Y28J 1SQQD 2A45H 1BE3D 2BS3C 1GK6A 1PP9G 2JDIH 4D6TD 3U1CA 5APWA 2O3JA 1NU1G 2IBZD 1R8EA 5CHXA 4I7ZB 2I1JA 1ZOYC 3FWNA 3HD7B 2KSJA 3O6QA 3VR8D 1LTJC 1SQBG 2QJKB 4O9BA 1VL2A 3CXHI 3H1JE 3V4QA 3L73E 1GL2C 1P84I 4IL6H 2RMZA 1SFCD 4H0LC 2KS1B 1SQVK 3HTKA 1N7SA 4WVZA 2KSEA 3KQGA 1RE3A 3Q3DA 2WDQD 2G8YA 4W7ZA 1JMMA 3C1LA 2JJLA 1PPJD 2OTLP 3T97A 1OX3A 5E79E 5KKZB 2WSCH 4GOFA 2FKWB 2QJPB 3RK2D 2ZT9D 2NPSC 3SFDD 2YIUB 2Y0EA 5AW5B 3JSVC 2H7HA 4IFDK 3M0AA 1L0NJ 1BE3E 1NKZB 2ZVOB 3AE2C 1ZR4A 1FZCC 4UB8H 3RL0C 4RKUJ 1M1KQ 2O01J 2FY8A 2IBZE 3AE8C 5DJUB 2E42A 2LXBA 4WB4A 1KILA 3SFED 4EDFA 5CJ4A 2OYHA 2LKMA 1J1EB 2D2CC 4WY4C 3AE6C 2CPBA 3IR9A 1J2JB 2FXMA 4L74A 1H0TB 1IK7A 1NVOA 4C46A 4JPZB 1NTMG 1EDJA 2K1AA 3AE9C 1OXZA 4YPCA 3AE4D 1KMIZ 1YQ3D 1L0LK 3GG2A 1W5CE 4KHXA 3AEDC 2KLVA 2YXRB 4W80A 5AW1B 3VP9A 1SQBJ 2OTJP 4JYBA 3W67A 1YI2P 2ZFCA 1RY3A 2WTYA 3GLMA 1LTBC 2FYNC 1N86A 3G9RA 4K35A 2WPSA 1L4AD 2E74D 2W90A 1UIXA 1T3UA 1NEKC 1LJ2A 1JO5A 4I6MC 3M0DA 3CCLP 1S72P 2QA4P 4AQRD 1U57A 2C0WA 1P84H 5CCHD 1HVVA 2IYPA 4ZKPA 3ABVC 2OQQA 4DJGA 4YTMC 1M8OB 1SFCB 1FDOA 4Y99C 4YTND 3U1AA 5C2TC 3PRJA 1N7LA 2E75D 1L0NE 1OWAA 1QX8A 4BRYB 1ZP0C 3VP8A 3V4WA 2H88C 2Z4EA 2FFDA 4N78E 3EFGA 3I5CA 1LNQA 2WSCJ 4XFJA 1M1JB 1L0VD 2WU2C 3AEFC 3HUSB 2FBWC 1HBWA 3KXDA 1URQD 2BEZF 4RJTA 1W2EA 1RF1C 4N6JA 2FYUK 2Q6QA 1NTZG 2OYOA 4WY4B 2GUVA 5KJ7D 3VMYA 2W6BA 3L74G 1VQ9P 1G1IA 1VF5C 3FWLA 1N73C 1YTZT 3AEGC 2O1KA 1EZVD 3H1HJ 1SQBE 1H8AA 3CWBJ 3R2PA 2I1KA 3CCVP 1S2EA 5AW7B 2BCCJ 2WSFH 3P4QD 3TNUB 2J5UA 2N9BA 1IFMA 2HLOA 3L72G 5CCGC 3CWBD 1NU1K 3EWKA 3EFFK 5KLVG 2IX7C 1NENC 4IL6E 1BGYJ 4B86A 2BCCD 1KORA 2OYIA 2KK7A 1J1DB 3AECD 3VONA 3CX5D 2AEJA 4DDIA 3SWKA 2OARA 3V6IA 1SQBK 3S9OA 1SQVG 1VQKP 1JM0A 3AE3C 1S9KD 1LT9A 5EFWB 1CI6B 1HWTC 3L70G 2B87A 3QH9A 1OW7A 4YSXD 2WDRD 2XNDH 3AEAC 3R4YA 1FZGA 2E43A 1LTTC 1FAVA 4PV1D 3CCMP 4Y99B 2POHA 1L4AB 4H13B 1IC2A 1SQPJ 2E76B 3TYYA 1NTKJ 1KD1Q 1T2KD 1GU4A 2WS3D 2AXTH 3W68A 3MHVA 3USSA 4KX6D 3L75J 3C8VA 1WMKA 1SQPD 4BWNA 5AVWB 3H1LG 1G2CB 4UB8E 4YSZC 1L2PA 4RO0A 5AVYB 2BS4C 1M56D 2Z5IA 5KAFH 2W6JH 5AVZB 3M9HA 1NTZJ 3H1HE 1T3JA 2R3SA 3CWBE 4H44B 2LR2A 1RE3C 3TK1A 2K9YA 2WDVC 3AEBC 2BCCE 2OTKE 4R4LA 1SQXD 1DIPA 2B76C 3NTNA 2L5GB 4I2LC 3HD7D 2H89C 5AVVB 5BU8B 1L0LG 1AJYA 3FXEA 1S9KE 1VQLP 2WSEH 1BGYE 3P4RC 4DZOA 4YT0C 1AVYA 1NTMK 3TGUD 3B5NC 2W6AA 3P4SC 1Q86Q 2V4HA 2WT7A 1H89A 1YITP 4D6TG 1HGZA 4GT1A 2M3BA 2UWJE 1SQVJ 1ZMEC 3AE7D 3F5HA 3L70J 4NPEA 4CPGA 2Y9ZA 1E79H 1GD2E 3G6EP 1P84E 2ZYGA 2OYHC 1SQPE 2YMYA 1NTKE 3CCRP 3RK3E 2P2UA 1LP1B 2KYVA 1BCCJ 5B5EH 2WP9C 3L75E 1KQSO 5DJTB 4JYCA 3NFQA 3H32A 4NPFX 3H1JD 3PLNA 3BCCJ 3L73D 2KZIA 3IAOA 1KFMA 1RQUA 2ITAA 1NTZE 3CCQP 2QJYB 1VQ7P 1PPJG 1HGVA 4DOJA 5AVRB 3Q1MA 3F89A 3A2AA 3CIRC 3VOPA 5AW0B 5AW3B 1URQA 1YJ9P 4GKGA 1JB0J 1GK4A 2PAJA 3V2QA 3GHGB 1X79B 1EZVI 4PD4H 2GUSA 3L71G 3D70A 1RF0A 1YYCA 3RK3B 2M5AA 1BSHA 5APYA 2KIKA 3H1IJ 3A3YB 3VR9C 4U3FG 1VQ5P 2WSSH 1ZOYD 1YQ4C 1L0LJ 3E1IA 5KTBA 2ZXEB 1LWUA 3H1ID 1JY2O 2XZRA 1SQVE 3B5NB 3FGAD 1TU3F 2FFDC 1WT6A 2WSEJ 2KI7B 3ITKA 3L70E 3D6ZA 2JO1A 2N9YB 1K8AQ 1FJPA 2KZJA 5BVZA 1KYOH 1FU1A 3B8EB 3O8ZA 2ZFYA 1KF6D 1BCCE 3AE1C 5KLVK 3VN0A
