1ZOYC

Crystal structure of mitochondrial respiratory complex ii from porcine heart at 2.4 angstroms
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Mitochondrial Respiratory Membrane Protein Complex II
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords FAD-binding protein
total genus 50
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2005-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1zoyC01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 1zoyC02
1YQ3D 4YXDC 3AE5C 4YSXC 1ZP0D 4YXDD 1YQ4D 3AE1D 4YTND 1OW8A 2WQYC 1NEKD 2B76D 3AE2D 3VRBC 3AEGD 4YT0C 1KF6D 5C2TD 3AEEC 1ZOYC 3AECC 3SFDD 2WDRD 3AEGC 3AE1C 4YTNC 3AE6D 1PV3A 3VR8D 3SFED 2H88D 3S9OA 2WDRC 2G3AA 2WDVC 3VRAC 4YSXD 1ZP0C 2FBWD 2BS3C 2WU5D 2H89C 2WDQC 3AE8D 4YTMD 3AE3C 3AE9C 1E7PC 3AEBD 2H89D 3AE8C 2WDQD 1OW6A 4YSZD 3ABVD 5C3JC 4YTPD 2WS3D 3AEDD 1KFYD 1K05A 3AE6C 3CIRC 3SFEC 3VR8C 3P4RD 3AECD 3AEFC 2WP9D 1L0VC 3VRBD 4YT0D 3P4RC 3AEBC 4YTMC 2WU2D 4YSYC 3P4QC 5C3JD 3P4SD 3B71A 3P4SC 3AE5D 2WDVD 2BS2C 3P4QD 3VRAD 2H88C 3AE4D 2WU2C 4YSYD 3AE9D 1NEND 4KX6C 1K04A 3AE4C 2WU5C 2WP9C 1L0VD 2FBWC 3AEFD 1QLBC 1OW7A 2ACZC 3AEAC 3AE7D 3VR9D 3AE2C 2B76C 2WQYD 1YQ4C 1KFYC 3AE7C 3CIRD 1ZOYD 3VR9C 3SFDC 2WS3C 4YTPC 2ACZD 3AEDC 3AEAD 5C2TC 3AEED 3ABVC 1KF6C 1YQ3C 4YSZC 2BS4C 1NENC 3P4PC 1NEKC 3P4PD 4KX6D 3AE3D 1KTMA
chains in the Genus database with same CATH superfamily
1FS0E 3RBZA 5AW5B 1NTMD 4OWFA 4JPZB 4EYYQ 4YXDD 5KLVJ 2PGDA 3MZWB 2E74D 1NU1D 4YT0C 3M9BA 3H1IE 4WY4D 3L36A 2I1JA 3AEEC 2E76B 4DT0A 4L75A 3H1KE 3H1KG 2WVRA 3F5HA 4N3YB 5CJ0A 2H7HA 3TNUB 4K3AA 4JQ0D 3TDKA 3HD7A 4YSZD 3D6YA 1SQQG 2B88A 1EDKA 3RK3C 2XDJA 5APUA 3HD7B 1M7LA 3SWFA 4ASWA 3L75J 5APWA 2YO2A 4ZKUA 3FGAD 2QG4A 3CPWO 1H89A 1CI6A 1NTZK 3CCVP 1N7LA 3FXEA 4EIJA 5KAIE 2WSCJ 5AVSB 1SQPG 2N1TC 5B5EH 1NWQA 1BE3D 3P4SD 4XA4A 2FFDC 1BE3J 3L74D 3GF3A 2Q9IA 3A2AA 1SS1A 3GMAA 2PAJA 1S9KD 3HE5B 4TLFA 5KLVK 3MGNA 5E79H 2HODB 1YIJP 2IFMA 1NU1E 1GK6A 3SFDC 2ACZD 3A7OA 3AEED 4DHZA 3ABVC 3MUDC 1FZGA 1KF6C 2YMKA 4H0LC 2HPCA 3H6PA 1IFNA 2J59M 2N9BA 5L8RJ 3B5NC 1YJNP 3P4PD 2R5DA 2YMYA 1LT1A 4IOIH 2W27A 5KLVD 1YQ3D 2JKVA 4YSXC 5BVZA 3M0AA 1VQPP 4K35A 4WY4A 2KXPB 2WQYC 1PPJE 1IJDB 2OYHA 1FZCA 4HH2A 2JP3A 4TT3H 3M0DA 2ZYAA 2O1KA 4C46A 1ZOYC 3RL0D 3AEGC 1JEKA 4IFMA 5B66H 3PJSK 1ZRTD 2NPSC 2OYHC 1EXJA 1DD3A 2ZJSE 2WDQC 1HVVA 1NO4A 2KNCB 5AVRB 3RGUA 3H1HG 2BASA 3D70A 1L0ND 2JO1A 1KILB 2YKOA 3RK2C 4OGQC 3CXHH 3A0BE 3B5NB 1LT9B 2M0BA 2WP9D 1OMIA 2PRRA 1PZQA 2GM4A 2WPVB 4YSYC 1KYOE 1SFCA 5CCHC 1G1JA 1KORA 3P4QD 2O1JA 2Y0DA 1JB0J 3AE4C 1OX3A 3PP5A 2KP8A 1WT6A 1SQXE 2P1JA 2CPSA 1VF5D 2LKMA 4OGQD 3RBXA 2IFNA 1HGVA 3L74E 2GUVA 1NHLA 2ZVOB 1GW3A 1OFCX 4H0LB 5BU8B 3HD7C 2WSCH 3S1KA 1DX7A 2GUSA 1S3JA 3PTZA 1N86A 1KILE 2A45I 5KAIH 1LJ2A 2LR2A 4GKGA 3Q5PA 5KKZB 1PPJD 5DJUB 4ZNCA 1ZR2A 1VDFA 3VMXA 3CD6P 1NTZJ 1BDCA 4GOFA 4BWNA 3O8ZA 3RK3B 3CCSP 3CX5I 1Y47A 3R2PA 3K5BA 4N78D 1SVFA 4XFJA 3P4SC 3VTPC 4GDOA 4PD4D 2ZFYA 4IL6X 1J1DC 1OWAA 1GK4A 1NAYA 2FBWC 2WPSA 3KPEA 2QVAA 2BEQD 2QJKB 3FWNA 2WQYD 4CPGA 3HUSA 1FDIA 1URQD 1JTHB 3L70E 1PP9J 1SFCB 2KOGA 2E74B 4YPCA 3H1HJ 2FYUG 1SQVG 4DHJA 2YXQB 1KN7A 3I5CA 1LT9A 1YQ4D 2W6AA 4GODA 2KLVA 1U7MA 1FJPA 1MV8A 2ZVNB 2HYNA 1SQVD 2NPSB 3HRNA 4DZOA 1VQMP 1X0TA 2H88D 2R5BA 4RESB 2QSIA 2IBZI 2FBWD 2KS1B 1LTAC 3BRVB 3L72E 3T97B 5GTHH 3V2PA 3KZIH 4UB8H 4W7ZA 3CC2P 3NFQA 4PD4E 3Q2YA 3AE6C 2OTLP 3CIRC 5GTIE 1KQFB 2JR8A 3TK1A 3RL0C 2D2CC 1D7MA 4WY4B 5B5EE 3C1LA 3P8CD 1VQ6P 3MD0A 1BGYJ 3R4YA 1QVFO 2HPCB 3L75E 3VRAD 2KIKA 2H88C 1JM0A 4DOJA 3H1LJ 5TJHA 1L4AC 1PGPA 2HODA 3A0BH 2N9YB 2BCCE 1SQXJ 1RF1A 1SQXD 1Q86Q 3CMEP 1YQ4C 1LTBC 4C7NA 2E75B 1BGYD 1Q2NA 4W7YA 1DH3A 