3AE7C

Crystal structure of porcine heart mitochondrial complex ii bound with 2-iodo-n-(3-isopropoxy-phenyl)-benzamide
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
total genus 44
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3ae7C01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3ae7C02
3AE4C 4YSYD 2WQYD 2H88C 2WU5D 3SFED 3AE8D 4KX6C 3SFEC 4KX6D 2WP9D 3AE5C 1ZOYD 2WS3C 5C3JD 3AE2C 2WDQC 3AE4D 2WDVC 1K04A 3VRBC 3ABVD 2WDVD 4YSZC 2BS3C 3AE5D 5C2TD 3VRAC 1YQ3D 4YT0C 2WP9C 3AEAC 3SFDD 3CIRD 3VR9D 2H88D 2WU5C 1L0VD 2B76D 2WU2C 3AE3D 1KFYD 4YXDD 3AE7D 1OW8A 2H89C 1KF6C 2WDRC 3AEFD 3P4SC 2ACZD 3P4QD 3AECC 2G3AA 3P4RD 4YTMC 4YSXD 1YQ4C 4YTNC 3S9OA 1NEKC 1OW6A 1NENC 3P4SD 2FBWD 3AE1D 3AEGD 3P4PC 1KF6D 2WDRD 1ZP0C 4YTPC 3VR8D 3AEGC 3AE1C 3AEDC 3AE9D 1NEND 1L0VC 1QLBC 1ZP0D 2B76C 3AEED 2FBWC 4YSXC 1K05A 3AE6D 1NEKD 3CIRC 3AECD 1YQ4D 4YTND 3SFDC 4YTMD 3AE6C 3AEEC 1E7PC 3AE9C 3AEDD 2BS4C 3VRBD 2BS2C 3VR8C 4YXDC 4YTPD 5C3JC 1ZOYC 3AE7C 1OW7A 3P4PD 1KFYC 1KTMA 2WU2D 1PV3A 2WDQD 3AE3C 3VR9C 3P4RC 3AE8C 3VRAD 3P4QC 3AEAD 2ACZC 2WQYC 1YQ3C 4YT0D 4YSYC 4YSZD 5C2TC 3B71A 3AEFC 3AEBD 2H89D 3AE2D 2WS3D 3AEBC 3ABVC
chains in the Genus database with same CATH superfamily
1DX7A 3PLNA 4MN4C 2E5YA 3GMAA 5AW2B 1VQ6P 1T2KD 4JQ0D 1IFNA 3II6A 1G1JA 3L35A 1GL2A 2NZ2A 1VQKP 1RF1A 2WDQC 3WU2E 2NPSC 1EDKA 3MHVA 3VTPC 1BGYE 3L36A 1N73B 1NTMJ 1K8AQ 4YXDD 2IYOA 2LKMA 2H89C 3CCUP 1DD3A 3L74D 1FZEA 3M0DA 3BCCD 3NTNA 3S9OA 1JOCA 3CCEP 1KF6D 3LW5H 2AEFA 5KLVG 2YMKA 2E75B 3VR8D 3AEDC 5E79E 1Q90D 1HF9A 1OVRA 2B89A 1FZCB 4GOFA 1VQ7P 1IFMA 1QX8A 1JNMA 2WWWA 4YTND 3A0HE 1KYOD 4PV1C 1E5WA 1JY3O 5DJUB 3K5BA 2E74C 2WSEJ 2QJYC 3VR8C 1SQVK 2ZVNB 3Q5RA 4Y28J 2L5GB 1JMBA 5EFWB 3A0BE 2AXTE 1LWUA 4RJTA 3MP7B 2GUVA 3H1HJ 1FZCA 3HD7A 4YSYC 1SVFA 5C2TC 2YKPA 3V2NA 1M90Q 1NTKE 2H89D 1EXIA 2WS3D 1NTZK 3B4SA 3KZIE 1IFJA 1H8AA 5KAFE 3GHGC 1MUUA 1Z56A 1BCCG 1VQPP 2KYVA 1FJKA 4EI2A 1AQTA 1L2PA 2A45I 2KXPB 3IR9A 1BCCJ 2D2CD 3PP5A 1NU1E 2ZJSE 2IX7C 2BS3C 1KORA 1HVVA 1GD2E 3L70E 4GOEA 3V5BA 5B5EH 3UIAA 3L75D 2IFMA 3BASA 4K3AA 1J1EC 3AE3D 2B76D 1T3JA 3D71A 3W67A 1EZVD 3E1IA 3HRNA 1RF0C 3H1LD 1JO5A 2G3AA 4YTMC 4H0LC 1VQMP 3KZIH 3RL0g 3G6EP 3HE4B 3AEGD 3VMXA 1JEKA 2IBZG 1FDOA 4JBZA 1DIPA 3KHUA 4I7ZC 1LWUC 1HTLC 1FDIA 2FBWC 1JM0A 1FZAA 3CWBJ 3TGUD 1L0LD 2O01N 1NU1K 3TNUB 2M5AA 2WSFH 1GZLA 3O8ZA 2Y9ZA 3H1IJ 4EIJA 1AA0A 1SS1A 2ZXXA 1KTMA 3T97B 1J1DC 3CC7P 3RK3E 2JJLA 2KZJA 1JB0J 5KLVK 4GODA 3L70D 4BRYA 4HJGH 2B9BA 4RKUJ 1PP9E 1RY3A 3RK3D 1D7MA 2K9JA 1IZNB 1S5LX 2KNCB 5TJHA 4GT1A 1GK4A 1RH5B 2JDIH 3C1LA 2WSFJ 5BU5A 3H32A 1PGPA 3GG2A 1HJBA 1AVOA 2HODB 1LTGC 3P8CD 5AW9B 1G2CB 1TU3F 5BU8B 2W6BA 2BCCJ 4YSXD 1RE4A 2NPSA 4XFJA 1L0LJ 1IK9A 3H1JJ 1LWUB 3M91A 3OAKA 4I1LA 3KDPB 1VQNP 1L4AD 3PRJA 1JY2P 5KLIB 1K05A 3BRTB 1PGJA 2O1KA 3FGAD 3VP8A 4BWNA 2Q6QA 1PGOA 1BE3G 3HUSC 1KILA 4D6TE 3PHLA 5AW3B 5CCHD 3HD7B 1J1EB 2HYNA 1SFCC 2JEEA 1SQBD 1YITP 1ZW0A 3AEBC 5BVZA 4U7JA 4D6TJ 3CC2P 2J59M 4YSYD 4DJGA 2OGUA 4H0LB 4OGQC 3L72G 3CX5I 1N73A 1QEXA 3S1KA 3SFEC 3CC4P 1BCCD 4AYCA 2V7QJ 2WSCH 1KB9I 5C3JD 5AVUB 2E74D 3IFMA 1JY3N 4PD4E 5AW6B 2IZ0A 3GF7A 5AVYB 3CPWO 3H1HG 3VR9D 2WU2C 4OWFA 3H1HD 2N1TB 4IOIH 3CCRP 4Y99B 3HTKB 3NFQA 3JCUH 1N7SC 1LT9A 5AVVB 1ZRTD 2ZT9C 1OXZA 3AEED 4DHIB 4N6JA 4OGQB 4KJMA 3VOPA 2R44A 4ZKUA 1RF0A 1YBKA 3AE9C 3B8EB 4DDIA 4EDFA 1L4AA 1VF5C 2N9BA 2Y0EA 3H1KD 1ZXGA 2PGDA 1NTKD 2WPSA 4WB4A 4HKZH 3VR9C 2ZYAA 1CI6A 2AEJA 2MKVA 2XDJA 1GDTA 1DH3A 2NPSD 1YQ3C 4GIFA 5KKZC 3AE2D 1A02J 3MUDC 4C46A 1W2EA 1T3UA 3MTUE 4DZOA 3RK3B 1K73Q 5C39A 4B86A 3L73E 5KTBA 1LT1A 4FJVA 2IYPA 1XTGB 1FZFA 1JY3P 1BGYD 1KFNA 3B5NC 2QJKC 4GKGA 1RE4C 