chains in the Genus database with same CATH topology
4U7JA 1Y9BA 4YXDC 3IN6A 3VRBC 4YTPC 2FYNC 2YIUC 4H0LD 3G9RA 3AEED 4YSYD 4I7ZC 3AEDD 3H25A 1NEKD 1DD3A 2IDBA 4GDOA 2D2CB 2E74D 1PV3A 1UIXA 1MKMA 1OW8A 2WPVB 3IAOA 3AECC 1NEKC 1HF9A 2WP9D 1RQUA 2BS2C 2E74C 2YMKA 4H13C 1KQFB 3Q5PA 4TT3H 4H44B 3P4QD 2QJKC 2WDVD 2E76C 3AE1D 3AEBD 2JP3A 2J5UA 3P4QC 2K9YA 2WDVC 3GF3A 1U57A 3AEBC 4OGQB 1DD4A 2B76D 2QSIA 2ZT9D 1NEND 2NZ2A 3CIRD 4YTPD 4YXDD 4R4LA 3EWKA 3RL0g 3Q1MA 1DIPA 2B76C 2WDRC 3CIRC 2ZT9C 4YSXC 1NENC 3SFDD 2WSFJ 3ABVD 4YTMD 1KORA 3SFDC 2WU5D 1KQGB 3ABVC 2H89C 2OQQA 4YTMC 4H0LB 1JB0J 3AECD 2WU5C 4H13D 4PV1C 1FDOA 1AJYA 4YTND 5C2TC 2E74B 1PL5A 1Q90D 2E76D 4Y28J 3S9OA 3AE2C 3AE5C 1NGMB 3P4RC 2V7QJ 5KLIC 3B71A 3AE8D 4YT0C 4YTNC 1RQVA 3VR8C 4RKUJ 3D70A 2O01J 2G3AA 3AE3C 1S1CX 1VF5B 3AE8C 2E75D 1GMJA 3VR9D 1HJ0A 1OW7A 3P4SC 2BS3C 2WDRD 3VRAC 4YSXD 2H88D 2WS3C 2E75C 3SFED 3Q5SA 2MKVA 1S5LX 1ZP0C 1QLBC 3VR9C 2ZT9B 3Q2YA 3AEAC 2H88C 4R4MA 3R4YA 1ZOYD 3SFEC 2H89D 1R8EA 1YQ4C 2BEQD 2D2CC 4I7ZB 4PV1D 1ZOYC 5C2TD 2WSCJ 1KILE 3AE6C 1K04A 4XFJA 3O6QA 1FDIA 3AE2D 3AE5D 1ZRTE 3P4RD 1KFYC 4YT0D 4H44C 3VR8D 2QJYC 2WU2D 4H13B 4OGQD 2FXPA 1E7PC 1ZMEC 3AE3D 2ACZD 3AE7D 5L8RJ 1L0VD 1IK7A 1VL2A 2E76B 3AEFC 2QJPC 4OGQC 1KF6C 2WQYD 2WU2C 3P4PD 3P4SD 3VRAD 4KT0J 2ACZC 3AE7C 1EXJA 1PIXA 1L0VC 2FBWC 2WQYC 2WS3D 1OMIA 3FGAD 1ZP0D 3P4PC 1TU3F 2E75B 4IL6X 2BEZF 3AE9C 3Q5RA 2WDQC 3AEAD 2WSEJ 1YQ4D 4Z1MH 3AE4D 3D6YA 3D6ZA 2D2CD 4KX6D 2JO1A 1KMIZ 1YQ3D 1NYHA 3D71A 4H0LC 3AEEC 3RK3E 3AE4C 4YSYC 2QIWA 1EXIA 3C8VA 3AEDC 3AE6D 1YQ3C 1KTMA 1WMKA 4KX6C 3GF7A 1OW6A 1KFYD 3LW5J 4H44D 2P10A 5M1BA 3T97B 4PV1B 2WP9C 5C3JD 4YSZD 1VF5D 3AEFD 1KF6D 3AEGD 5C3JC 4YSZC 1VF5C 3GMAA 1K05A 5KKZC 2FBWD 3AE1C 3AEGC 2BS4C 3VRBD 3Q3DA 3GLMA 3AE9D 2WDQD 2G8YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YXD C;  3VRB C;  4YTP C;  3AEE D;  4YSY D;  3AED D;  1NEK D;  1PV3 A;  1OW8 A;  1NEK C;  2WP9 D;  3AEC C;  2BS2 C;  3P4Q D;  2WDV D;  3AE1 D;  3AEB D;  3P4Q C;  2WDV C;  3AEB C;  2B76 D;  3CIR D;  4YXD D;  1NEN D;  4YTP D;  2B76 C;  2WDR C;  3CIR C;  4YSX C;  3SFD D;  1NEN C;  3ABV D;  4YTM D;  3SFD C;  2WU5 D;  3ABV C;  2H89 C;  4YTM C;  3AEC D;  2WU5 C;  4YTN D;  5C2T C;  3S9O A;  3AE2 C;  3AE5 C;  4YTN C;  3P4R C;  3AE8 D;  4YT0 C;  3B71 A;  3VR8 C;  2G3A A;  3AE3 C;  3AE8 C;  3VR9 D;  1OW7 A;  3P4S C;  2BS3 C;  2WDR D;  3VRA C;  4YSX D;  2H88 