1ZOYC

Crystal structure of mitochondrial respiratory complex ii from porcine heart at 2.4 angstroms
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
138
structure length
138
Chain Sequence
b'TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAD-binding protein
publication title Crystal Structure of Mitochondrial Respiratory Membrane Protein Complex II
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 50
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2005-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1zoyC01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 1zoyC02
3AE4C 2ACZC 1QLBC 3AEBD 4YSXC 3AECD 4KX6C 2WDVD 1OW8A 3AEAD 4YTND 5C2TC 3AEFD 2G3AA 2H88C 3AE9D 3AEBC 3VRBD 5C3JC 4YSYC 3AECC 3ABVD 2WDVC 2B76D 4YTMD 1K05A 1OW7A 3AEFC 1L0VD 3VRBC 1YQ4D 3AEDC 3AEGD 3VR9D 3VRAD 1KF6D 3AE2C 2B76C 4YTMC 3AE8D 3VR8D 4YSZD 2BS4C 2WP9D 2WU5C 2H89D 2WDRD 3AE3D 2WDQD 3AEGC 1KTMA 3VR9C 3VRAC 3P4PD 1KF6C 1NEKD 1ZP0D 1ZOYD 3AE8C 3VR8C 3SFDD 4YSZC 3AEAC 4YTNC 2WQYD 2WDRC 2WDQC 3AE9C 3P4PC 1ZP0C 1NEKC 3ABVC 3AE6D 3P4SD 1KFYD 3SFDC 3AE1D 1YQ3D 2WQYC 5C2TD 1L0VC 1PV3A 3AE7D 3AE4D 3CIRD 2WU2D 1YQ4C 3AE6C 2BS2C 1KFYC 3AE5D 2WS3D 1E7PC 3AE1C 1YQ3C 4YT0D 4YTPD 1OW6A 3AEED 3AE7C 1K04A 2WP9C 2H89C 3CIRC 2H88D 3AE3C 2WU2C 4YXDD 3S9OA 3P4RD 3P4QD 5C3JD 4YSYD 3AE5C 3SFED 2WS3C 1ZOYC 4YT0C 4YTPC 3AEEC 2FBWD 4YXDC 1NEND 2BS3C 3P4RC 2ACZD 3P4QC 3SFEC 3AEDD 3B71A 3AE2D 4YSXD 3P4SC 2FBWC 4KX6D 1NENC 2WU5D
chains in the Genus database with same CATH superfamily
5KAIH 1VQOP 1Q81Q 2OARA 2IBZI 1U57A 1ZN5A 3P8CE 4L76A 2CPSA 3L70J 3TDKA 1Q7YQ 1DIPA 1NTKE 1IFPA 1AJYA 1RF1C 3L4FA 3A5TA 2WTYA 2WWWA 3O6QB 2SPZA 4PD4I 1IZNB 5APTA 1JY3N 2NPSD 4QMAA 3CCVP 2IFMA 1GU5A 1P84H 1AFOA 3L71G 3G4SP 2BEQD 1FZBA 2FYUG 3HRNA 4PJ0H 1G2CA 4DZOA 1NH4A 1SFCD 1SQVK 1LTGC 1BGYG 3SWFA 3JCUH 3K5BA 1QL2A 3L37A 3R2PA 2WS3D 3VONA 1SQVD 3S4RA 1ZXGA 2FYNC 1L0LG 1FDOA 5KLIC 1ZOYC 