1NGMB 1KZUB 1URQC 4PJ0H 4D6TG 1H0TA 3VMYA 5KLVJ 3L73J 1L0NE 1FC2C 1X79B 1Q2NA 2H88D 2IBZE 3M9BA 3E1RA 1FAVA 2Z4EA 3CMAP 1CW5A 3LIEA 2FYNC 2JO1A 1IK7A 5AVSB 1PP9G 2UWJE 2QRXA 3Q5SA 3CXHD 5AW7B 3L37A 1PPJE 1KYOI 1SQBK 2P7JA 2QVAA 2FYUG 1H88A 3L71J 2JP3A 1S5LH 3F89A 3AECD 3V2RA 3KXDA 3H1HE 1SLQA 2MJZA 1E7PC 3D6YA 1YYCA 3VRBD 3H1IE 3RK2D 2C9NY 4YTPD 3M9HA 4ASWA 1Q7YQ 3RBXA 2E75C 2CK3H 2BCCG 1J1DB 3CD6P 5GTIE 2GM4A 1L0LG 2KI7B 2P58A 1PZQA 5CHXA 3TSIA 3SFED 1SQPK 3H1LE 1U57A 2YO2A 5CCHC 3A2AA 4GDOA 2KB7P 3MIWA 2WDVC 5KJ7D 1SFCA 1Y47A 2E42A 1EZVI 1L0NG 4R4LA 2PFXA 1ZMEC 3L74J 3CI9A 2J5UA 1M1JB 3RBZA 1GU5A 5CMZA 3T97A 2R32A 1CZQA 2QIWA 3AE7D 1OW8A 3CLQA 3HD7C 1LTSC 2WDRC 1FOSF 1BE3D 2YO3A 3RL0C 5GTHH 3P4QD 3AECC 5B5EE 2WSSH 1KYOE 1SQQD 2Q7CA 5AW4B 4K35A 3AE1D 3P4PC 5APXA 2AXCA 2A06D 2XZRA 2P2UA 2R5DA 1L0VC 1ZP0D 2W8ZA 1ZV8A 4YTMD 1M1JC 5KKZB 4HH2A 2I8DA 1N86A 1Q81Q 2BS4C 2BS2C 1MFTA 1JUNA 3AE3C 3PJSK 5K5GB 1WT6A 1K9MQ 1NYHA 2KS1A 3Q2YA 1FE6A 5GTHE 3A0BH 3H1ID 1SQPD 1RF1B 1OFCX 2BASA 2PAJA 1S72P 3BCCG 3AE2C 5AVTB 1YHQP 3E7KA 3EWKA 2Y0CA 3VONA 4PJ0E 4OVNF 1M8OB 2N1TC 1X0TA 3H1JE 3WUVA 3FXEA 5KLIC 2ACZD 1BE3J 4WY4D 3TK1A 4H0LD 1NTMG 4YTNC 3P7KA 1NO4A 1OW6A 1URQA 1U7JA 2WTYA 1SQVE 1VQOP 2IPPA 1WRGA 3AEGC 2B76C 1OX3A 1BSNA 2M3BA 3CMEP 3CIRC 5AW0B 4IFMA 1SQVJ 3AEDD 1RQUA 3OJAB 3L71E 3I55P 1ZOYC 1LNQA 1ZR4A 1NKZB 5CCGD 4JF7A 3VN0A 3VRAD 4ZKPA 1TFFA 3V4QA 3BRVB 1BCCE 3B71A 3MZWB 2Q3EA 1FBMA 2XU6A 5GTIH 1U7MA 2HLOA 1KQSO 1LTBC 3CCSP 3AE8D 1LP1B 1NWQA 1SQBE 2WP9D 3SWKA 1ZOYD 3TF5A 3Q1MA 2QEXP 2R3CA 5KLVE 1VPCA 1PIXA 1SFCD 1MV8A 3VRAC 1Y8AA 2A45H 2E5TA 3CIRD 2B87B 3VYIA 1SQVD 2P1JA 4U3FE 2YMYA 1JCDA 1ZN5A 1PFIA 1L0NK 2ZT9B 4DOJA 1R5SA 4L76A 2RMZA 3FWNA 2D2CB 2W83C 3IN6A 1KF6C 4YXWH 1KV4A 3H1KE 4UB6E 2AEMA 1SFCB 3CCQP 2C9LY 2KSJA 1LGHB 3A0HH 1VL2A 1KFMA 1RQVA 1BDDA 2QM8A 5H2FH 2C0XA 3RL0B 2HPCA 4YSXC 2AXTH 2JWAA 1NEKD 3CXHE 1NTZJ 2Q1KA 1L0NJ 2ZVOB 3TGUJ 1SQQE 1NTZG 2FFDC 4YXDC 2OTLP 1OZHA 3HUSB 2E76D 4H44B 3P4PD 1BSHA 1GW4A 1PL5A 3P4RC 2A06E 3CXHI 4YT0D 2ZAEB 1SQQJ 3QH9A 3L73G 3P8MC 2Q9IA 1SQVG 3L75E 2POHA 2K3RA 5KJ7C 2K9YA 1NTKJ 5CCGA 3L72J 2KK7A 2KIKA 1T2KC 2FXPA 1Y9BA 1KN7A 1JCCA 2OTJP 2WPRA 1HGZA 5H2FE 4OH8B 2JR8A 3ABVD 4ZMDA 1JTHB 3I5CA 1DEEG 1YI2P 2W27A 1KILE 3CXHH 1S9KE 4WBAA 2E75D 1M56D 2WU5C 1L0VD 1HJ0A 1OVVA 1EDIA 1KFYD 4PV1B 2QJPB 4N3YB 1S9KD 3JC22 3CX5D 4WY4A 4A7PA 4Y99C 1SQXD 1KQFB 4TLFA 1KB9E 1T6AA 1OMIA 2OQQA 4NPEA 4XA4A 2QG4A 4YTPC 3AE1C 1BE3E 1EZVE 3GHGB 2M3EA 2KZIA 4XE5B 3V2QA 3EFGA 4W7ZA 5APVA 5AVQB 3A7OA 3AE6C 1YTZT 3CWBE 1OWAA 3ITKA 1H0TB 4BRYB 5APYA 4I7ZB 5CBOA 1G1IA 2WMMA 3OW2O 5TISH 2C0WA 1RE3C 4C7NA 4N78E 2K88A 2QJKB 1M57D 4EOTA 2VRSA 4WWIA 1SQXK 1KB9H 4N78D 2XNXA 3AE4C 1IO4A 2ZFYA 2IFNA 5AVXB 1NTMD 1GK6A 2H43A 2KP8A 2WS3C 4Z1MH 1SQQG 4NPFX 1K04A 3NXSA 1FS0E 5DJTB 3H32B 1OVUA 4LC1A 2N9YB 1EQ7A 3SSUA 3H1LG 4YT0C 1M7LA 2FY8A 2CPBA 1JMMA 1KC8Q 5B66H 2FYUE 2Z5IA 2E76C 3KYQA 1QGKB 2OYIA 1NAYA 4M3LA 3TDKA 1XTCC 5AW1B 3G4SP 4BXLA 1AJYA 4KHXA 2BCCE 2FYUJ 5CJ0A 1SQXG 2KLVA 1L0LE 1RE3A 5CCHA 1NEND 1QLBC 1KILD 5AW8B 1GMJA 1N7SB 3CCVP 1P84I 5KJ7A 3H25A 1UIIA 3BVHA 3MGNA 2YXQB 1BDCA 4H13C 1VQ5P 1MFZA 4EYYQ 3USSA 2HPCB 3AEFC 2W6JH 4IFFA 2K37A 1NTZD 4IL6E 4U3FD 1USDA 4HB1A 1KYOH 1N73C 2A06G 3S4RA 1MZ9A 1VDFA 2FYUD 2QSIA 1QL2A 1L4AB 1EC5A 3SWFA 3GLMA 1M1JA 4QMAA 2WITA 3L74G 4U3FG 4H44C 2O01H 1HBWA 5C2TD 1NOHA 4U3FJ 3R2PA 3CWBG 3M0AA 4OGQD 5CCGC 2WVRA 1KILC 2WPVB 3WUTA 1PPJG 4H13B 1N2DC 3U59A 1GL2B 1R8EA 2JKVA 1M1KQ 2YXRB 3CL3D 1VQ9P 2HFED 1J2JB 1NENC 4IL6X 4LDTA 1GTWA 2O3JA 1GU4A 1NVOA 3O6QB 2PP6A 2KSEA 3L4FA 2ZFCA 3NMDA 1P84E 3AE6D 2KLUA 1X9VA 1HUCA 1P84D 2KOGA 1SQXJ 