D;  2WS3 C;  3SFE D;  3VR9 C;  1ZP0 C;  1QLB C;  3AEA C;  2H88 C;  1ZOY D;  3SFE C;  2H89 D;  1YQ4 C;  1ZOY C;  5C2T D;  3AE6 C;  1K04 A;  3AE2 D;  3AE5 D;  3P4R D;  4YT0 D;  1KFY C;  3VR8 D;  2WU2 D;  1E7P C;  3AE3 D;  2ACZ D;  3AE7 D;  1L0V D;  2WQY D;  3AEF C;  2WU2 C;  1KF6 C;  3P4P D;  3P4S D;  3VRA D;  2WS3 D;  3AE7 C;  1L0V C;  2ACZ C;  2FBW C;  2WQY C;  1ZP0 D;  3P4P C;  3AEA D;  3AE9 C;  2WDQ C;  1YQ4 D;  3AE4 D;  4KX6 D;  1YQ3 D;  3AEE C;  3AE4 C;  4YSY C;  3AE6 D;  3AED C;  4KX6 C;  1YQ3 C;  1KTM A;  1OW6 A;  1KFY D;  2WP9 C;  5C3J D;  4YSZ D;  3AEF D;  1KF6 D;  3AEG D;  5C3J C;  4YSZ C;  1K05 A;  2FBW D;  3AE1 C;  3AEG C;  2BS4 C;  3VRB D;  3AE9 D;  2WDQ D; 
#chains in the Genus database with same CATH topology
 3VRB C;  2HOD A;  3OJA B;  1IFI A;  3H1K J;  1OW8 A;  2R5D A;  1IO4 A;  4DT0 A;  2YMK A;  3BCC E;  3I55 P;  3E1R A;  1GZL A;  2AXT E;  4YTP D;  4RES B;  3OAK A;  1JY3 N;  2MJZ A;  2JR8 A;  1DEE G;  1M90 Q;  2WU5 C;  3RL0 D;  1S3J A;  3WUU A;  3AE8 D;  1JTH B;  3VR8 C;  2KNC A;  1VDF A;  2KP8 A;  5KAF E;  1XTG B;  3Q5S A;  2MKV A;  1S5L X;  2OYI C;  4WY4 D;  2FYU J;  3H1I E;  1IFJ A;  5TIS H;  1ZRT E;  3L71 J;  1ZW0 A;  1L0L E;  3V2N A;  3EQ2 A;  1VQ4 P;  1MFZ A;  5APU A;  2WDQ C;  1FE6 A;  2K9J B;  1JY2 N;  4ASW A;  1L0N D;  1YTZ I;  2ZYA A;  1KFY D;  3S4R A;  3HD7 A;  4N78 D;  2IZ1 A;  2N1T B;  1KQL A;  2R44 A;  3WUT A;  1ZXG A;  2IZ0 A;  4GOE A;  1PP9 J;  1EDI A;  4PD4 D;  3MUD C;  4U7J A;  2E5T A;  3RK2 C;  1NU1 J;  4MN4 C;  2Q3I A;  2XKM A;  1EC5 A;  1NEK D;  4HB1 A;  2KS1 A;  3H1K E;  4DDG A;  1LTJ B;  1NU1 D;  1YJN P;  1DD4 A;  1SQQ K;  1EQ7 A;  5K5G B;  1JNM A;  1GL2 B;  3ABV D;  4YTM D;  4H0L B;  1SQB D;  4H13 D;  5B5E E;  5CBO A;  1KB9 I;  1Q90 D;  2E76 D;  1AQ5 A;  1XTC C;  1OZH A;  4EI2 A;  4DHJ A;  3CXH H;  3V5B A;  3LW5 H;  2I8D A;  1USD A;  3VMA A;  3M06 A;  2H88 D;  1FJK A;  1LGH B;  4R4M A;  1S5L H;  3M9Q A;  1H88 A;  1X0T A;  3CD6 P;  1CSB A;  3AE5 D;  2WU2 D;  2WWW A;  1VPC A;  2BAS A;  2FYU E;  4YXW H;  4OGQ C;  5APQ A;  2GM4 A;  4KT0 J;  3HE5 B;  3SWY A;  3L71 E;  2NPS B;  3MGN A;  3D71 A;  1T8Z A;  3CPW O;  3GF7 A;  1OW6 A;  4H44 D;  2W27 A;  1VF5 D;  4PD4 E;  1FZC B;  3AEG D;  1H0T A;  1K05 A;  3RL0 B;  2B9B A;  2HPC B;  3CL3 D;  1A02 J;  4EIJ A;  4YSY D;  3H25 A;  1PP9 E;  1SLQ A;  3KPE A;  2A06 G;  2D2C B;  1NU1 E;  1JY3 P;  2AXC A;  4C7N B;  1KFN A;  3TDK A;  3KYQ A;  2Q1K A;  2IBZ I;  1NTM J;  4YXD D;  1FOS E;  1NEN D;  1OIP A;  4C7R A;  5AW2 B;  1KYO E;  1PL5 A;  1NTM D;  1LT1 A;  3B71 A;  3CCS P;  3HE4 B;  3H1H D;  1M57 D;  2KUB A;  1GTW A;  3B4S A;  4UB6 H;  2H43 A;  2C9L Y;  4M3L A;  1URQ C;  1BSN A;  3TGU G;  2FYN B;  3VMZ A;  2YO2 A;  3QWO C;  1SFC A;  2J58 A;  1JY2 P;  2CPS A;  2JWA A;  3IFM