3QH9A 3L73E 2FYUK 1NTKD 3Q1MA 1PGQA 1CI6B 3H1LD 5TISE 3L72D 1NU1K 2L91A 1KB9I 1SQVJ 3CCUP 4I6LA 2GA1A 1FAVA 2R32A 3JSVC 1K73Q 3VR8D 4YXWH 1RF0A 4NPFX 3V5BA 5GTIH 2M8RA 4WBAA 1N7SC 3V4WA 2BCCG 3LW5H 1QVGO 3L75D 1R5SA 2RN0A 3GHGB 2FYUJ 5AW3B 1BCCG 1W5CE 1X22A 5AVUB 1SQBE 4M3LA 5CCGD 1SQQJ 1NTKG 5CJ4A 3L4FA 3P4QC 3L74J 2WSEJ 1FDMA 2BS2C 1RE4A 2B87A 2QJYB 1USDA 2AXTH 1T8ZA 1IFIA 3GW6A 1LP1A 3AEFD 2K3RA 1OW7A 2K9YA 1T3UA 3VR9D 2CK3H 1RE4C 3PLNA 2K9JA 3AE7C 1UIXA 4QMAA 1RQUA 1RE3A 1NTKJ 2XNXA 2E75C 3CI9A 3EFFK 2YKQA 1NH4A 1VPCA 5KJ7A 1OVUA 1NEKD 1PPJG 1AQTA 1SQVK 3HE4B 3BVHA 1LTJC 1SQPE 2O3JA 2QJPB 1L4AB 2OTJP 2QJPC 3CCEP 3SFED 3S9OA 3P32A 3WUTA 3RK2D 2Y0CA 3RL0g 2KLUA 2WZ7A 1IFMA 1NGMB 2WSFJ 1AV1A 4H0LD 5C3JC 4WVZA 2D2CB 3RL0B 3G3ZA 1FOSE 1HJ0A 1Q82Q 4FJVA 1Q7YQ 5APQA 3CMAP 1GW4A 1FZEA 1L0NG 2YXRB 1LTGC 1S72P 3HE4A 3A0HE 1NYHA 1JY3O 1M1JC 3FX0A 3TSIA 1KQLA 3L70J 3AE9D 1RY3A 1LTJB 1LWUC 2K9JB 3CX5D 1DD4A 3CX5E 2SPZA 4O9BA 3D6ZA 1L0LD 4LLHA 1GU4A 1SQPJ 4RJTA 2AEFA 2WS3C 1LWUA 5E79E 1QLED 4LDTA 3GHGC 1LP1B 5APYA 3C9IA 2QEXP 1L2PA 5CMZA 1NU1G 5AW6B 2B87B 1VF5B 1EZVD 2ZT9C 1H8AA 3GHGA 4RKUJ 5C2TD 2Q3IA 3AECC 1S1CX 3VYIA 1J1DB 2VRSA 3CCLP 1P84D 1G2CB 3VRAC 2A45H 3N7NA 1JY3N 3H1IG 1KMIZ 1M90Q 4YTMD 4R4MA 1FZBA 1NTZD 4H13B 1NJIQ 2RMZA 4IL6H 5CCHD 2ZAEB 5EFWB 2Z5IA 3C8VA 1X8YA 1VQ7P 5AW7B 2E43A 1SQBD 3II6A 2WT7B 3S4RA 3CC4P 1SQBJ 1HBWA 3H1HE 3IFMA 3L35A 5KKZC 3GF7A 2QM7A 3PH0A 3V6IA 1GL2C 2NPSD 3L71D 5AW9B 1JY2P 3FXDA 3IN6A 5AW4B 2HFED 1EDJA 3M9HA 4DHIB 1NTME 2IYPA 2WSFH 4C7NB 1JO5A 4Z1MH 1M57D 1YITP 3WUUA 2YKPA 1GMJA 3P4PC 3G6EP 2H43A 4KJMA 1RF1B 4WB4A 4EOTA 1JY2O 1TFFA 1X9VA 4JBZA 3U1AA 4ASVA 3W68A 3AE1D 2O01N 1OW8A 2ZFCA 1SQQK 1NTZE 3H32B 1LTSC 1NTZG 1W2BO 1JOCA 3TYYA 3M91A 1L0LK 4YTNC 1PV3A 5GTHE 2OYIA 1T2KC 1ZP0C 3VMZA 2WPRA 1M1JA 5AVXB 2WDQD 4KT0J 1BE3E 5AW8B 5KLIB 1M56D 3T97A 1K05A 1NTMJ 3FWLA 3VR8C 1SFCD 2KS1A 3KXDA 2V4HA 3BRTB 4BXLA 1L0VC 3U1CA 3G4SP 1GZLA 4IFFA 2W90A 2NPSA 1T6AA 3B71A 2OYOA 4PV1C 1JTHA 1S5LX 2QA4P 5KTBA 2FY8A 1EC5A 4UB8E 5AVTB 2FXOA 3OAKA 1W2EA 3I56P 2Q5UA 3L73J 2K37A 3AE7D 2WWWA 3AE2C 2N1TD 2ZXEB 1GU5A 1YBKA 3H1KJ 2G8YA 1IFDA 3I55P 2JJLA 5AVQB 5CBOA 1ZV8A 2NZ2A 1NAFA 1MFZA 4BRYA 3VONA 1ZRTE 2OTKE 1N2DC 1NKZB 1ZP0D 2XNDH 1KQSO 2Z4EA 3HTKA 4WWIA 3L74G 1EZVE 3IAOA 3MIWA 3AEGD 4HB1A 1KF6D 3H1ID 4R4LA 3CL3D 2DW3A 3H1KD 4I2LC 3O6QA 1X79B 2G3AA 3L37A 4H44C 3OW2O 2A06G 2R3CA 2E76D 2H89C 1R5LA 4JYCA 3TGUG 1E7PC 4KHXA 2PP6A 3AEDD 1OIPA 2UWJE 2XKMA 3PRJA 3H1IJ 3AECD 2OQQA 1FC2C 4C7RA 1SQBG 3NTNA 1EXIA 2YNYA 4YT0D 1KV4A 5APSA 1KC8Q 4D6TJ 3BATA 3WU2E 1GDTA 4D6TD 4D6TE 1A02J 3AE5D 1GL2D 5CBNA 3LIEA 2AXCA 3HTKB 3L71G 3Q5SA 1K9MQ 2ZXXA 1NEND 4IL6E 1VQOP 2E76C 2WP9C 2N1TA 1S9KE 1KYOI 2J58A 4BRYB 3H1JE 1MZ9A 2CPBA 1E79H 3CIRD 3KDPB 3AEAD 2OYIC 4HJGH 4WY4C 1HTLC 1PFIA 4LC1A 1FZCC 3AE3D 1VQNP 2E5TA 2MJZA 3M0DC 1KTMA 4EDFA 1JUNA 2FYUD 5K5GB 3EFGA 1N7SD 1AVOA 3VRBC 1E5WA 3OA7A 4RO0A 1KYOH 1S2EA 3JCUE 1S5LE 1SQVE 3P8MC 1FU1A 1KILA 4A7PA 1RH5B 2P67A 2C9LY 3CXHI 2Y9YA 1USEA 1WRGA 2WU5D 4DDGA 4ZKPA 3AE8C 4U7JA 3G71P 3ABVD 1FE6A 1LT9C 3E7KA 2C0WA 2E75D 2H8PD 3B5ND 1FZCB 1IZNB 3TF5A 3SWYA 1JY2N 3CWBG 3CC7P 4NPEA 2OYIB 1G1IA 3BCCJ 5APVA 1WMKA 2XU6A 2I8DA 1ZN5A 1IO4A 1QX8A 3L70D 1K8AQ 2OYHB 3L70G 1DIPA 2KUBA 2Q1KA 2WU5C 1VQ8P 3H25A 4ZMDA 3MTUE 2FYUE 5CCHA 1CZQA 1AQ5A 3KZIE 3HE5A 1N73B 2M3EA 2M3BA 3N4XA 2JWDA 1ZLLA 1YJWP 3B8EB 3BCCG 4OH8B 2P2UA 4UB6E 1OVRA 3AE5C 3NXSA 3SWKA 2IZ1A 2C9NY 3KYQA 2P58A 1VL2A 3CWBE 1KILD 1L0NE 1CSBA 1IC2A 1L0NK 3B4SA 1JCDA 4H44B 5KLVG 2WDRC 5KLVE 2W6BA 3TNUA 2FFDB 2BS3C 3GG2A 1LNQA 2FFDA 3AE3C 2E5YA 1PP9E 3CX5H 1PP9D 5CCGA 3CCRP 2KZJA 2D2CD 4YTPD 3L75G 2ITAA 1FOSF 1CW5A 