1LP1A 1N8RQ 3H1KG 1NU1G 1JTHA 1NU1D 1WMKA 4RO0A 3H6PA 3AEAD 1W2BO 3A5TA 1Q86Q 5C3JC 1EDLA 1H89A 2WU5D 1URQB 3TYYA 4DT0A 3LW5J 1RF1C 1NAFA 3P8CE 2J58A 1KILB 1NTZE 4JYBA 3H1JG 1FDMA 2V7QH 1AVYA 1YIJP 3JSVC 3CCMP 1JY2O 2QA4P 3RK3C 2XKMA 1KMIZ 5APQA 3TNUA 2WSEH 2R3SA 3GW6A 1L4AC 2BEZF 1PPJD 1LTTC 3BCCE 3M06A 1SQPE 3FXDA 4TT3H 2OARA 3ZDMA 5AW5B 3L70J 3HE4A 2FXOA 2FFDB 3H1JD 3P4SD 2FBWD 1QLED 2ITAA 3SWYA 1ZP0C 2Z5HA 3L72D 4L73A 2N1TD 3H1LJ 2QE7H 1YJNP 2ZYDA 2I1KA 1W5CE 2OYIC 2E43A 4CPGA 3OA7A 2B87A 1RHZB 4RESB 3L75J 2GUSA 3AE7C 1A02F 1OW7A 5KAFH 1VF5B 1FU1A 1S1CX 3P4QC 4YSZD 2WPQA 2L91A 4R4MA 3V6IA 3M0DC 2LXBA 2DW3A 3L71G 4W7YA 3WUUA 5E79H 1N7LA 4LLHA 4PD4I 2QJPC 1X8YA 2WP9C 3AEAC 1NTMK 3GHGA 1GL2D 1FZGA 3G71P 1CSBA 1KB9D 1NKNA 4JPZB 3CWBD 3N7NA 3P4SC 1FZCC 2KUBA 1DEBA 1SP4A 2BEQD 3V2PA 4PD4H 3RL0D 1L0ND 1PGQA 2OTKE 2H7HA 3RK2C 3B5NB 3EFFK 2P67A 3L70G 1IFDA 3KQGA 2IZ1A 1FJPA 3JCUE 2LXCB 2FYNB 3FWLA 1E79H 5B66E 1JY2N 2O01J 2RH0A 2D2CC 4AQRD 3I56P 2FFDA 1PV3A 4AUWA 3FX0A 3AE8C 5AVZB 2WT7B 1BGYJ 4WY4C 2ACZC 3CX5H 1IFIA 1NTME 1HWTC 4H44D 1BGYG 2GA1A 2W90A 2P10A 3EQ2A 1NH4A 3D70A 2PRRA 2YKQA 1G2CA 1NHLA 2ZYGA 4YPCA 1LT9B 1LTJC 2OYHC 1ZR2A 2B88A 5APTA 1NTKK 1OIPA 2BCCD 2Y0DA 3IAOA 1QVGO 2M0BA 2I1JA 5CJ4A 4PV1D 2OYOA 3H1KJ 1YQ3D 2N1TA 4DHJA 1VQ8P 1EZVG 1UIXA 2IBZI 1NU1J 4H13D 1S4XA 1X22A 5APSA 1KQGB 1S2EA 3AEFD 3WMM0 3LIDA 1T8ZA 1EXJA 2Q5UA 1FZBA 1YQ4C 1LTJB 2YKOA 3Q5PA 2OYHB 1SQPG 3TGUE 2K1AA 3BCCJ 2ZT9D 1VF5D 1SQPJ 4DHZA 4ASVA 3AE9D 1DD4A 1L0LK 2CPSA 2WT7A 1YTZI 2M5AB 4WVZA 3KPEA 3HUSA 2IBZD 2XV5A 2ZXEB 3AEEC 2OYIB 3G3ZA 3L73D 2QJYB 2FXMA 1GL2C 3L72E 2WU2D 2NRGA 3M9QA 3VMZA 3TGUG 1LTAC 1KQLA 3A3YB 2YNYA 3HD7D 3HE5B 2WDQD 2FYUK 4L75A 3CCLP 5AVRB 2WQYD 2Y9YA 3O6QA 4KX6C 2A45G 4PD4D 2G8YA 1YJ9P 3AE5C 3PH0A 3H1IG 5TISE 1SQBJ 2WSCJ 4UB6H 4I6MC 3AE4D 2YIUC 5APWA 2WDVD 3L74E 1SQBG 3C9IA 4YSZC 5L8RJ 5CBNA 1SQXE 3P32A 3GF3A 4IL6H 1IJDB 3WU2H 1ZRTE 1HGVA 1PP9J 3L75G 1AFOA 4HYTB 1LTIC 1QVFO 4IFDK 2XNDH 4C7RA 1EDJA 2H8PD 4DDGA 1QL1A 2V4HA 4C7NB 1VQ4P 4JYCA 1FOSE 2WDRD 1NJIQ 1R5LA 3W68A 4O9BA 2FYZA 3L71D 2O1JA 3SFDC 3HE5A 3G9RA 2LR2A 3C8VA 4KT0J 2WZ7A 1LTJA 2OYHA 1LT9C 3HTKA 2E76B 3QWOC 4UB8E 1KFYC 3RGUA 2IDBA 3U1CA 3BATA 1AQ5A 2HR3A 3PTZA 2RKLA 3D6ZA 4DCKA 1MKMA 3IF4A 4WY4B 5KAIE 3AEBD 2YIUB 1Q82Q 3ABVC 5KLVD 1N7SA 2H88C 2JWDA 2NPSB 4I2LC 4D6TD 3MD0A 1ZLLA 4KX6D 2KNCA 1HH0A 5APUA 3VMAA 1P84H 3VRBC 3B5ND 1IC2A 2HG5D 2HODA 3AE5D 3MUDA 3SFDD 2SPZA 3R4YA 1AV1A 1KD1Q 4LGDE 4UB8H 1S3JA 3U1AA 5AVWB 3N4XA 2K9JB 1NTKG 1GW3A 2M8RA 3F5HA 1S5LE 5KAIH 1LJ2A 3P4RD 2FKWB 2W6AA 1NEKC 1YJWP 1CI6B 2R5BA 1SQQK 3V4WA 3Q3DA 4I6LA 3RK2B 4NPDA 3CX5E 1YQ4D 3B5NA 1IFPA 1USEA 4ZNCA 3CCJP 1PP9D 2E74B 5M1BA 4W80A 1N7SD 2KS1B 1URQD 2WQYC 2Q3IA 2RN0A 1VQLP 2QM7A 3VP9A 4L74A
chains in the Genus database with same CATH topology
4R4MA 4U7JA 3AE4C 2P10A 2K9YA 4YSYD 3D70A 2WQYD 3GMAA 3AE2D 2H88C 2WU5D 3SFED 4H0LB 3LW5J 3O6QA 3AE8D 4OGQC 4KX6C 1U57A 2FXPA 1Y9BA 4RKUJ 2G8YA 3SFEC 4KX6D 2WP9D 2QSIA 2V7QJ 3AE5C 2NZ2A 2WSCJ 4GDOA 2D2CD 1ZOYD 2WS3C 5C3JD 3AE2C 2WDQC 1S5LX 3IAOA 3GLMA 2QJPC 2YIUC 2QJKC 1K04A 4Z1MH 3Q1MA 2WDVC 2E74D 3ABVD 2WDVD 3VRBC 3EWKA 4YSZC 5L8RJ 2BS3C 1NGMB 3GF3A 4H44C 4R4LA 3AE5D 1KORA 1PIXA 4PV1D 1ZMEC 1KMIZ 3VRAC 1KILE 1YQ3D 2J5UA 4YT0C 5C2TD 2WSFJ 1ZRTE 3AEAC 2WP9C 3SFDD 3CIRD 3GF7A 4OGQD 1UIXA 3AE4D 3VR9D 2E75D 3R4YA 2H88D 2WU5C 1L0VD 2B76D 2WPVB 2WU2C 3AE3D 2BEZF 2QIWA 2ZT9B 1HJ0A 3D71A 1KFYD 4YXDD 4PV1B 2D2CB 2E76C 3AE7D 1OW8A 4H13B 4H13D 3IN6A 1TU3F 2H89C 2FYNC 2JO1A 1R8EA 1KF6C 2WDRC 1IK7A 1KQGB 3AEFD 4TT3H 3P4SC 1DD3A 5KLIC 2ACZD 3P4QD 3AECC 4H0LD 3Q5SA 2BEQD 1KQFB 1EXJA 2G3AA 3P4RD 4H0LC 1AJYA 