A;  1RF0 C;  4EOT A;  1PZQ A;  2ACZ C;  1BGY D;  1CW5 A;  3OW2 O;  1DEB A;  2M3E A;  3G71 P;  3CME P;  4BRY A;  2W83 C;  1KV4 A;  2RN0 A;  3BVH A;  1Q81 Q;  1KTM A;  3LW5 J;  1AVO A;  1LWU C;  1FBM A;  4YSZ D;  1KB9 H;  1M1J A;  5H2F H;  3A7O A;  2P7J A;  3HUS A;  2W8Z A;  1AQT A;  3MP7 B;  3CXH D;  5APT A;  3AEE D;  5TIS E;  2Y9Y A;  1P84 D;  4AYC A;  4WY4 A;  3VMX A;  3AEC C;  2E5Y A;  1NTK D;  3RK3 D;  2WDV D;  3AEB D;  1FOS F;  1U7J A;  1LTA C;  2B76 D;  1FZB A;  3L75 D;  4GIF A;  4YSX C;  2WDR C;  1LTS C;  4OH8 B;  1RF1 B;  1NTM E;  4AUW A;  4PV1 C;  1N7S C;  2QRX A;  3L74 J;  5KLI C;  1OVU A;  3B5N D;  3TNU A;  3MIW A;  1VF5 B;  1N73 B;  2KXP B;  3PTZ A;  1NTZ D;  2XNX A;  2WS3 C;  2QVA A;  4FJV A;  2ZYD A;  5AVU B;  1RH5 B;  3FX0 A;  2BEQ D;  1W2B O;  3L74 D;  5AW9 B;  1T6A A;  1IFN A;  3A0H H;  2B89 A;  1E7P C;  1PGJ A;  2A45 I;  3L72 J;  2B88 A;  2KOG A;  3VRA D;  1CI6 A;  2WQY C;  5KLV J;  3P4P C;  1QVG O;  1SQQ G;  1BE3 G;  2QIW A;  1FDM A;  3L72 D;  2IBZ G;  2AEF A;  1L4A A;  5KLV D;  2WPR A;  5C3J C;  1X8Y A;  3CXH E;  3H6P A;  1KIL C;  4EYY Q;  1S5L E;  3E7K A;  4I7Z C;  1SQV D;  3RGU A;  5CCH A;  1A02 F;  1S4X A;  3L70 D;  1KQF B;  2QJK C;  1G2C A;  1ZR2 A;  2J59 M;  1NJI Q;  3P8C D;  3CC7 P;  2AEM A;  3CIR D;  1ZV8 A;  4LGD E;  1FZE A;  1BCC D;  2Z5H A;  1KQG B;  4HKZ H;  3WMM 0;  3O6Q B;  5AW6 B;  3CCU P;  3H1L J;  2QM8 A;  2YKO A;  5TJH A;  3II6 A;  4DHZ A;  3VR9 D;  3L74 E;  1Y8A A;  3BCC D;  2M8R A;  1NHL A;  4L75 A;  4L73 A;  4XE5 B;  2ZJS E;  1KIL E;  2N1T D;  2PRR A;  3HTK B;  1QL1 A;  1N7S B;  3M0D C;  1Q7Y Q;  5KJ7 A;  3A5T A;  2K88 A;  2QJP C;  5AVT B;  3JCU E;  5APS A;  3L72 E;  3ZDM A;  4BXL A;  5KLV E;  2IPP A;  4JF7 A;  2JWD A;  3T97 B;  1L0N G;  2P67 A;  1LTG C;  3P32 A;  1Q2N A;  4UB6 E;  3VRB D;  3I56 P;  1GL2 D;  1ZRT D;  2K3R A;  3RBZ A;  3MTU E;  3G4S P;  1SQQ J;  3IN6 A;  1L0L D;  3CX5 I;  1NKN A;  3M9B A;  1SQX K;  4H0L D;  4D6T J;  4GDO A;  4KJM A;  3PH0 A;  3L4F A;  3P8C E;  3MZW B;  1FC2 C;  1VQ6 P;  1FZA A;  1R5S A;  2NZ2 A;  1KIL B;  3RL0 g;  1USE A;  3L36 A;  2OYH B;  2WU5 D;  3KZI H;  4ZNC A;  2K37 A;  2A45 G;  1KB9 E;  1OVV A;  3FXD A;  4IFM A;  5H2F E;  1JCD A;  1FS0 E;  4W7Y A;  2NPS D;  3GW6 A;  3H1L E;  2ZXX A;  1HTL C;  3H1K D;  2IFM A;  1FDI A;  2HG5 D;  2WVR A;  3AE2 D;  4NPD A;  3GHG A;  3CI9 A;  4LC1 A;  1SVF A;  1YJW P;  1KF6 C;  1GU5 A;  4OWF A;  1DX7 A;  2D2C D;  3P7K A;  1HH0 A;  3AE6 D;  1NAF A;  1SFC C;  3CMA P;  1GW4 A;  2R3C A;  1N8R Q;  5AW4 B;  2R32 A;  2PP6 A;  4L76 A;  1LT9 C;  2YXQ B;  3B5N A;  3AE9 D;  4U3F J;  4YTP C;  4PJ0 H;  2V7Q H;  2FYU D;  3AED D;  2IFN A;  1IFP A;  3L71 D;  1SQQ E;  2L91 A;  2QE7 H;  1MKM A;  3A0H E;  1M1J C;  2BS2 C;  3Q5P A;  4D6T E;  4U3F D;  3HUS