1EQ7A 3G9RA 1ZW0A 3BCCD 1G2CA 5CCGC 3A0HH 3BCCE 3LW5J 2ZT9D 2IYOA 1RF0C 3V4QA 5APTA 1N73C 1SQXK 1QL2A 2WITA 4PV1D 2KK7A 4NPDA 1SQBK 1JMBA 4YSYD 2M5AB 4KX6C 1K04A 3NMDA 1N73A 1NTKE 1QLBC 1DEBA 1KZUB 2KYVA 1T2KD 3PHLA 3D71A 1BDDA 5AW2B 3BASA 4B86A 3VR9C 1IK7A 1HJBA 4HYTB 1PGJA 2W8ZA 1FDOA 2KB7P 3JCUH 3HUSC 4OGQB 4YXDC 1H0TA 2IPPA 4PJ0E 4Y28J 1VQ9P 2FXPA 5M1BA 3CLQA 1P84H 1URQA 1SQQE 1AJYA 1BGYE 3SFDD 1VQ5P 4DCKA 2JEEA 1EZVI 5AVVB 1AFOA 1KD1Q 3U59A 1J2JB 1BE3G 4HKZH 1SLQA 4GIFA 3L72J 2WTYA 4GT1A 4U3FJ 4GOEA 5H2FH 1L4AA 3P8CE 3AEBC 2QRXA 3OJAB 2WU2D 4XE5B 1BSHA 1YYCA 3L71J 4L74A 1T3JA 2WDVD 3AE4D 1HUCA 1YI2P 1KB9E 1KB9D 1LGHB 3CXHE 1BGYG 2JWAA 2N1TB 1KFYC 2XV5A 1HWTC 1AA0A 1IFPA 2FXMA 2A45G 1RF1C 2WSSH 2KSJA 1NENC 1S4XA 2IBZG 1NTMG 1PIXA 3V2RA 1FZAA 3H1LE 2ZYGA 2MKVA 2J5UA 3CWBD 2QM8A 1J1EC 3ZDMA 1PL5A 1HH0A 1UIIA 3QWOC 1A02F 3AE6D 2QJYC 3JC22 2WMMA 4UB6H 1H88A 1PGOA 4YSXD 1GL2B 4DDIA 3AE8D 3AE9C 2LXBA 3AEBD 3O6QB 4I1LA 2FYZA 2IX7C 5KAFH 2O01J 1L0NJ 1NU1J 4H44D 1BCCD 2Q3EA 3CWBJ 3SFEC 5AVZB 1N7SA 2POHA 2XZRA 3IR9A 2BCCD 3CXHD 4H13C 4JF7A 2R3SA 2IBZE 1QL1A 3KHUA 4N78E 3H1LG 5C3JD 3CCJP 3SSUA 2NRGA 1XTGB 2YIUC 1EZVG 2WU2C 4Y99B 2QE7H 5KJ7D 1OXZA 3L73D 4PV1B 1AVYA 1RE3C 4L76A 1URQC 1VF5C 2V7QJ 2ZT9B 2E42A 2A06E 3AEDC 4I7ZB 2W6JH 3P7KA 1HGZA 5CHXA 2BS4C 3VP9A 1NEKC 1VQKP 2WSEH 1P84E 3A5TA 5KLIC 1NTMK 1S5LH 2HG5D 2ZYDA 2PFXA 1SQQD 5KAFE 5AW0B 5KJ7C 2WDRD 2YO3A 1EDLA 1FJKA 1Y9BA 1IK9A 4EI2A 1SQXG 3MP7B 1L0LJ 1M1JB 3EQ2A 1BSNA 5AW1B 1MFTA 2WPQA 1BCCJ 1ZR4A 2WS3D 3H32A 1JCCA 3F89A 2OARA 2BCCJ 3P4RD 3MHVA 2LXCB 2QIWA 3VRBD 1NKNA 4N6JA 2OGUA 4YTMC 2HLOA 2B89A 2Y9ZA 1BCCE 4MN4C 4W80A 2YIUB 1JMMA 4PD4H 1MKMA 5BU5A 1L0LE 2KI7B 1Q90D 1KQGB 1VQ4P 4D6TG 1RQVA 2O01H 3RK3E 1YTZI 3L71E 1NOHA 3HUSB 4KX6D 2Q7CA 3WUVA 3WU2H 5APXA 1RHZB 4AUWA 1NTKK 1YTZT 2AEJA 4LGDE 5C39A 1R8EA 2WT7A 2Z5HA 3VMAA 1N7SB 2B76D 4JYBA 2FYNB 2QJKC 3E1IA 2AEMA 1KFMA 3TGUJ 1FBMA 5AVYB 1M8OB 3VP8A 4Y99C 2W83C 2WDVC 3VMYA 3IF4A 1J1EB 3USSA 2FYNC 1OVVA 3WMM0 2H89D 1ZMEC 1SQPD 1KFYD 1GL2A 2HR3A 3AEFC 4PJ0H 1JNMA 2IBZD 3P4RC 1SQPK 1YHQP 4AQRD 5H2FE 3RK3D 1LWUB 1MUUA 2K88A 1L0VD 4L73A 1LTTC 2BEZF 1IFJA 1SP4A 3CCQP 1KFNA 2IZ0A 1LTIC 3M9QA 3H1JD 1KB9H 1LTJA 2A06D 1ZOYD 2KZIA 4YTPC 1VQLP 2R44A 1HF9A 2P10A 1L4AD 1PP9G 2K1AA 3M06A 1YJ9P 3V2NA 3CCMP 3Q5RA 2Y0EA 2AXTE 3ITKA 2B9BA 4YTND 3AE2D 3TGUD 3TGUE 4H13D 4DJGA 1XTCC 2C0XA 2P7JA 3AE1C 3LIDA 3MUDA 2RH0A 1Z56A 5AVWB 3L72G 3B5NA 3H1HD 2FKWB 2RKLA 3A3YB 2V7QH 1OW6A 1QGKB 1EDIA 3V2QA 3HD7D 2JDIH 2KNCA 1OZHA 1U7JA 2IDBA 1GD2E 4I6MC 3RK2B 4U3FD 4U3FE 1P84I 1QEXA 1GTWA 3W67A 4U3FG 1KILC 4I7ZC 1NVOA 2L5GB 1H0TB 3E1RA 1U57A 1DEEG 5DJTB 1Q81Q 1URQB 3H1JG 1N8RQ 2KSEA 1Y8AA 1KYOD 4OVNF 3UIAA 4IFDK 5TISH 3VN0A 3KQGA 1M1KQ 1ZXGA 2Q6QA 3H1JJ 2ACZC 3AEAC 3VOPA 2B76C 3GLMA 2M5AA 4PD4I 5C2TC 1TU3F 2I1KA 1JY3P 3EWKA 4AYCA 1YQ3C 3Q3DA 4YSZC 2E74C 1FZFA 1SFCC 3L73G 1L0LG 5B66E
chains in the Genus database with same CATH topology
4H0LB 5KLIC 1YQ3D 1PIXA 4YXDC 1ZRTE 3AE5C 3Q1MA 3Q5RA 4YSXC 1ZP0D 4Y28J 4YXDD 1R8EA 1YQ4D 2MKVA 3AE1D 4YTND 2E74D 2WQYC 1OW8A 2FXPA 1VL2A 3IAOA 5M1BA 1VF5B 2J5UA 2ZT9C 2QJKC 1NEKD 3AE2D 3AEGD 4YT0C 3VRBC 2JP3A 4TT3H 4H13D 1KF6D 1KILE 4RKUJ 5C2TD 4R4LA 3AEEC 3VR9C 2E76B 4H44B 1PL5A 1ZOYC 3AECC 1S1CX 1AJYA 3SFDD 2WDRD 3AEGC 3O6QA 1Y9BA 3AE1C 4YTNC 2QJPC 1PV3A 2QJYC 3AE6D 3SFED 3VR8D 3S9OA 2H88D 2WDRC 2G3AA 4H44C 2WDVC 3VRAC 2QSIA 3RL0g 4YSXD 1ZP0C 2FBWD 2BS3C 1NGMB 1EXJA 1DD3A 2WU5D 2E76D 2H89C 1KMIZ 2FYNC 2WDQC 3AE8D 4YTMD 3AE3C 3Q5PA 4R4MA 3AE9C 3T97B 1E7PC 3AEBD 2WSFJ 2H89D 3AE8C 3D70A 2WDQD 1OW6A 4YSZD 1ZMEC 2JO1A 4H13B 4H0LD 4KT0J 4U7JA 3D6YA 3ABVD 2B76D 2D2CD 5C3JC 4YTPD 2D2CB 2O01J 