1YQ4C 4YTNC 4YSXD 4YTMC 3S9OA 1OMIA 3Q5PA 1NEKC 3AE9D 1OW6A 1VL2A 1NENC 4IL6X 3RL0g 3P4SD 4XFJA 2FBWD 3AE1D 3AEGD 1RQVA 3P4PC 1KF6D 2WDRD 1ZP0C 2OQQA 1FDOA 2ZT9D 1VF5D 1DIPA 4I7ZC 4YTPC 2YMKA 2E75B 3VR8D 3AEGC 3AE1C 1FDIA 3AEDC 1DD4A 1Q90D 2JP3A 2ZT9C 3Q3DA 1HF9A 1L0VC 1NEND 1QLBC 1ZP0D 2B76C 3AEED 2FBWC 1GMJA 4YSXC 1K05A 3AE6D 3Q2YA 4OGQB 1NEKD 3CIRC 3AECD 1YQ4D 4YTND 3SFDC 4YTMD 3FGAD 3AE6C 3G9RA 4PV1C 3H25A 3AEEC 3C8VA 1E7PC 3D6YA 3AE9C 1RQUA 4KT0J 2BS4C 3AEDD 2E74C 2WSEJ 2QJYC 2BS2C 4YXDC 3VRBD 3VR8C 2O01J 2E74B 4I7ZB 4YTPD 4H13C 5C3JC 1ZOYC 1VF5C 2D2CC 2E76B 2E76D 3AE7C 3Q5RA 1OW7A 4H44B 4Y28J 1KFYC 3P4PD 2IDBA 1KTMA 1VF5B 3T97B 2WU2D 1PV3A 5M1BA 3AE3C 2WDQD 2E75C 3VR9C 1PL5A 3P4RC 3AE8C 3VRAD 1S1CX 1WMKA 2MKVA 3P4QC 3D6ZA 3AEAD 3RK3E 2ACZC 2WQYC 1YQ3C 4YT0D 4YSYC 1MKMA 4YSZD 5C2TC 3B71A 3AEFC 4H44D 1JB0J 3AEBD 2H89D 5KKZC 1EXIA 1NYHA 2WS3D 3AEBC 3ABVC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AE4 C;  4YSY D;  2WQY D;  2H88 C;  2WU5 D;  3SFE D;  3AE8 D;  4KX6 C;  3SFE C;  4KX6 D;  2WP9 D;  3AE5 C;  1ZOY D;  2WS3 C;  5C3J D;  3AE2 C;  2WDQ C;  3AE4 D;  2WDV C;  1K04 A;  3VRB C;  3ABV D;  2WDV D;  4YSZ C;  2BS3 C;  3AE5 D;  5C2T D;  3VRA C;  1YQ3 D;  4YT0 C;  2WP9 C;  3AEA C;  3SFD D;  3CIR D;  3VR9 D;  2H88 D;  2WU5 C;  1L0V D;  2B76 D;  2WU2 C;  3AE3 D;  1KFY D;  4YXD D;  3AE7 D;  1OW8 A;  2H89 C;  1KF6 C;  2WDR C;  3AEF D;  3P4S C;  2ACZ D;  3P4Q D;  3AEC C;  2G3A A;  3P4R D;  4YTM C;  4YSX D;  1YQ4 C;  4YTN C;  3S9O A;  1NEK C;  1OW6 A;  1NEN C;  3P4S D;  2FBW D;  3AE1 D;  3AEG D;  3P4P C;  1KF6 D;  2WDR D;  1ZP0 C;  4YTP C;  3VR8 D;  3AEG C;  3AE1 C;  3AED C;  3AE9 D;  1NEN D;  1L0V C;  1QLB C;  1ZP0 D;  2B76 C;  3AEE D;  2FBW C;  4YSX C;  1K05 A;  3AE6 D;  1NEK D;  3CIR C;  3AEC D;  1YQ4 D;  4YTN D;  3SFD C;  4YTM D;  3AE6 C;  3AEE C;  1E7P C;  3AE9 C;  3AED D;  2BS4 C;  3VRB D;  2BS2 C;  3VR8 C;  4YXD C;  4YTP D;  5C3J C;  1ZOY C;  3AE7 C;  1OW7 A;  3P4P D;  1KFY C;  1KTM A;  2WU2 D;  1PV3 A;  2WDQ D;  3AE3 C;  3VR9 C;  3P4R C;  3AE8 C;  3VRA D;  3P4Q C;  3AEA D;  2ACZ C;  2WQY C;  1YQ3 C;  4YT0 D;  4YSY C;  4YSZ D;  5C2T C;  3B71 A;  3AEF C;  3AEB D;  2H89 D;  3AE2 D;  2WS3 D;  3AEB C;  3ABV C; 
#chains in the Genus database with same CATH topology
 1DX7 A;  3PLN A;  4MN4 C;  2E5Y A;  3GMA A;  5AW2 B;  1VQ6 P;  1T2K D;  4JQ0 D;  1IFN A;  3II6 A;  1G1J A;  3L35 A;  1GL2 A;  2NZ2 A;  1VQK P;  1RF1 A;  2WDQ C;  3WU2 E;  2NPS C;  1EDK A;  3MHV A;  3VTP C;  1BGY E;  3L36 A;  1N73 B;  1NTM J;  1K8A Q;  4YXD D;  2IYO A;  2LKM A;  2H89 C;  3CCU P;  1DD3 A;  3L74 D;  1FZE A;  3M0D A;  3BCC D;  3NTN A;  3S9O A;  1JOC A;  3CCE P;  1KF6 D;  3LW5 H;  2AEF A;  5KLV G;  2YMK A;  2E75 B;  3VR8 D;  3AED C;  5E79 E;  1Q90 D;  1HF9 A;  1OVR A;  2B89 A;  1FZC B;  4GOF A;  1VQ7 P;  1IFM A;  1QX8 A;  1JNM A;  2WWW A;  4YTN D;  3A0H E;  1KYO D;  4PV1 C;  1E5W A;  1JY3 O;  5DJU B;  3K5B A;  2E74 C;  2WSE J;  2QJY C;  3VR8 C;  1SQV K;  2ZVN B;  3Q5R A;  4Y28 J;  2L5G B;  1JMB A;  5EFW B;  3A0B E;  2AXT E;  1LWU A;  4RJT A;  3MP7 B;  2GUV A;  3H1H J;  1FZC A;  3HD7 A;  4YSY C;  1SVF A;  5C2T C;  2YKP A;  3V2N A;  1M90 Q;  1NTK E;  2H89 D;  1EXI A;  2WS3 D;  1NTZ K;  3B4S A;  3KZI E;  1IFJ A;  1H8A A;  5KAF E;  3GHG C;  1MUU A;  1Z56 A;  1BCC G;  1VQP P;  2KYV A;  1FJK A;  4EI2 A;  1AQT A;  1L2P A;  2A45 I;  2KXP B;  3IR9 A;  1BCC J;  2D2C D;  3PP5 A;  1NU1 E;  2ZJS E;  2IX7 C;  2BS3 C;  1KOR A;  1HVV A;  1GD2 E;  3L70 E;  4GOE A;  3V5B A;  5B5E H;  3UIA A;  3L75 D;  2IFM A;  3BAS A;  4K3A A;  1J1E C;  3AE3 D;  2B76 D;  1T3J A;  3D71 A;  3W67 A;  1EZV D;  3E1I A;  