C;  1AA0 A;  1OFC X;  3GF3 A;  1N2D C;  1HUC A;  4IOI H;  2ZT9 C;  2FFD B;  4WWI A;  3SFD C;  4ZMD A;  4ZKU A;  1EZV G;  2FXO A;  1BDC A;  4A7P A;  1NGM B;  1PP9 D;  1CZQ A;  1NAY A;  1AV1 A;  2HYN A;  5AVQ B;  1Y47 A;  3K5B A;  2G3A A;  2Y0D A;  1HJ0 A;  2JKV A;  3H1H G;  2WMM A;  3CX5 H;  5C39 A;  3SFE C;  5CJ0 A;  3CWB G;  1RE4 A;  5APX A;  5C2T D;  3A0B H;  1VQN P;  1KFY C;  1ZN5 A;  2BCC G;  4OGQ D;  1K73 Q;  1JTH A;  2XV5 A;  1KYO D;  3N4X A;  5AVS B;  1ZP0 D;  3L37 A;  5KAI H;  1PPJ E;  5GTH H;  4HYT B;  1E5W A;  4Z1M H;  1FZF A;  4N3Y B;  3C9I A;  4DCK A;  1HJB A;  1BGY G;  1J1D C;  3WU2 H;  3AE4 C;  1EXI A;  1YQ3 C;  1RHZ B;  3BAS A;  1PGQ A;  3AEF D;  1GW3 A;  2FBW D;  1D7M A;  5CBN A;  1Y9B A;  1JEK A;  3V2P A;  2HFE D;  3RBX A;  2K9J A;  2OYI B;  2IDB A;  5APV A;  1JOC A;  4U3F E;  1Z56 A;  3VTP C;  1L4A C;  2CK3 H;  2E74 C;  4H13 C;  1UII A;  1MFT A;  4TT3 H;  3KDP B;  2N1T A;  2E76 C;  4LDT A;  1LT9 B;  1SQP G;  3NXS A;  2B87 B;  1K9M Q;  1NTK G;  1SP4 A;  1NH4 A;  1TFF A;  5CCH C;  4ASV A;  3CC4 P;  3CLQ A;  3L75 G;  2QG4 A;  2RKL A;  3PP5 A;  1GDT A;  1PFI A;  2O1J A;  4IFF A;  3AE5 C;  4YTN C;  2V7Q J;  1NOH A;  5CCG D;  1LTJ A;  1GMJ A;  3U59 A;  3LID A;  2E75 C;  4DHI B;  1U7M A;  3JCU H;  3RK2 B;  2ZT9 B;  1GL2 A;  2DW3 A;  3V2R A;  5CMZ A;  1SQX G;  1EDL A;  1L0N K;  2KLU A;  1KZU B;  4H44 C;  3AE3 D;  2ACZ D;  5B66 H;  1L0V C;  1PIX A;  5GTI H;  3AEA D;  3JC2 2;  2Q3E A;  2YO3 A;  3BRV B;  4WBA A;  1MUU A;  1NYH A;  3KZI E;  4YSY C;  5AVX B;  5M1B A;  2P10 A;  5KJ7 C;  4I6L A;  3GMA A;  2FYZ A;  2PFX A;  3BAT A;  3HE5 A;  4YXD C;  1IJD B;  2PGD A;  2NPS A;  1OVR A;  1DD3 A;  4HH2 A;  1HF9 A;  1DH3 A;  1FZC A;  4XA4 A;  3P4Q C;  3PHL A;  4OGQ B;  2HPC A;  2WT7 B;  4QMA A;  3N7N A;  1JCC A;  1N7S D;  1KN7 A;  3CC2 P;  1BCC G;  2E74 B;  3H1J G;  3L35 A;  4C7N A;  4JQ0 D;  1VQ8 P;  2IYO A;  3L73 G;  1S1C X;  2NRG A;  1QL2 A;  3MUD A;  4PJ0 E;  1QVF O;  2HR3 A;  3Q2Y A;  3M91 A;  2LXC B;  4HJG H;  2H89 D;  3BCC G;  1Q82 Q;  2O01 N;  2Y0C A;  1VQO P;  3P4R D;  4YT0 D;  1YIJ P;  1EZV E;  2OGU A;  2QJY C;  2YKP A;  4PD4 I;  2FXP A;  3HE4 A;  5E79 H;  5L8R J;  2WQY D;  3P4P D;  3P4S D;  4GOD A;  2A06 D;  2YKQ A;  3WUV A;  2E75 B;  1T2K C;  1LTI C;  3H32 B;  2Q5U A;  3NMD A;  1SQX J;  3AEE C;  4I1L A;  4KX6 C;  3VYI A;  1QGK B;  1QEX A;  3GHG C;  5C3J D;  3TSI A;  3RK3 C;  1KIL D;  1VQM P;  2KB7 P;  1IK9 A;  3CX5 E;  3H1I G;  2JEE A;  3TGU J;  1URQ B;  2C0X A;  2P58 A;  1KYO I;  3A0B E;  2WP9 D;  2WPV B;  2RH0 A;  1QLE D;  1R5L A;  1IFD A;  1YHQ P;  1MZ9 A;  3MD0 A;  3P8M C;  1SS1 A;  2JP3 A;  2XDJ A;  2M5A B;  3S1K A;  1X22 A;  2QSI A;  1NWQ A;  5KAI E;  1JMB A;  5GTH E;  2WSF J;  3WU2 E;  1WRG A;  1JUN A;  1VQP P;  4JBZ A;  2M0B