2WS3D 3AEDD 3C8VA 4OGQC 4H44D 1KFYD 1K05A 2E75D 3AE6C 3Q2YA 2IDBA 3SFEC 3CIRC 1HJ0A 3VR8C 1KQFB 3P4RD 3G9RA 3FGAD 3AECD 2OQQA 2D2CC 3AEFC 2WP9D 3LW5J 4I7ZC 1L0VC 4H13C 1EXIA 2QIWA 1OMIA 2ZT9D 4YT0D 3P4RC 3VRBD 3AEBC 1U57A 2WSCJ 5KKZC 4YTMC 2WPVB 1NYHA 3GF7A 3R4YA 2WU2D 4YSYC 1WMKA 3P4QC 4XFJA 4PV1D 5C3JD 2WSEJ 3P4SD 3B71A 3P4SC 3AE5D 4GDOA 1KORA 2BS2C 2WDVD 3P4QD 3VRAD 4PV1C 2H88C 2YIUC 3AE4D 3GF3A 1DIPA 1S5LX 2WU2C 4YSYD 3AE9D 4IL6X 3Q5SA 1NEND 4KX6C 1JB0J 1K04A 3AE4C 3GMAA 3IN6A 4PV1B 2E76C 3H25A 2WU5C 2WP9C 1L0VD 2FBWC 1DD4A 2BEZF 1ZOYD 3AEFD 1MKMA 2K9YA 1OW7A 1QLBC 2ACZC 2BEQD 3AEAC 3D6ZA 3AE7D 3VR9D 1VF5C 2V7QJ 2ZT9B 3AE2C 2B76C 2WQYD 1Q90D 3D71A 1KQGB 1FDIA 1YQ4C 1KFYC 3AE7C 3CIRD 1UIXA 1VF5D 2G8YA 1IK7A 3GLMA 3SFDC 1RQVA 4YTPC 4OGQD 4Z1MH 3AEDC 4I7ZB 2ACZD 2WS3C 1TU3F 3AEAD 3AEED 3ABVC 3EWKA 5C2TC 3RK3E 1HF9A 1KF6C 1YQ3C 2YMKA 3Q3DA 4YSZC 2NZ2A 4H0LC 1RQUA 2E75B 1FDOA 1GMJA 2P10A 2E74C 5L8RJ 1NENC 1NEKC 2BS4C 3P4PD 3AE3D 3P4PC 4KX6D 2E74B 2E75C 1KTMA 4OGQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YQ3 D;  4YXD C;  3AE5 C;  4YSX C;  1ZP0 D;  4YXD D;  1YQ4 D;  3AE1 D;  4YTN D;  1OW8 A;  2WQY C;  1NEK D;  2B76 D;  3AE2 D;  3VRB C;  3AEG D;  4YT0 C;  1KF6 D;  5C2T D;  3AEE C;  1ZOY C;  3AEC C;  3SFD D;  2WDR D;  3AEG C;  3AE1 C;  4YTN C;  3AE6 D;  1PV3 A;  3VR8 D;  3SFE D;  2H88 D;  3S9O A;  2WDR C;  2G3A A;  2WDV C;  3VRA C;  4YSX D;  1ZP0 C;  2FBW D;  2BS3 C;  2WU5 D;  2H89 C;  2WDQ C;  3AE8 D;  4YTM D;  3AE3 C;  3AE9 C;  1E7P C;  3AEB D;  2H89 D;  3AE8 C;  2WDQ D;  1OW6 A;  4YSZ D;  3ABV D;  5C3J C;  4YTP D;  2WS3 D;  3AED D;  1KFY D;  1K05 A;  3AE6 C;  3CIR C;  3SFE C;  3VR8 C;  3P4R D;  3AEC D;  3AEF C;  2WP9 D;  1L0V C;  3VRB D;  4YT0 D;  3P4R C;  3AEB C;  4YTM C;  2WU2 D;  4YSY C;  3P4Q C;  5C3J D;  3P4S D;  3B71 A;  3P4S C;  3AE5 D;  2WDV D;  2BS2 C;  3P4Q D;  3VRA D;  2H88 C;  3AE4 D;  2WU2 C;  4YSY D;  3AE9 D;  1NEN D;  4KX6 C;  1K04 A;  3AE4 C;  2WU5 C;  2WP9 C;  1L0V D;  2FBW C;  3AEF D;  1QLB C;  1OW7 A;  2ACZ C;  3AEA C;  3AE7 D;  3VR9 D;  3AE2 C;  2B76 C;  2WQY D;  1YQ4 C;  1KFY C;  3AE7 C;  3CIR D;  1ZOY D;  3VR9 C;  3SFD C;  2WS3 C;  4YTP C;  2ACZ D;  3AED C;  3AEA D;  5C2T C;  3AEE D;  3ABV C;  1KF6 C;  1YQ3 C;  4YSZ C;  2BS4 C;  1NEN C;  3P4P C;  1NEK C;  3P4P D;  4KX6 D;  3AE3 D;  1KTM A; 
#chains in the Genus database with same CATH topology
 1FS0 E;  3RBZ A;  5AW5 B;  1NTM D;  4OWF A;  4JPZ B;  4EYY Q;  4YXD D;  5KLV J;  2PGD A;  3MZW B;  2E74 D;  1NU1 D;  4YT0 C;  3M9B A;  3H1I E;  4WY4 D;  3L36 A;  2I1J A;  3AEE C;  2E76 B;  4DT0 A;  4L75 A;  3H1K E;  3H1K G;  2WVR A;  3F5H A;  4N3Y B;  5CJ0 A;  2H7H A;  3TNU B;  4K3A A;  4JQ0 D;  3TDK A;  3HD7 A;  4YSZ D;  3D6Y A;  1SQQ G;  2B88 A;  1EDK A;  3RK3 C;  2XDJ A;  5APU A;  3HD7 B;  1M7L A;  3SWF A;  4ASW A;  3L75 J;  5APW A;  2YO2 A;  4ZKU A;  3FGA D;  2QG4 A;  3CPW O;  1H89 A;  1CI6 A;  1NTZ K;  3CCV P;  1N7L A;  3FXE A;  4EIJ A;  5KAI E;  2WSC J;  5AVS B;  1SQP G;  2N1T C;  5B5E H;  1NWQ A;  1BE3 D;  3P4S D;  4XA4 A;  2FFD C;  1BE3 J;  3L74 D;  3GF3 A;  2Q9I A;  3A2A A;  1SS1 A;  3GMA A;  2PAJ A;  1S9K D;  3HE5 B;  4TLF A;  5KLV K;  3MGN A;  5E79 H;  2HOD B;  1YIJ P;  2IFM A;  1NU1 E;  1GK6 A;  3SFD C;  2ACZ D;  3A7O A;  3AEE D;  4DHZ A;  3ABV C;  3MUD C;  1FZG A;  1KF6 C;  2YMK A;  4H0L C;  2HPC A;  3H6P A;  1IFN A;  2J59 M;  2N9B A;  5L8R J;  3B5N C;  1YJN P;  3P4P D;  2R5D A;  2YMY A;  1LT1 A;  4IOI H;  2W27 A;  5KLV D;  1YQ3 D;  2JKV A;  4YSX C;  5BVZ A;  3M0A A;  1VQP P;  4K35 A;  4WY4 A;  2KXP B;  2WQY C;  1PPJ E;  1IJD B;  2OYH A;  1FZC A;  4HH2 A;  2JP3 A;  4TT3 H;  3M0D A;  2ZYA A;  2O1K