3HRN A;  1RF0 C;  3H1L D;  1JO5 A;  2G3A A;  4YTM C;  4H0L C;  1VQM P;  3KZI H;  3RL0 g;  3G6E P;  3HE4 B;  3AEG D;  3VMX A;  1JEK A;  2IBZ G;  1FDO A;  4JBZ A;  1DIP A;  3KHU A;  4I7Z C;  1LWU C;  1HTL C;  1FDI A;  2FBW C;  1JM0 A;  1FZA A;  3CWB J;  3TGU D;  1L0L D;  2O01 N;  1NU1 K;  3TNU B;  2M5A A;  2WSF H;  1GZL A;  3O8Z A;  2Y9Z A;  3H1I J;  4EIJ A;  1AA0 A;  1SS1 A;  2ZXX A;  1KTM A;  3T97 B;  1J1D C;  3CC7 P;  3RK3 E;  2JJL A;  2KZJ A;  1JB0 J;  5KLV K;  4GOD A;  3L70 D;  4BRY A;  4HJG H;  2B9B A;  4RKU J;  1PP9 E;  1RY3 A;  3RK3 D;  1D7M A;  2K9J A;  1IZN B;  1S5L X;  2KNC B;  5TJH A;  4GT1 A;  1GK4 A;  1RH5 B;  2JDI H;  3C1L A;  2WSF J;  5BU5 A;  3H32 A;  1PGP A;  3GG2 A;  1HJB A;  1AVO A;  2HOD B;  1LTG C;  3P8C D;  5AW9 B;  1G2C B;  1TU3 F;  5BU8 B;  2W6B A;  2BCC J;  4YSX D;  1RE4 A;  2NPS A;  4XFJ A;  1L0L J;  1IK9 A;  3H1J J;  1LWU B;  3M91 A;  3OAK A;  4I1L A;  3KDP B;  1VQN P;  1L4A D;  3PRJ A;  1JY2 P;  5KLI B;  1K05 A;  3BRT B;  1PGJ A;  2O1K A;  3FGA D;  3VP8 A;  4BWN A;  2Q6Q A;  1PGO A;  1BE3 G;  3HUS C;  1KIL A;  4D6T E;  3PHL A;  5AW3 B;  5CCH D;  3HD7 B;  1J1E B;  2HYN A;  1SFC C;  2JEE A;  1SQB D;  1YIT P;  1ZW0 A;  3AEB C;  5BVZ A;  4U7J A;  4D6T J;  3CC2 P;  2J59 M;  4YSY D;  4DJG A;  2OGU A;  4H0L B;  4OGQ C;  3L72 G;  3CX5 I;  1N73 A;  1QEX A;  3S1K A;  3SFE C;  3CC4 P;  1BCC D;  4AYC A;  2V7Q J;  2WSC H;  1KB9 I;  5C3J D;  5AVU B;  2E74 D;  3IFM A;  1JY3 N;  4PD4 E;  5AW6 B;  2IZ0 A;  3GF7 A;  5AVY B;  3CPW O;  3H1H G;  3VR9 D;  2WU2 C;  4OWF A;  3H1H D;  2N1T B;  4IOI H;  3CCR P;  4Y99 B;  3HTK B;  3NFQ A;  3JCU H;  1N7S C;  1LT9 A;  5AVV B;  1ZRT D;  2ZT9 C;  1OXZ A;  3AEE D;  4DHI B;  4N6J A;  4OGQ B;  4KJM A;  3VOP A;  2R44 A;  4ZKU A;  1RF0 A;  1YBK A;  3AE9 C;  3B8E B;  4DDI A;  4EDF A;  1L4A A;  1VF5 C;  2N9B A;  2Y0E A;  3H1K D;  1ZXG A;  2PGD A;  1NTK D;  2WPS A;  4WB4 A;  4HKZ H;  3VR9 C;  2ZYA A;  1CI6 A;  2AEJ A;  2MKV A;  2XDJ A;  1GDT A;  1DH3 A;  2NPS D;  1YQ3 C;  4GIF A;  5KKZ C;  3AE2 D;  1A02 J;  3MUD C;  4C46 A;  1W2E A;  1T3U A;  3MTU E;  4DZO A;  3RK3 B;  1K73 Q;  5C39 A;  4B86 A;  3L73 E;  5KTB A;  1LT1 A;  4FJV A;  2IYP A;  1XTG B;  1FZF A;  1JY3 P;  1BGY D;  1KFN A;  3B5N C;  2QJK C;  4GKG A;  1RE4 C;  1NGM B;  1KZU B;  1URQ C;  4PJ0 H;  4D6T G;  1H0T A;  3VMY A;  5KLV J;  3L73 J;  1L0N E;  1FC2 C;  1X79 B;  1Q2N A;  2H88 D;  2IBZ E;  3M9B A;  3E1R A;  1FAV A;  2Z4E A;  3CMA P;  1CW5 A;  3LIE A;  2FYN C;  2JO1 A;  1IK7 A;  5AVS B;  1PP9 G;  2UWJ E;  2QRX A;  3Q5S A;  3CXH D;  5AW7 B;  3L37 A;  1PPJ E;  1KYO I;  1SQB K;  2P7J A;  2QVA A;  2FYU G;  1H88 A;  3L71 J;  2JP3 A;  1S5L H;  3F89 A;  3AEC D;  3V2R A;  3KXD A;  3H1H E;  1SLQ A;  2MJZ A;  1E7P C;  3D6Y A;  1YYC A;  3VRB D;  3H1I E;  3RK2 D;  2C9N Y;  4YTP D;  3M9H A;  4ASW A;  1Q7Y Q;  3RBX A;  2E75 C;  2CK3 H;  2BCC G;  1J1D B;  3CD6 P;  5GTI E;  2GM4 A;  1L0L G;  2KI7 B;  2P58 A;  1PZQ A;  5CHX A;  3TSI A;  3SFE D;  1SQP K;  3H1L E;  1U57 A;  2YO2 A;  5CCH C;  3A2A A;  4GDO A;  2KB7 P;  3MIW A;  2WDV C;  5KJ7 D;  1SFC A;  1Y47 A;  2E42 A;  1EZV I;  1L0N G;  4R4L A;  2PFX A;  1ZME C;  3L74 J;  3CI9 A;  2J5U A;  1M1J B;  3RBZ A;  1GU5 A;  5CMZ A;  3T97 A;  2R32 A;  1CZQ A;  2QIW A;  3AE7 D;  1OW8 A;  3CLQ A;  3HD7 C;  1LTS C;  2WDR C;  1FOS F;  1BE3 D;  2YO3 A;  3RL0 C;  5GTH H;  3P4Q D;  3AEC C;  5B5E E;  2WSS H;  1KYO E;  1SQQ D;  2Q7C A;  5AW4 B;  4K35 A;  3AE1 D;  3P4P C;  5APX A;  2AXC A;  2A06 D;  2XZR A;  2P2U A;  2R5D A;  1L0V C;  1ZP0 D;  2W8Z A;  1ZV8 A;  4YTM D;  1M1J C;  5KKZ B;  4HH2 A;  2I8D A;  1N86 A;  1Q81 Q;  2BS4 C;  2BS2 C;  1MFT A;  