A;  5BU5 A;  2WZ7 A;  3HD7 C;  3OA7 A;  1LWU B;  1RQV A;  3UIA A;  1KC8 Q;  4OVN F;  2QM7 A;  3VRA C;  3BRT B;  2YNY A;  4LLH A;  1QLB C;  3SSU A;  1RF1 A;  2VRS A;  3CCE P;  3H1K G;  2WPQ A;  3H1J J;  1K04 A;  3L73 J;  5AW8 B;  2A06 E;  2H8P D;  1N73 A;  1YBK A;  2Q7C A;  3AE7 C;  1KB9 D;  3KHU A;  1EXJ A;  1OMI A;  4IL6 X;  2HOD B;  2R5B A;  3LIE A;  3Q5R A;  1YQ4 D;  4TLF A;  2SPZ A;  3D6Y A;  1RE4 C;  2P1J A;  3HRN A;  3H1L D;  1EDK A;  4PV1 B;  1JY3 O;  1PGP A;  1SQX E;  3SWF A;  1M7L A;  1SQP K;  2XU6 A;  5KLI B;  1NTK K;  5KKZ C;  2C9N Y;  5CCG A;  4K3A A;  3IF4 A;  2YIU C;  2O01 H;  1MV8 A;  1G1J A;  1PV3 A;  3CCJ P;  2FYU G;  3PJS K;  1IZN B;  3TGU E;  2ZVN B;  2KNC B;  5B66 E;  3AE1 D;  3TF5 A;  1ZLL A;  5GTI E;  2WIT A;  1NTZ K;  2ZAE B;  1BE3 J;  1J1E C;  1X9V A;  1NO4 A;  2QEX P;  2Q9I A;  1LP1 A;  3G3Z A;  1BDD A;  1AFO A;  1PGO A;  2GA1 A;  2N1T C;  4Y28 J;  1SQQ D;  2A45 H;  1BE3 D;  2BS3 C;  1GK6 A;  1PP9 G;  2JDI H;  4D6T D;  3U1C A;  5APW A;  2O3J A;  1NU1 G;  2IBZ D;  1R8E A;  5CHX A;  4I7Z B;  2I1J A;  1ZOY C;  3FWN A;  3HD7 B;  2KSJ A;  3O6Q A;  3VR8 D;  1LTJ C;  1SQB G;  2QJK B;  4O9B A;  1VL2 A;  3CXH I;  3H1J E;  3V4Q A;  3L73 E;  1GL2 C;  1P84 I;  4IL6 H;  2RMZ A;  1SFC D;  4H0L C;  2KS1 B;  1SQV K;  3HTK A;  1N7S A;  4WVZ A;  2KSE A;  3KQG A;  1RE3 A;  3Q3D A;  2WDQ D;  2G8Y A;  4W7Z A;  1JMM A;  3C1L A;  2JJL A;  1PPJ D;  2OTL P;  3T97 A;  1OX3 A;  5E79 E;  5KKZ B;  2WSC H;  4GOF A;  2FKW B;  2QJP B;  3RK2 D;  2ZT9 D;  2NPS C;  3SFD D;  2YIU B;  2Y0E A;  5AW5 B;  3JSV C;  2H7H A;  4IFD K;  3M0A A;  1L0N J;  1BE3 E;  1NKZ B;  2ZVO B;  3AE2 C;  1ZR4 A;  1FZC C;  4UB8 H;  3RL0 C;  4RKU J;  1M1K Q;  2O01 J;  2FY8 A;  2IBZ E;  3AE8 C;  5DJU B;  2E42 A;  2LXB A;  4WB4 A;  1KIL A;  3SFE D;  4EDF A;  5CJ4 A;  2OYH A;  2LKM A;  1J1E B;  2D2C C;  4WY4 C;  3AE6 C;  2CPB A;  3IR9 A;  1J2J B;  2FXM A;  4L74 A;  1H0T B;  1IK7 A;  1NVO A;  4C46 A;  4JPZ B;  1NTM G;  1EDJ A;  2K1A A;  3AE9 C;  1OXZ A;  4YPC A;  3AE4 D;  1KMI Z;  1YQ3 D;  1L0L K;  3GG2 A;  1W5C E;  4KHX A;  3AED C;  2KLV A;  2YXR B;  4W80 A;  5AW1 B;  3VP9 A;  1SQB J;  2OTJ P;  4JYB A;  3W67 A;  1YI2 P;  2ZFC A;  1RY3 A;  2WTY A;  3GLM A;  1LTB C;  2FYN C;  1N86 A;  3G9R A;  4K35 A;  2WPS A;  1L4A D;  2E74 D;  2W90 A;  1UIX A;  1T3U A;  1NEK C;  1LJ2 A;  1JO5 A;  4I6M C;  3M0D A;  3CCL P;  1S72 P;  2QA4 P;  4AQR D;  1U57 A;  2C0W A;  1P84 H;  5CCH D;  1HVV A;  2IYP A;  4ZKP A;  3ABV C;  2OQQ A;  4DJG A;  4YTM C;  1M8O B;  1SFC B;  1FDO A;  4Y99 C;  4YTN D;  3U1A A;  5C2T C;  3PRJ A;  1N7L A;  2E75 D;  1L0N E;  1OWA A;  1QX8 A;  4BRY B;  1ZP0 C;  3VP8 A;  3V4W A;  2H88 C;  2Z4E A;  2FFD A;  4N78 E;  3EFG A;  3I5C A;  1LNQ A;  2WSC J;  4XFJ A;  1M1J B;  1L0V D;  2WU2 