A;  4C46 A;  1ZOY C;  3RL0 D;  3AEG C;  1JEK A;  4IFM A;  5B66 H;  3PJS K;  1ZRT D;  2NPS C;  2OYH C;  1EXJ A;  1DD3 A;  2ZJS E;  2WDQ C;  1HVV A;  1NO4 A;  2KNC B;  5AVR B;  3RGU A;  3H1H G;  2BAS A;  3D70 A;  1L0N D;  2JO1 A;  1KIL B;  2YKO A;  3RK2 C;  4OGQ C;  3CXH H;  3A0B E;  3B5N B;  1LT9 B;  2M0B A;  2WP9 D;  1OMI A;  2PRR A;  1PZQ A;  2GM4 A;  2WPV B;  4YSY C;  1KYO E;  1SFC A;  5CCH C;  1G1J A;  1KOR A;  3P4Q D;  2O1J A;  2Y0D A;  1JB0 J;  3AE4 C;  1OX3 A;  3PP5 A;  2KP8 A;  1WT6 A;  1SQX E;  2P1J A;  2CPS A;  1VF5 D;  2LKM A;  4OGQ D;  3RBX A;  2IFN A;  1HGV A;  3L74 E;  2GUV A;  1NHL A;  2ZVO B;  1GW3 A;  1OFC X;  4H0L B;  5BU8 B;  3HD7 C;  2WSC H;  3S1K A;  1DX7 A;  2GUS A;  1S3J A;  3PTZ A;  1N86 A;  1KIL E;  2A45 I;  5KAI H;  1LJ2 A;  2LR2 A;  4GKG A;  3Q5P A;  5KKZ B;  1PPJ D;  5DJU B;  4ZNC A;  1ZR2 A;  1VDF A;  3VMX A;  3CD6 P;  1NTZ J;  1BDC A;  4GOF A;  4BWN A;  3O8Z A;  3RK3 B;  3CCS P;  3CX5 I;  1Y47 A;  3R2P A;  3K5B A;  4N78 D;  1SVF A;  4XFJ A;  3P4S C;  3VTP C;  4GDO A;  4PD4 D;  2ZFY A;  4IL6 X;  1J1D C;  1OWA A;  1GK4 A;  1NAY A;  2FBW C;  2WPS A;  3KPE A;  2QVA A;  2BEQ D;  2QJK B;  3FWN A;  2WQY D;  4CPG A;  3HUS A;  1FDI A;  1URQ D;  1JTH B;  3L70 E;  1PP9 J;  1SFC B;  2KOG A;  2E74 B;  4YPC A;  3H1H J;  2FYU G;  1SQV G;  4DHJ A;  2YXQ B;  1KN7 A;  3I5C A;  1LT9 A;  1YQ4 D;  2W6A A;  4GOD A;  2KLV A;  1U7M A;  1FJP A;  1MV8 A;  2ZVN B;  2HYN A;  1SQV D;  2NPS B;  3HRN A;  4DZO A;  1VQM P;  1X0T A;  2H88 D;  2R5B A;  4RES B;  2QSI A;  2IBZ I;  2FBW D;  2KS1 B;  1LTA C;  3BRV B;  3L72 E;  3T97 B;  5GTH H;  3V2P A;  3KZI H;  4UB8 H;  4W7Z A;  3CC2 P;  3NFQ A;  4PD4 E;  3Q2Y A;  3AE6 C;  2OTL P;  3CIR C;  5GTI E;  1KQF B;  2JR8 A;  3TK1 A;  3RL0 C;  2D2C C;  1D7M A;  4WY4 B;  5B5E E;  3C1L A;  3P8C D;  1VQ6 P;  3MD0 A;  1BGY J;  3R4Y A;  1QVF O;  2HPC B;  3L75 E;  3VRA D;  2KIK A;  2H88 C;  1JM0 A;  4DOJ A;  3H1L J;  5TJH A;  1L4A C;  1PGP A;  2HOD A;  3A0B H;  2N9Y B;  2BCC E;  1SQX J;  1RF1 A;  1SQX D;  1Q86 Q;  3CME P;  1YQ4 C;  1LTB C;  4C7N A;  2E75 B;  1BGY D;  1Q2N A;  4W7Y A;  1DH3 A;  3QH9 A;  3L73 E;  2FYU K;  1NTK D;  3Q1M A;  1PGQ A;  1CI6 B;  3H1L D;  5TIS E;  3L72 D;  1NU1 K;  2L91 A;  1KB9 I;  1SQV J;  3CCU P;  4I6L A;  2GA1 A;  1FAV A;  2R32 A;  3JSV C;  1K73 Q;  3VR8 D;  4YXW H;  1RF0 A;  4NPF X;  3V5B A;  5GTI H;  2M8R A;  4WBA A;  1N7S C;  3V4W A;  2BCC G;  3LW5 H;  1QVG O;  3L75 D;  1R5S A;  2RN0 A;  3GHG B;  2FYU J;  5AW3 B;  1BCC G;  1W5C E;  1X22 A;  5AVU B;  1SQB E;  4M3L A;  5CCG D;  1SQQ J;  1NTK G;  5CJ4 A;  3L4F A;  3P4Q C;  3L74 J;  2WSE J;  1FDM A;  2BS2 C;  1RE4 A;  2B87 A;  2QJY B;  1USD A;  2AXT H;  1T8Z A;  1IFI A;  3GW6 A;  1LP1 A;  3AEF D;  2K3R A;  1OW7 A;  2K9Y A;  1T3U A;  3VR9 D;  2CK3 H;  1RE4 C;  3PLN A;  2K9J A;  3AE7 C;  1UIX A;  4QMA A;  1RQU A;  1RE3 A;  1NTK J;  2XNX A;  2E75 C;  3CI9 A;  3EFF K;  2YKQ A;  1NH4 A;  1VPC A;  5KJ7 A;  1OVU A;  1NEK D;  1PPJ G;  1AQT A;  1SQV K;  3HE4 B;  3BVH A;  1LTJ C;  1SQP E;  2O3J A;  2QJP B;  1L4A B;  2OTJ P;  2QJP C;  3CCE P;  3SFE D;  3S9O A;  3P32 A;  3WUT A;  3RK2 D;  2Y0C A;  3RL0 g;  2KLU A;  2WZ7 A;  1IFM A;  1NGM B;  2WSF J;  1AV1 A;  4H0L D;  5C3J C;  4WVZ A;  2D2C B;  3RL0 B;  3G3Z A;  1FOS E;  1HJ0 A;  1Q82 Q;  4FJV A;  1Q7Y Q;  5APQ A;  3CMA P;  1GW4 A;  1FZE A;  1L0N G;  2YXR B;  1LTG C;  1S72 P;  3HE4 A;  3A0H E;  1NYH A;  1JY3 O;  1M1J C;  3FX0 A;  3TSI A;  1KQL A;  3L70 J;  3AE9 D;  1RY3 A;  1LTJ B;  1LWU C;  2K9J B;  3CX5 D;  1DD4 A;  3CX5 E;  2SPZ A;  4O9B A;  3D6Z A;  1L0L D;  4LLH A;  1GU4 A;  1SQP J;  4RJT A;  2AEF A;  2WS3 C;  1LWU A;  5E79 E;  1QLE