1JUN A;  3AE3 C;  3PJS K;  5K5G B;  1WT6 A;  1K9M Q;  1NYH A;  2KS1 A;  3Q2Y A;  1FE6 A;  5GTH E;  3A0B H;  3H1I D;  1SQP D;  1RF1 B;  1OFC X;  2BAS A;  2PAJ A;  1S72 P;  3BCC G;  3AE2 C;  5AVT B;  1YHQ P;  3E7K A;  3EWK A;  2Y0C A;  3VON A;  4PJ0 E;  4OVN F;  1M8O B;  2N1T C;  1X0T A;  3H1J E;  3WUV A;  3FXE A;  5KLI C;  2ACZ D;  1BE3 J;  4WY4 D;  3TK1 A;  4H0L D;  1NTM G;  4YTN C;  3P7K A;  1NO4 A;  1OW6 A;  1URQ A;  1U7J A;  2WTY A;  1SQV E;  1VQO P;  2IPP A;  1WRG A;  3AEG C;  2B76 C;  1OX3 A;  1BSN A;  2M3B A;  3CME P;  3CIR C;  5AW0 B;  4IFM A;  1SQV J;  3AED D;  1RQU A;  3OJA B;  3L71 E;  3I55 P;  1ZOY C;  1LNQ A;  1ZR4 A;  1NKZ B;  5CCG D;  4JF7 A;  3VN0 A;  3VRA D;  4ZKP A;  1TFF A;  3V4Q A;  3BRV B;  1BCC E;  3B71 A;  3MZW B;  2Q3E A;  1FBM A;  2XU6 A;  5GTI H;  1U7M A;  2HLO A;  1KQS O;  1LTB C;  3CCS P;  3AE8 D;  1LP1 B;  1NWQ A;  1SQB E;  2WP9 D;  3SWK A;  1ZOY D;  3TF5 A;  3Q1M A;  2QEX P;  2R3C A;  5KLV E;  1VPC A;  1PIX A;  1SFC D;  1MV8 A;  3VRA C;  1Y8A A;  2A45 H;  2E5T A;  3CIR D;  2B87 B;  3VYI A;  1SQV D;  2P1J A;  4U3F E;  2YMY A;  1JCD A;  1ZN5 A;  1PFI A;  1L0N K;  2ZT9 B;  4DOJ A;  1R5S A;  4L76 A;  2RMZ A;  3FWN A;  2D2C B;  2W83 C;  3IN6 A;  1KF6 C;  4YXW H;  1KV4 A;  3H1K E;  4UB6 E;  2AEM A;  1SFC B;  3CCQ P;  2C9L Y;  2KSJ A;  1LGH B;  3A0H H;  1VL2 A;  1KFM A;  1RQV A;  1BDD A;  2QM8 A;  5H2F H;  2C0X A;  3RL0 B;  2HPC A;  4YSX C;  2AXT H;  2JWA A;  1NEK D;  3CXH E;  1NTZ J;  2Q1K A;  1L0N J;  2ZVO B;  3TGU J;  1SQQ E;  1NTZ G;  2FFD C;  4YXD C;  2OTL P;  1OZH A;  3HUS B;  2E76 D;  4H44 B;  3P4P D;  1BSH A;  1GW4 A;  1PL5 A;  3P4R C;  2A06 E;  3CXH I;  4YT0 D;  2ZAE B;  1SQQ J;  3QH9 A;  3L73 G;  3P8M C;  2Q9I A;  1SQV G;  3L75 E;  2POH A;  2K3R A;  5KJ7 C;  2K9Y A;  1NTK J;  5CCG A;  3L72 J;  2KK7 A;  2KIK A;  1T2K C;  2FXP A;  1Y9B A;  1KN7 A;  1JCC A;  2OTJ P;  2WPR A;  1HGZ A;  5H2F E;  4OH8 B;  2JR8 A;  3ABV D;  4ZMD A;  1JTH B;  3I5C A;  1DEE G;  1YI2 P;  2W27 A;  1KIL E;  3CXH H;  1S9K E;  4WBA A;  2E75 D;  1M56 D;  2WU5 C;  1L0V D;  1HJ0 A;  1OVV A;  1EDI A;  1KFY D;  4PV1 B;  2QJP B;  4N3Y B;  1S9K D;  3JC2 2;  3CX5 D;  4WY4 A;  4A7P A;  4Y99 C;  1SQX D;  1KQF B;  4TLF A;  1KB9 E;  1T6A A;  1OMI A;  2OQQ A;  4NPE A;  4XA4 A;  2QG4 A;  4YTP C;  3AE1 C;  1BE3 E;  1EZV E;  3GHG B;  2M3E A;  2KZI A;  4XE5 B;  3V2Q A;  3EFG A;  4W7Z A;  5APV A;  5AVQ B;  3A7O A;  3AE6 C;  1YTZ T;  3CWB E;  1OWA A;  3ITK A;  1H0T B;  4BRY B;  5APY A;  4I7Z B;  5CBO A;  1G1I A;  2WMM A;  3OW2 O;  5TIS H;  2C0W A;  1RE3 C;  4C7N A;  4N78 E;  2K88 A;  2QJK B;  1M57 D;  4EOT A;  2VRS A;  4WWI A;  1SQX K;  1KB9 H;  4N78 D;  2XNX A;  3AE4 C;  1IO4 A;  2ZFY A;  2IFN A;  5AVX B;  1NTM D;  1GK6 A;  2H43 A;  2KP8 A;  2WS3 C;  4Z1M H;  1SQQ G;  4NPF X;  1K04 A;  3NXS A;  1FS0 E;  5DJT B;  3H32 B;  1OVU A;  4LC1 A;  2N9Y B;  1EQ7 A;  3SSU A;  3H1L G;  4YT0 C;  1M7L A;  2FY8 A;  2CPB A;  1JMM A;  1KC8 Q;  5B66 H;  2FYU E;  2Z5I A;  2E76 C;  3KYQ A;  1QGK B;  2OYI A;  1NAY A;  4M3L A;  3TDK A;  1XTC C;  5AW1 B;  3G4S P;  4BXL A;  1AJY A;  4KHX A;  2BCC E;  2FYU J;  5CJ0 A;  1SQX G;  2KLV A;  1L0L E;  1RE3 A;  5CCH A;  1NEN D;  1QLB C;  1KIL D;  5AW8 B;  1GMJ A;  1N7S B;  3CCV P;  1P84 I;  5KJ7 A;  3H25 A;  1UII A;  3BVH A;  3MGN A;  2YXQ B;  1BDC A;  4H13 C;  1VQ5 P;  1MFZ A;  4EYY Q;  3USS A;  2HPC B;  3AEF C;  2W6J H;  4IFF A;  2K37 A;  1NTZ D;  4IL6 E;  4U3F D;  1USD A;  4HB1 A;  1KYO H;  1N73 C;  2A06 G;  3S4R A;  1MZ9 A;  1VDF A;  2FYU D;  2QSI A;  1QL2 A;  1L4A B;  1EC5 A;  3SWF A;  3GLM A;  1M1J A;  4QMA A;  2WIT A;  3L74 G;  4U3F G;  4H44 C;  2O01 