C;  3AEF C;  3HUS B;  2FBW C;  1HBW A;  3KXD A;  1URQ D;  2BEZ F;  4RJT A;  1W2E A;  1RF1 C;  4N6J A;  2FYU K;  2Q6Q A;  1NTZ G;  2OYO A;  4WY4 B;  2GUV A;  5KJ7 D;  3VMY A;  2W6B A;  3L74 G;  1VQ9 P;  1G1I A;  1VF5 C;  3FWL A;  1N73 C;  1YTZ T;  3AEG C;  2O1K A;  1EZV D;  3H1H J;  1SQB E;  1H8A A;  3CWB J;  3R2P A;  2I1K A;  3CCV P;  1S2E A;  5AW7 B;  2BCC J;  2WSF H;  3P4Q D;  3TNU B;  2J5U A;  2N9B A;  1IFM A;  2HLO A;  3L72 G;  5CCG C;  3CWB D;  1NU1 K;  3EWK A;  3EFF K;  5KLV G;  2IX7 C;  1NEN C;  4IL6 E;  1BGY J;  4B86 A;  2BCC D;  1KOR A;  2OYI A;  2KK7 A;  1J1D B;  3AEC D;  3VON A;  3CX5 D;  2AEJ A;  4DDI A;  3SWK A;  2OAR A;  3V6I A;  1SQB K;  3S9O A;  1SQV G;  1VQK P;  1JM0 A;  3AE3 C;  1S9K D;  1LT9 A;  5EFW B;  1CI6 B;  1HWT C;  3L70 G;  2B87 A;  3QH9 A;  1OW7 A;  4YSX D;  2WDR D;  2XND H;  3AEA C;  3R4Y A;  1FZG A;  2E43 A;  1LTT C;  1FAV A;  4PV1 D;  3CCM P;  4Y99 B;  2POH A;  1L4A B;  4H13 B;  1IC2 A;  1SQP J;  2E76 B;  3TYY A;  1NTK J;  1KD1 Q;  1T2K D;  1GU4 A;  2WS3 D;  2AXT H;  3W68 A;  3MHV A;  3USS A;  4KX6 D;  3L75 J;  3C8V A;  1WMK A;  1SQP D;  4BWN A;  5AVW B;  3H1L G;  1G2C B;  4UB8 E;  4YSZ C;  1L2P A;  4RO0 A;  5AVY B;  2BS4 C;  1M56 D;  2Z5I A;  5KAF H;  2W6J H;  5AVZ B;  3M9H A;  1NTZ J;  3H1H E;  1T3J A;  2R3S A;  3CWB E;  4H44 B;  2LR2 A;  1RE3 C;  3TK1 A;  2K9Y A;  2WDV C;  3AEB C;  2BCC E;  2OTK E;  4R4L A;  1SQX D;  1DIP A;  2B76 C;  3NTN A;  2L5G B;  4I2L C;  3HD7 D;  2H89 C;  5AVV B;  5BU8 B;  1L0L G;  1AJY A;  3FXE A;  1S9K E;  1VQL P;  2WSE H;  1BGY E;  3P4R C;  4DZO A;  4YT0 C;  1AVY A;  1NTM K;  3TGU D;  3B5N C;  2W6A A;  3P4S C;  1Q86 Q;  2V4H A;  2WT7 A;  1H89 A;  1YIT P;  4D6T G;  1HGZ A;  4GT1 A;  2M3B A;  2UWJ E;  1SQV J;  1ZME C;  3AE7 D;  3F5H A;  3L70 J;  4NPE A;  4CPG A;  2Y9Z A;  1E79 H;  1GD2 E;  3G6E P;  1P84 E;  2ZYG A;  2OYH C;  1SQP E;  2YMY A;  1NTK E;  3CCR P;  3RK3 E;  2P2U A;  1LP1 B;  2KYV A;  1BCC J;  5B5E H;  2WP9 C;  3L75 E;  1KQS O;  5DJT B;  4JYC A;  3NFQ A;  3H32 A;  4NPF X;  3H1J D;  3PLN A;  3BCC J;  3L73 D;  2KZI A;  3IAO A;  1KFM A;  1RQU A;  2ITA A;  1NTZ E;  3CCQ P;  2QJY B;  1VQ7 P;  1PPJ G;  1HGV A;  4DOJ A;  5AVR B;  3Q1M A;  3F89 A;  3A2A A;  3CIR C;  3VOP A;  5AW0 B;  5AW3 B;  1URQ A;  1YJ9 P;  4GKG A;  1JB0 J;  1GK4 A;  2PAJ A;  3V2Q A;  3GHG B;  1X79 B;  1EZV I;  4PD4 H;  2GUS A;  3L71 G;  3D70 A;  1RF0 A;  1YYC A;  3RK3 B;  2M5A A;  1BSH A;  5APY A;  2KIK A;  3H1I J;  3A3Y B;  3VR9 C;  4U3F G;  1VQ5 P;  2WSS H;  1ZOY D;  1YQ4 C;  1L0L J;  3E1I A;  5KTB A;  2ZXE B;  1LWU A;  3H1I D;  1JY2 O;  2XZR A;  1SQV E;  3B5N B;  3FGA D;  1TU3 F;  2FFD C;  1WT6 A;  2WSE J;  2KI7 B;  3ITK A;  3L70 E;  3D6Z A;  2JO1 A;  2N9Y B;  1K8A Q;  1FJP A;  2KZJ A;  5BVZ A;  1KYO H;  1FU1 A;  3B8E B;  3O8Z A;  2ZFY A;  1KF6 D;  1BCC E;  3AE1 C;  5KLV K;  3VN0 A; 