D;  4LDT A;  3GHG C;  1LP1 B;  5APY A;  3C9I A;  2QEX P;  1L2P A;  5CMZ A;  1NU1 G;  5AW6 B;  2B87 B;  1VF5 B;  1EZV D;  2ZT9 C;  1H8A A;  3GHG A;  4RKU J;  5C2T D;  2Q3I A;  3AEC C;  1S1C X;  3VYI A;  1J1D B;  2VRS A;  3CCL P;  1P84 D;  1G2C B;  3VRA C;  2A45 H;  3N7N A;  1JY3 N;  3H1I G;  1KMI Z;  1M90 Q;  4YTM D;  4R4M A;  1FZB A;  1NTZ D;  4H13 B;  1NJI Q;  2RMZ A;  4IL6 H;  5CCH D;  2ZAE B;  5EFW B;  2Z5I A;  3C8V A;  1X8Y A;  1VQ7 P;  5AW7 B;  2E43 A;  1SQB D;  3II6 A;  2WT7 B;  3S4R A;  3CC4 P;  1SQB J;  1HBW A;  3H1H E;  3IFM A;  3L35 A;  5KKZ C;  3GF7 A;  2QM7 A;  3PH0 A;  3V6I A;  1GL2 C;  2NPS D;  3L71 D;  5AW9 B;  1JY2 P;  3FXD A;  3IN6 A;  5AW4 B;  2HFE D;  1EDJ A;  3M9H A;  4DHI B;  1NTM E;  2IYP A;  2WSF H;  4C7N B;  1JO5 A;  4Z1M H;  1M57 D;  1YIT P;  3WUU A;  2YKP A;  1GMJ A;  3P4P C;  3G6E P;  2H43 A;  4KJM A;  1RF1 B;  4WB4 A;  4EOT A;  1JY2 O;  1TFF A;  1X9V A;  4JBZ A;  3U1A A;  4ASV A;  3W68 A;  3AE1 D;  2O01 N;  1OW8 A;  2ZFC A;  1SQQ K;  1NTZ E;  3H32 B;  1LTS C;  1NTZ G;  1W2B O;  1JOC A;  3TYY A;  3M91 A;  1L0L K;  4YTN C;  1PV3 A;  5GTH E;  2OYI A;  1T2K C;  1ZP0 C;  3VMZ A;  2WPR A;  1M1J A;  5AVX B;  2WDQ D;  4KT0 J;  1BE3 E;  5AW8 B;  5KLI B;  1M56 D;  3T97 A;  1K05 A;  1NTM J;  3FWL A;  3VR8 C;  1SFC D;  2KS1 A;  3KXD A;  2V4H A;  3BRT B;  4BXL A;  1L0V C;  3U1C A;  3G4S P;  1GZL A;  4IFF A;  2W90 A;  2NPS A;  1T6A A;  3B71 A;  2OYO A;  4PV1 C;  1JTH A;  1S5L X;  2QA4 P;  5KTB A;  2FY8 A;  1EC5 A;  4UB8 E;  5AVT B;  2FXO A;  3OAK A;  1W2E A;  3I56 P;  2Q5U A;  3L73 J;  2K37 A;  3AE7 D;  2WWW A;  3AE2 C;  2N1T D;  2ZXE B;  1GU5 A;  1YBK A;  3H1K J;  2G8Y A;  1IFD A;  3I55 P;  2JJL A;  5AVQ B;  5CBO A;  1ZV8 A;  2NZ2 A;  1NAF A;  1MFZ A;  4BRY A;  3VON A;  1ZRT E;  2OTK E;  1N2D C;  1NKZ B;  1ZP0 D;  2XND H;  1KQS O;  2Z4E A;  3HTK A;  4WWI A;  3L74 G;  1EZV E;  3IAO A;  3MIW A;  3AEG D;  4HB1 A;  1KF6 D;  3H1I D;  4R4L A;  3CL3 D;  2DW3 A;  3H1K D;  4I2L C;  3O6Q A;  1X79 B;  2G3A A;  3L37 A;  4H44 C;  3OW2 O;  2A06 G;  2R3C A;  2E76 D;  2H89 C;  1R5L A;  4JYC A;  3TGU G;  1E7P C;  4KHX A;  2PP6 A;  3AED D;  1OIP A;  2UWJ E;  2XKM A;  3PRJ A;  3H1I J;  3AEC D;  2OQQ A;  1FC2 C;  4C7R A;  1SQB G;  3NTN A;  1EXI A;  2YNY A;  4YT0 D;  1KV4 A;  5APS A;  1KC8 Q;  4D6T J;  3BAT A;  3WU2 E;  1GDT A;  4D6T D;  4D6T E;  1A02 J;  3AE5 D;  1GL2 D;  5CBN A;  3LIE A;  2AXC A;  3HTK B;  3L71 G;  3Q5S A;  1K9M Q;  2ZXX A;  1NEN D;  4IL6 E;  1VQO P;  2E76 C;  2WP9 C;  2N1T A;  1S9K E;  1KYO I;  2J58 A;  4BRY B;  3H1J E;  1MZ9 A;  2CPB A;  1E79 H;  3CIR D;  3KDP B;  3AEA D;  2OYI C;  4HJG H;  4WY4 C;  1HTL C;  1PFI A;  4LC1 A;  1FZC C;  3AE3 D;  1VQN P;  2E5T A;  2MJZ A;  3M0D C;  1KTM A;  4EDF A;  1JUN A;  2FYU D;  5K5G B;  3EFG A;  1N7S D;  1AVO A;  3VRB C;  1E5W A;  3OA7 A;  4RO0 A;  1KYO H;  1S2E A;  3JCU E;  1S5L E;  1SQV E;  3P8M C;  1FU1 A;  1KIL A;  4A7P A;  1RH5 B;  2P67 A;  2C9L Y;  3CXH I;  2Y9Y A;  1USE A;  1WRG A;  2WU5 D;  4DDG A;  4ZKP A;  3AE8 C;  4U7J A;  3G71 P;  3ABV D;  1FE6 A;  1LT9 C;  3E7K A;  2C0W A;  2E75 D;  2H8P D;  3B5N D;  1FZC B;  1IZN B;  3TF5 A;  3SWY A;  1JY2 N;  3CWB G;  3CC7 P;  4NPE A;  2OYI B;  1G1I A;  3BCC J;  5APV A;  1WMK A;  2XU6 A;  2I8D A;  1ZN5 A;  1IO4 A;  1QX8 A;  3L70 D;  1K8A Q;  2OYH B;  3L70 G;  1DIP A;  2KUB A;  2Q1K A;  2WU5 C;  1VQ8 P;  3H25 A;  4ZMD A;  3MTU E;  2FYU E;  5CCH A;  1CZQ A;  1AQ5 A;  3KZI E;  3HE5 A;  1N73 B;  2M3E A;  2M3B A;  3N4X A;  2JWD A;  1ZLL A;  1YJW P;  3B8E B;  3BCC G;  4OH8 B;  2P2U A;  4UB6 E;  1OVR A;  3AE5 C;  3NXS A;  3SWK A;  2IZ1 A;  2C9N Y;  3KYQ A;  2P58 A;  1VL2 A;  3CWB E;  1KIL