H;  1HBW A;  5C2T D;  1NOH A;  4U3F J;  3R2P A;  3CWB G;  3M0A A;  4OGQ D;  5CCG C;  2WVR A;  1KIL C;  2WPV B;  3WUT A;  1PPJ G;  4H13 B;  1N2D C;  3U59 A;  1GL2 B;  1R8E A;  2JKV A;  1M1K Q;  2YXR B;  3CL3 D;  1VQ9 P;  2HFE D;  1J2J B;  1NEN C;  4IL6 X;  4LDT A;  1GTW A;  2O3J A;  1GU4 A;  1NVO A;  3O6Q B;  2PP6 A;  2KSE A;  3L4F A;  2ZFC A;  3NMD A;  1P84 E;  3AE6 D;  2KLU A;  1X9V A;  1HUC A;  1P84 D;  2KOG A;  1SQX J;  1LP1 A;  1N8R Q;  3H1K G;  1NU1 G;  1JTH A;  1NU1 D;  1WMK A;  4RO0 A;  3H6P A;  3AEA D;  1W2B O;  3A5T A;  1Q86 Q;  5C3J C;  1EDL A;  1H89 A;  2WU5 D;  1URQ B;  3TYY A;  4DT0 A;  3LW5 J;  1RF1 C;  1NAF A;  3P8C E;  2J58 A;  1KIL B;  1NTZ E;  4JYB A;  3H1J G;  1FDM A;  2V7Q H;  1AVY A;  1YIJ P;  3JSV C;  3CCM P;  1JY2 O;  2QA4 P;  3RK3 C;  2XKM A;  1KMI Z;  5APQ A;  3TNU A;  2WSE H;  2R3S A;  3GW6 A;  1L4A C;  2BEZ F;  1PPJ D;  1LTT C;  3BCC E;  3M06 A;  1SQP E;  3FXD A;  4TT3 H;  2OAR A;  3ZDM A;  5AW5 B;  3L70 J;  3HE4 A;  2FXO A;  2FFD B;  3H1J D;  3P4S D;  2FBW D;  1QLE D;  2ITA A;  3SWY A;  1ZP0 C;  2Z5H A;  3L72 D;  4L73 A;  2N1T D;  3H1L J;  2QE7 H;  1YJN P;  2ZYD A;  2I1K A;  1W5C E;  2OYI C;  2E43 A;  4CPG A;  3OA7 A;  2B87 A;  1RHZ B;  4RES B;  3L75 J;  2GUS A;  3AE7 C;  1A02 F;  1OW7 A;  5KAF H;  1VF5 B;  1FU1 A;  1S1C X;  3P4Q C;  4YSZ D;  2WPQ A;  2L91 A;  4R4M A;  3V6I A;  3M0D C;  2LXB A;  2DW3 A;  3L71 G;  4W7Y A;  3WUU A;  5E79 H;  1N7L A;  4LLH A;  4PD4 I;  2QJP C;  1X8Y A;  2WP9 C;  3AEA C;  1NTM K;  3GHG A;  1GL2 D;  1FZG A;  3G71 P;  1CSB A;  1KB9 D;  1NKN A;  4JPZ B;  3CWB D;  3N7N A;  3P4S C;  1FZC C;  2KUB A;  1DEB A;  1SP4 A;  2BEQ D;  3V2P A;  4PD4 H;  3RL0 D;  1L0N D;  1PGQ A;  2OTK E;  2H7H A;  3RK2 C;  3B5N B;  3EFF K;  2P67 A;  3L70 G;  1IFD A;  3KQG A;  2IZ1 A;  1FJP A;  3JCU E;  2LXC B;  2FYN B;  3FWL A;  1E79 H;  5B66 E;  1JY2 N;  2O01 J;  2RH0 A;  2D2C C;  4AQR D;  3I56 P;  2FFD A;  1PV3 A;  4AUW A;  3FX0 A;  3AE8 C;  5AVZ B;  2WT7 B;  1BGY J;  4WY4 C;  2ACZ C;  3CX5 H;  1IFI A;  1NTM E;  1HWT C;  4H44 D;  1BGY G;  2GA1 A;  2W90 A;  2P10 A;  3EQ2 A;  1NH4 A;  3D70 A;  2PRR A;  2YKQ A;  1G2C A;  1NHL A;  2ZYG A;  4YPC A;  1LT9 B;  1LTJ C;  2OYH C;  1ZR2 A;  2B88 A;  5APT A;  1NTK K;  1OIP A;  2BCC D;  2Y0D A;  3IAO A;  1QVG O;  2M0B A;  2I1J A;  5CJ4 A;  4PV1 D;  2OYO A;  3H1K J;  1YQ3 D;  2N1T A;  4DHJ A;  1VQ8 P;  1EZV G;  1UIX A;  2IBZ I;  1NU1 J;  4H13 D;  1S4X A;  1X22 A;  5APS A;  1KQG B;  1S2E A;  3AEF D;  3WMM 0;  3LID A;  1T8Z A;  1EXJ A;  2Q5U A;  1FZB A;  1YQ4 C;  1LTJ B;  2YKO A;  3Q5P A;  2OYH B;  1SQP G;  3TGU E;  2K1A A;  3BCC J;  2ZT9 D;  1VF5 D;  1SQP J;  4DHZ A;  4ASV A;  3AE9 D;  1DD4 A;  1L0L K;  2CPS A;  2WT7 A;  1YTZ I;  2M5A B;  4WVZ A;  3KPE A;  3HUS A;  2IBZ D;  2XV5 A;  2ZXE B;  3AEE C;  2OYI B;  3G3Z A;  3L73 D;  2QJY B;  2FXM A;  1GL2 C;  3L72 E;  2WU2 D;  2NRG A;  3M9Q A;  3VMZ A;  3TGU G;  1LTA C;  1KQL A;  3A3Y B;  2YNY A;  3HD7 D;  3HE5 B;  2WDQ D;  2FYU K;  4L75 A;  3CCL P;  5AVR B;  2WQY D;  2Y9Y A;  3O6Q A;  4KX6 C;  2A45 G;  4PD4 D;  2G8Y A;  1YJ9 P;  3AE5 C;  3PH0 A;  3H1I G;  5TIS E;  1SQB J;  2WSC J;  4UB6 H;  4I6M C;  3AE4 D;  2YIU C;  5APW A;  2WDV D;  3L74 E;  1SQB G;  3C9I A;  4YSZ C;  5L8R J;  5CBN A;  1SQX E;  3P32 A;  3GF3 A;  4IL6 H;  1IJD B;  3WU2 H;  1ZRT E;  1HGV A;  1PP9 J;  3L75 G;  1AFO A;  4HYT B;  1LTI C;  1QVF O;  4IFD K;  2XND H;  4C7R A;  1EDJ A;  2H8P D;  4DDG A;  1QL1 A;  2V4H A;  4C7N B;  1VQ4 P;  4JYC A;  1FOS E;  2WDR D;  1NJI Q;  1R5L A;  3W68 A;  4O9B A;  2FYZ A;  3L71 D;  2O1J A;  3SFD C;  3HE5 A;  3G9R A;  2LR2 A;  3C8V A;  4KT0 J;  2WZ7 A;  1LTJ A;  2OYH A;  1LT9 C;  3HTK A;  2E76 B;  3QWO C;  4UB8 E;  1KFY C;  3RGU A;  2IDB A;  3U1C A;  3BAT A;  1AQ5 A;  2HR3 A;  3PTZ A;  2RKL A;  3D6Z A;  4DCK A;  1MKM A;  3IF4 A;  4WY4 B;  5KAI E;  3AEB D;  2YIU B;  1Q82 Q;  3ABV C;  5KLV D;  1N7S A;  2H88 C;  2JWD A;  2NPS B;  4I2L C;  4D6T D;  3MD0 A;  1ZLL A;  4KX6 D;  2KNC A;  1HH0 A;  5APU A;  3VMA A;  1P84 H;  3VRB C;  3B5N D;  1IC2 A;  2HG5 D;  2HOD A;  3AE5 D;  3MUD A;  3SFD D;  2SPZ A;  3R4Y A;  1AV1 A;  1KD1 Q;  4LGD E;  4UB8 H;  1S3J A;  3U1A A;  5AVW B;  3N4X A;  2K9J B;  1NTK G;  1GW3 A;  2M8R A;  3F5H A;  1S5L E;  5KAI H;  1LJ2 A;  3P4R D;  2FKW B;  2W6A A;  1NEK C;  1YJW P;  1CI6 B;  2R5B A;  1SQQ K;  3V4W A;  3Q3D A;  4I6L A;  3RK2 B;  4NPD A;  3CX5 E;  1YQ4 D;  3B5N A;  1IFP A;  1USE A;  4ZNC A;  3CCJ P;  1PP9 D;  2E74 B;  5M1B A;  4W80 A;  1N7S D;  2KS1 B;  1URQ D;  2WQY C;  2Q3I A;  2RN0 A;  1VQL P;  2QM7 A;  3VP9 A;  4L74 A; 
#chains in the Genus database with same CATH homology
 4R4M A;  4U7J A;  3AE4 C;  2P10 A;  2K9Y A;  4YSY D;  3D70 A;  2WQY D;  3GMA A;  3AE2 D;  2H88 C;  2WU5 D;  3SFE D;  4H0L B;  3LW5 J;  3O6Q A;  3AE8 D;  4OGQ C;  4KX6 C;  1U57 A;  2FXP A;  1Y9B A;  4RKU J;  2G8Y A;  3SFE C;  4KX6 D;  2WP9 D;  2QSI A;  2V7Q J;  3AE5 C;  2NZ2 A;  2WSC J;  4GDO A;  2D2C D;  1ZOY D;  2WS3 C;  5C3J D;  3AE2 C;  2WDQ C;  1S5L X;  3IAO A;  3GLM A;  2QJP C;  2YIU C;  2QJK C;  1K04 A;  4Z1M H;  3Q1M A;  2WDV C;  2E74 D;  3ABV D;  2WDV D;  3VRB C;  3EWK A;  4YSZ C;  5L8R J;  2BS3 C;  1NGM B;  3GF3 A;  4H44 C;  4R4L A;  3AE5 D;  1KOR A;  1PIX A;  4PV1 D;  1ZME C;  1KMI Z;  3VRA C;  1KIL E;  1YQ3 D;  2J5U A;  4YT0 C;  5C2T D;  2WSF J;  1ZRT E;  3AEA C;  2WP9 C;  3SFD D;  3CIR D;  3GF7 A;  4OGQ D;  1UIX A;  3AE4 D;  3VR9 D;  2E75 D;  3R4Y A;  2H88 D;  2WU5 C;  1L0V D;  2B76 D;  2WPV B;  2WU2 C;  3AE3 D;  2BEZ F;  2QIW A;  2ZT9 B;  1HJ0 A;  3D71 A;  1KFY D;  4YXD D;  4PV1 B;  2D2C B;  2E76 C;  3AE7 D;  1OW8 A;  4H13 B;  4H13 D;  3IN6 A;  1TU3 F;  2H89 C;  2FYN C;  2JO1 A;  1R8E A;  1KF6 C;  2WDR C;  1IK7 A;  1KQG B;  3AEF D;  4TT3 H;  3P4S C;  1DD3 A;  5KLI C;  2ACZ D;  3P4Q D;  3AEC C;  4H0L D;  3Q5S A;  2BEQ D;  1KQF B;  1EXJ A;  2G3A A;  3P4R D;  4H0L C;  1AJY A;  1YQ4 C;  4YTN C;  4YSX D;  4YTM C;  3S9O A;  1OMI A;  3Q5P A;  1NEK C;  3AE9 D;  1OW6 A;  1VL2 A;  1NEN C;  4IL6 X;  3RL0 g;  3P4S D;  4XFJ A;  2FBW D;  3AE1 D;  3AEG D;  1RQV A;  3P4P C;  1KF6 D;  2WDR D;  1ZP0 C;  2OQQ A;  1FDO A;  2ZT9 D;  1VF5 D;  1DIP A;  4I7Z C;  4YTP C;  2YMK A;  2E75 B;  3VR8 D;  3AEG C;  3AE1 C;  1FDI A;  3AED C;  1DD4 A;  1Q90 D;  2JP3 A;  2ZT9 C;  3Q3D A;  1HF9 A;  1L0V C;  1NEN D;  1QLB C;  1ZP0 D;  2B76 C;  3AEE D;  2FBW C;  1GMJ A;  4YSX C;  1K05 A;  3AE6 D;  3Q2Y A;  4OGQ B;  1NEK D;  3CIR C;  3AEC D;  1YQ4 D;  4YTN D;  3SFD C;  4YTM D;  3FGA D;  3AE6 C;  3G9R A;  4PV1 C;  3H25 A;  3AEE C;  3C8V A;  1E7P C;  3D6Y A;  3AE9 C;  1RQU A;  4KT0 J;  2BS4 C;  3AED D;  2E74 C;  2WSE J;  2QJY C;  2BS2 C;  4YXD C;  3VRB D;  3VR8 C;  2O01 J;  2E74 B;  4I7Z B;  4YTP D;  4H13 C;  5C3J C;  1ZOY C;  1VF5 C;  2D2C C;  2E76 B;  2E76 D;  3AE7 C;  3Q5R A;  1OW7 A;  4H44 B;  4Y28 J;  1KFY C;  3P4P D;  2IDB A;  1KTM A;  1VF5 B;  3T97 B;  2WU2 D;  1PV3 A;  5M1B A;  3AE3 C;  2WDQ D;  2E75 C;  3VR9 C;  1PL5 A;  3P4R C;  3AE8 C;  3VRA D;  1S1C X;  1WMK A;  2MKV A;  3P4Q C;  3D6Z A;  3AEA D;  3RK3 E;  2ACZ C;  2WQY C;  1YQ3 C;  4YT0 D;  4YSY C;  1MKM A;  4YSZ D;  5C2T C;  3B71 A;  3AEF C;  4H44 D;  1JB0 J;  3AEB D;  2H89 D;  5KKZ C;  1EXI A;  1NYH A;  2WS3 D;  3AEB C;  3ABV C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...