#chains in the Genus database with same CATH homology
 4U7J A;  1Y9B A;  4YXD C;  3IN6 A;  3VRB C;  4YTP C;  2FYN C;  2YIU C;  4H0L D;  3G9R A;  3AEE D;  4YSY D;  4I7Z C;  3AED D;  3H25 A;  1NEK D;  1DD3 A;  2IDB A;  4GDO A;  2D2C B;  2E74 D;  1PV3 A;  1UIX A;  1MKM A;  1OW8 A;  2WPV B;  3IAO A;  3AEC C;  1NEK C;  1HF9 A;  2WP9 D;  1RQU A;  2BS2 C;  2E74 C;  2YMK A;  4H13 C;  1KQF B;  3Q5P A;  4TT3 H;  4H44 B;  3P4Q D;  2QJK C;  2WDV D;  2E76 C;  3AE1 D;  3AEB D;  2JP3 A;  2J5U A;  3P4Q C;  2K9Y A;  2WDV C;  3GF3 A;  1U57 A;  3AEB C;  4OGQ B;  1DD4 A;  2B76 D;  2QSI A;  2ZT9 D;  1NEN D;  2NZ2 A;  3CIR D;  4YTP D;  4YXD D;  4R4L A;  3EWK A;  3RL0 g;  3Q1M A;  1DIP A;  2B76 C;  2WDR C;  3CIR C;  2ZT9 C;  4YSX C;  1NEN C;  3SFD D;  2WSF J;  3ABV D;  4YTM D;  1KOR A;  3SFD C;  2WU5 D;  1KQG B;  3ABV C;  2H89 C;  2OQQ A;  4YTM C;  4H0L B;  1JB0 J;  3AEC D;  2WU5 C;  4H13 D;  4PV1 C;  1FDO A;  1AJY A;  4YTN D;  5C2T C;  2E74 B;  1PL5 A;  1Q90 D;  2E76 D;  4Y28 J;  3S9O A;  3AE2 C;  3AE5 C;  1NGM B;  3P4R C;  2V7Q J;  5KLI C;  3B71 A;  3AE8 D;  4YT0 C;  4YTN C;  1RQV A;  3VR8 C;  4RKU J;  3D70 A;  2O01 J;  2G3A A;  3AE3 C;  1S1C X;  1VF5 B;  3AE8 C;  2E75 D;  1GMJ A;  3VR9 D;  1HJ0 A;  1OW7 A;  3P4S C;  2BS3 C;  2WDR D;  3VRA C;  4YSX D;  2H88 D;  2WS3 C;  2E75 C;  3SFE D;  3Q5S A;  2MKV A;  1S5L X;  1ZP0 C;  1QLB C;  3VR9 C;  2ZT9 B;  3Q2Y A;  3AEA C;  2H88 C;  4R4M A;  3R4Y A;  1ZOY D;  3SFE C;  2H89 D;  1R8E A;  1YQ4 C;  2BEQ D;  2D2C C;  4I7Z B;  4PV1 D;  1ZOY C;  5C2T D;  2WSC J;  1KIL E;  3AE6 C;  1K04 A;  4XFJ A;  3O6Q A;  1FDI A;  3AE2 D;  3AE5 D;  1ZRT E;  3P4R D;  1KFY C;  4YT0 D;  4H44 C;  3VR8 D;  2QJY C;  2WU2 D;  4H13 B;  4OGQ D;  2FXP A;  1E7P C;  1ZME C;  3AE3 D;  2ACZ D;  3AE7 D;  5L8R J;  1L0V D;  1IK7 A;  1VL2 A;  2E76 B;  3AEF C;  2QJP C;  4OGQ C;  1KF6 C;  2WQY D;  2WU2 C;  3P4P D;  3P4S D;  3VRA D;  4KT0 J;  2ACZ C;  3AE7 C;  1EXJ A;  1PIX A;  1L0V C;  2FBW C;  2WQY C;  2WS3 D;  1OMI A;  3FGA D;  1ZP0 D;  3P4P C;  1TU3 F;  2E75 B;  4IL6 X;  2BEZ F;  3AE9 C;  3Q5R A;  2WDQ C;  3AEA D;  2WSE J;  1YQ4 D;  4Z1M H;  3AE4 D;  3D6Y A;  3D6Z A;  2D2C D;  4KX6 D;  2JO1 A;  1KMI Z;  1YQ3 D;  1NYH A;  3D71 A;  4H0L C;  3AEE C;  3RK3 E;  3AE4 C;  4YSY C;  2QIW A;  1EXI A;  3C8V A;  3AED C;  3AE6 D;  1YQ3 C;  1KTM A;  1WMK A;  4KX6 C;  3GF7 A;  1OW6 A;  1KFY D;  3LW5 J;  4H44 D;  2P10 A;  5M1B A;  3T97 B;  4PV1 B;  2WP9 C;  5C3J D;  4YSZ D;  1VF5 D;  3AEF D;  1KF6 D;  3AEG D;  5C3J C;  4YSZ C;  1VF5 C;  3GMA A;  1K05 A;  5KKZ C;  2FBW D;  3AE1 C;  3AEG C;  2BS4 C;  3VRB D;  3Q3D A;  3GLM A;  3AE9 D;  2WDQ D;  2G8Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...