D;  1L0N E;  1CSB A;  1IC2 A;  1L0N K;  3B4S A;  1JCD A;  4H44 B;  5KLV G;  2WDR C;  5KLV E;  2W6B A;  3TNU A;  2FFD B;  2BS3 C;  3GG2 A;  1LNQ A;  2FFD A;  3AE3 C;  2E5Y A;  1PP9 E;  3CX5 H;  1PP9 D;  5CCG A;  3CCR P;  2KZJ A;  2D2C D;  4YTP D;  3L75 G;  2ITA A;  1FOS F;  1CW5 A;  1EQ7 A;  3G9R A;  1ZW0 A;  3BCC D;  1G2C A;  5CCG C;  3A0H H;  3BCC E;  3LW5 J;  2ZT9 D;  2IYO A;  1RF0 C;  3V4Q A;  5APT A;  1N73 C;  1SQX K;  1QL2 A;  2WIT A;  4PV1 D;  2KK7 A;  4NPD A;  1SQB K;  1JMB A;  4YSY D;  2M5A B;  4KX6 C;  1K04 A;  3NMD A;  1N73 A;  1NTK E;  1QLB C;  1DEB A;  1KZU B;  2KYV A;  1T2K D;  3PHL A;  3D71 A;  1BDD A;  5AW2 B;  3BAS A;  4B86 A;  3VR9 C;  1IK7 A;  1HJB A;  4HYT B;  1PGJ A;  2W8Z A;  1FDO A;  2KB7 P;  3JCU H;  3HUS C;  4OGQ B;  4YXD C;  1H0T A;  2IPP A;  4PJ0 E;  4Y28 J;  1VQ9 P;  2FXP A;  5M1B A;  3CLQ A;  1P84 H;  1URQ A;  1SQQ E;  1AJY A;  1BGY E;  3SFD D;  1VQ5 P;  4DCK A;  2JEE A;  1EZV I;  5AVV B;  1AFO A;  1KD1 Q;  3U59 A;  1J2J B;  1BE3 G;  4HKZ H;  1SLQ A;  4GIF A;  3L72 J;  2WTY A;  4GT1 A;  4U3F J;  4GOE A;  5H2F H;  1L4A A;  3P8C E;  3AEB C;  2QRX A;  3OJA B;  2WU2 D;  4XE5 B;  1BSH A;  1YYC A;  3L71 J;  4L74 A;  1T3J A;  2WDV D;  3AE4 D;  1HUC A;  1YI2 P;  1KB9 E;  1KB9 D;  1LGH B;  3CXH E;  1BGY G;  2JWA A;  2N1T B;  1KFY C;  2XV5 A;  1HWT C;  1AA0 A;  1IFP A;  2FXM A;  2A45 G;  1RF1 C;  2WSS H;  2KSJ A;  1NEN C;  1S4X A;  2IBZ G;  1NTM G;  1PIX A;  3V2R A;  1FZA A;  3H1L E;  2ZYG A;  2MKV A;  2J5U A;  3CWB D;  2QM8 A;  1J1E C;  3ZDM A;  1PL5 A;  1HH0 A;  1UII A;  3QWO C;  1A02 F;  3AE6 D;  2QJY C;  3JC2 2;  2WMM A;  4UB6 H;  1H88 A;  1PGO A;  4YSX D;  1GL2 B;  4DDI A;  3AE8 D;  3AE9 C;  2LXB A;  3AEB D;  3O6Q B;  4I1L A;  2FYZ A;  2IX7 C;  5KAF H;  2O01 J;  1L0N J;  1NU1 J;  4H44 D;  1BCC D;  2Q3E A;  3CWB J;  3SFE C;  5AVZ B;  1N7S A;  2POH A;  2XZR A;  3IR9 A;  2BCC D;  3CXH D;  4H13 C;  4JF7 A;  2R3S A;  2IBZ E;  1QL1 A;  3KHU A;  4N78 E;  3H1L G;  5C3J D;  3CCJ P;  3SSU A;  2NRG A;  1XTG B;  2YIU C;  1EZV G;  2WU2 C;  4Y99 B;  2QE7 H;  5KJ7 D;  1OXZ A;  3L73 D;  4PV1 B;  1AVY A;  1RE3 C;  4L76 A;  1URQ C;  1VF5 C;  2V7Q J;  2ZT9 B;  2E42 A;  2A06 E;  3AED C;  4I7Z B;  2W6J H;  3P7K A;  1HGZ A;  5CHX A;  2BS4 C;  3VP9 A;  1NEK C;  1VQK P;  2WSE H;  1P84 E;  3A5T A;  5KLI C;  1NTM K;  1S5L H;  2HG5 D;  2ZYD A;  2PFX A;  1SQQ D;  5KAF E;  5AW0 B;  5KJ7 C;  2WDR D;  2YO3 A;  1EDL A;  1FJK A;  1Y9B A;  1IK9 A;  4EI2 A;  1SQX G;  3MP7 B;  1L0L J;  1M1J B;  3EQ2 A;  1BSN A;  5AW1 B;  1MFT A;  2WPQ A;  1BCC J;  1ZR4 A;  2WS3 D;  3H32 A;  1JCC A;  3F89 A;  2OAR A;  2BCC J;  3P4R D;  3MHV A;  2LXC B;  2QIW A;  3VRB D;  1NKN A;  4N6J A;  2OGU A;  4YTM C;  2HLO A;  2B89 A;  2Y9Z A;  1BCC E;  4MN4 C;  4W80 A;  2YIU B;  1JMM A;  4PD4 H;  1MKM A;  5BU5 A;  1L0L E;  2KI7 B;  1Q90 D;  1KQG B;  1VQ4 P;  4D6T G;  1RQV A;  2O01 H;  3RK3 E;  1YTZ I;  3L71 E;  1NOH A;  3HUS B;  4KX6 D;  2Q7C A;  3WUV A;  3WU2 H;  5APX A;  1RHZ B;  4AUW A;  1NTK K;  1YTZ T;  2AEJ A;  4LGD E;  5C39 A;  1R8E A;  2WT7 A;  2Z5H A;  3VMA A;  1N7S B;  2B76 D;  4JYB A;  2FYN B;  2QJK C;  3E1I A;  2AEM A;  1KFM A;  3TGU J;  1FBM A;  5AVY B;  1M8O B;  3VP8 A;  4Y99 C;  2W83 C;  2WDV C;  3VMY A;  3IF4 A;  1J1E B;  3USS A;  2FYN C;  1OVV A;  3WMM 0;  2H89 D;  1ZME C;  1SQP D;  1KFY D;  1GL2 A;  2HR3 A;  3AEF C;  4PJ0 H;  1JNM A;  2IBZ D;  3P4R C;  1SQP K;  1YHQ P;  4AQR D;  5H2F E;  3RK3 D;  1LWU B;  1MUU A;  2K88 A;  1L0V D;  4L73 A;  1LTT C;  2BEZ F;  1IFJ A;  1SP4 A;  3CCQ P;  1KFN A;  2IZ0 A;  1LTI C;  3M9Q A;  3H1J D;  1KB9 H;  1LTJ A;  2A06 D;  1ZOY D;  2KZI A;  4YTP C;  1VQL P;  2R44 A;  1HF9 A;  2P10 A;  1L4A D;  1PP9 G;  2K1A A;  3M06 A;  1YJ9 P;  3V2N A;  3CCM P;  3Q5R A;  2Y0E A;  2AXT E;  3ITK A;  2B9B A;  4YTN D;  3AE2 D;  3TGU D;  3TGU E;  4H13 D;  4DJG A;  1XTC C;  2C0X A;  2P7J A;  3AE1 C;  3LID A;  3MUD A;  2RH0 A;  1Z56 A;  5AVW B;  3L72 G;  3B5N A;  3H1H D;  2FKW B;  2RKL A;  3A3Y B;  2V7Q H;  1OW6 A;  1QGK B;  1EDI A;  3V2Q A;  3HD7 D;  2JDI H;  2KNC A;  1OZH A;  1U7J A;  2IDB A;  1GD2 E;  4I6M C;  3RK2 B;  4U3F D;  4U3F E;  1P84 I;  1QEX A;  1GTW A;  3W67 A;  4U3F G;  1KIL C;  4I7Z C;  1NVO A;  2L5G B;  1H0T B;  3E1R A;  1U57 A;  1DEE G;  5DJT B;  1Q81 Q;  1URQ B;  3H1J G;  1N8R Q;  2KSE A;  1Y8A A;  1KYO D;  4OVN F;  3UIA A;  4IFD K;  5TIS H;  3VN0 A;  3KQG A;  1M1K Q;  1ZXG A;  2Q6Q A;  3H1J J;  2ACZ C;  3AEA C;  3VOP A;  2B76 C;  3GLM A;  2M5A A;  4PD4 I;  5C2T C;  1TU3 F;  2I1K A;  1JY3 P;  3EWK A;  4AYC A;  1YQ3 C;  3Q3D A;  4YSZ C;  2E74 C;  1FZF A;  1SFC C;  3L73 G;  1L0L G;  5B66 E; 
#chains in the Genus database with same CATH homology
 4H0L B;  5KLI C;  1YQ3 D;  1PIX A;  4YXD C;  1ZRT E;  3AE5 C;  3Q1M A;  3Q5R A;  4YSX C;  1ZP0 D;  4Y28 J;  4YXD D;  1R8E A;  1YQ4 D;  2MKV A;  3AE1 D;  4YTN D;  2E74 D;  2WQY C;  1OW8 A;  2FXP A;  1VL2 A;  3IAO A;  5M1B A;  1VF5 B;  2J5U A;  2ZT9 C;  2QJK C;  1NEK D;  3AE2 D;  3AEG D;  4YT0 C;  3VRB C;  2JP3 A;  4TT3 H;  4H13 D;  1KF6 D;  1KIL E;  4RKU J;  5C2T D;  4R4L A;  3AEE C;  3VR9 C;  2E76 B;  4H44 B;  1PL5 A;  1ZOY C;  3AEC C;  1S1C X;  1AJY A;  3SFD D;  2WDR D;  3AEG C;  3O6Q A;  1Y9B A;  3AE1 C;  4YTN C;  2QJP C;  1PV3 A;  2QJY C;  3AE6 D;  3SFE D;  3VR8 D;  3S9O A;  2H88 D;  2WDR C;  2G3A A;  4H44 C;  2WDV C;  3VRA C;  2QSI A;  3RL0 g;  4YSX D;  1ZP0 C;  2FBW D;  2BS3 C;  1NGM B;  1EXJ A;  1DD3 A;  2WU5 D;  2E76 D;  2H89 C;  1KMI Z;  2FYN C;  2WDQ C;  3AE8 D;  4YTM D;  3AE3 C;  3Q5P A;  4R4M A;  3AE9 C;  3T97 B;  1E7P C;  3AEB D;  2WSF J;  2H89 D;  3AE8 C;  3D70 A;  2WDQ D;  1OW6 A;  4YSZ D;  1ZME C;  2JO1 A;  4H13 B;  4H0L D;  4KT0 J;  4U7J A;  3D6Y A;  3ABV D;  2B76 D;  2D2C D;  5C3J C;  4YTP D;  2D2C B;  2O01 J;  2WS3 D;  3AED D;  3C8V A;  4OGQ C;  4H44 D;  1KFY D;  1K05 A;  2E75 D;  3AE6 C;  3Q2Y A;  2IDB A;  3SFE C;  3CIR C;  1HJ0 A;  3VR8 C;  1KQF B;  3P4R D;  3G9R A;  3FGA D;  3AEC D;  2OQQ A;  2D2C C;  3AEF C;  2WP9 D;  3LW5 J;  4I7Z C;  1L0V C;  4H13 C;  1EXI A;  2QIW A;  1OMI A;  2ZT9 D;  4YT0 D;  3P4R C;  3VRB D;  3AEB C;  1U57 A;  2WSC J;  5KKZ C;  4YTM C;  2WPV B;  1NYH A;  3GF7 A;  3R4Y A;  2WU2 D;  4YSY C;  1WMK A;  3P4Q C;  4XFJ A;  4PV1 D;  5C3J D;  2WSE J;  3P4S D;  3B71 A;  3P4S C;  3AE5 D;  4GDO A;  1KOR A;  2BS2 C;  2WDV D;  3P4Q D;  3VRA D;  4PV1 C;  2H88 C;  2YIU C;  3AE4 D;  3GF3 A;  1DIP A;  1S5L X;  2WU2 C;  4YSY D;  3AE9 D;  4IL6 X;  3Q5S A;  1NEN D;  4KX6 C;  1JB0 J;  1K04 A;  3AE4 C;  3GMA A;  3IN6 A;  4PV1 B;  2E76 C;  3H25 A;  2WU5 C;  2WP9 C;  1L0V D;  2FBW C;  1DD4 A;  2BEZ F;  1ZOY D;  3AEF D;  1MKM A;  2K9Y A;  1OW7 A;  1QLB C;  2ACZ C;  2BEQ D;  3AEA C;  3D6Z A;  3AE7 D;  3VR9 D;  1VF5 C;  2V7Q J;  2ZT9 B;  3AE2 C;  2B76 C;  2WQY D;  1Q90 D;  3D71 A;  1KQG B;  1FDI A;  1YQ4 C;  1KFY C;  3AE7 C;  3CIR D;  1UIX A;  1VF5 D;  2G8Y A;  1IK7 A;  3GLM A;  3SFD C;  1RQV A;  4YTP C;  4OGQ D;  4Z1M H;  3AED C;  4I7Z B;  2ACZ D;  2WS3 C;  1TU3 F;  3AEA D;  3AEE D;  3ABV C;  3EWK A;  5C2T C;  3RK3 E;  1HF9 A;  1KF6 C;  1YQ3 C;  2YMK A;  3Q3D A;  4YSZ C;  2NZ2 A;  4H0L C;  1RQU A;  2E75 B;  1FDO A;  1GMJ A;  2P10 A;  2E74 C;  5L8R J;  1NEN C;  1NEK C;  2BS4 C;  3P4P D;  3AE3 D;  3P4P C;  4KX6 D;  2E74 B;  2E75 C;  1KTM A;  4OGQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...