1NKNA 2H7HA 1N7SB 1IK7A 4W7ZA 3CCRP 3H1ID 3HE4A 2QE7H 3FX0A 1L0NG 3P4QC 1AVOA 1DH3A 2E75C 4I6MC 5BU5A 4PV1C 4TLFA 1YYCA 4ASWA 1BSNA 3WUTA 3AE4C 2KK7A 4DJGA 2KB7P 3EFGA 4DDGA 4UB6H 5AVQB 2IZ1A 3V2PA 3HD7B 2OYIB 2KNCA 2D2CB 3AECC 2J59M 4Y28J 1NJIQ 3H1JE 3L74D 3PLNA 3O6QA 2P2UA 3NMDA 1PP9G 3L35A 3AE2C 1S2EA 1NVOA 2HFED 1RQUA 1SQVJ 1Y47A 1PGOA 2ZXEB 3FWLA 1EZVI 2WDQD 1USEA 3RL0g 3RK3C 1KTMA 1M1KQ 2KYVA 4K35A 1ZOYD 2YO2A 1GK6A 4YSZC 5KLVE 3H1IJ 1J1DC 2WQYD 1Y9BA 5CCGD 3NFQA 2NRGA 2ZT9D 2WSCJ 4RKUJ 1S1CX 3AE6D 1P84I 1JTHA 2RN0A 2QJYC 4N78D 5B5EE 4GIFA 3AE7D 3AE4D 4D6TD 2W6JH 1M1JA 2E76C 1VQ8P 2AXCA 2O1JA 4H13B 1GD2E 3E1RA 2OTLP 3WUUA 1JY3P 3D6ZA 3AEEC 1FJKA 1MV8A 2WSEH 1NEND 3L74J 1FDMA 1SQXE 2AEMA 3BCCG 4RO0A 1EDIA 3B71A 4WBAA 3AE2D 3FWNA 2XDJA 2QA4P 1PGPA 4YSXD 3CXHD 3G3ZA 3MHVA 3HUSB 1KB9D 3VMAA 3RK3D 1ZW0A 4NPFX 3H1KJ 1VQNP 1EDJA 1S3JA 2WZ7A 1NTZJ 3A0BH 1JY2O 1IO4A 4YSYC 3H1JG 3B5NC 3HD7A 3CCSP 3VOPA 2N1TB 5CCHA 3H32B 5TISE 1IFDA 3IFMA 3L72E 4ZNCA 4JYCA 4AUWA 3VR8D 2BS4C 3M06A 1FE6A 3P4PD 2B9BA 2JP3A 4YTNC 2QIWA 4JYBA 4OVNF 2KUBA 4WVZA 2K88A 4WY4D 1IFJA 1E5WA 1AQ5A 4EOTA 1YJ9P 1KYOE 2QJKB 3C1LA 4XA4A 2J58A 1L0VC 5AVVB 4HH2A 1PPJG 1KV4A 1ZMEC 1HJ0A 5GTHH 4BRYB 4YT0D 1N7SD 2QG4A 2WVRA 2QRXA 1NU1J 4YSYD 4BWNA 3CXHH 3B5ND 2RMZA 3L36A 1SQXG 2IZ0A 1NO4A 2R5BA 2FYUD 3H1LG 2FBWD 1M7LA 2AEJA 3TGUE 2LR2A 1HBWA 1RF0A 1ZV8A 1Q90D 2A45G 2HODA 2OGUA 4C46A 1SQBE 1SS1A 3F5HA 1Q2NA 1BCCE 2D2CD 3HUSA 1LT9B 1NAYA 2FXMA 4YTND 2YMKA 2KP8A 2Y9ZA 3RK2B 5APUA 3A0HE 2A06G 1JY2N 3GG2A 3L72G 3AEFC 1L0VD 4O9BA 2WITA 2POHA 1OWAA 2IBZD 4IFDK 2W6AA 1LNQA 1QLED 3P8CD 5AW0B 2B89A 1R8EA 1KQLA 1NYHA 1L4AC 1NTKD 2P1JA 2FYUJ 4Z1MH 4U3FG 1S9KE 3SWKA 3KZIE 3MUDA 4I7ZC 2GUSA 3HTKB 4EIJA 3M9HA 2JKVA 3KQGA 1PV3A 2FFDB 4H13D 1FS0E 2OYHB 2NPSB 4IFMA 1E7PC 1YQ3C 2E74B 3G6EP 1BE3E 4BRYA 2IYOA 1L0LJ 5APSA 1URQB 1TFFA 1RY3A 3GMAA 1X9VA 3GF7A 1SFCB 3MTUE 3R4YA 3CCLP 3JC22 3BRVB 1DEEG 2JR8A 4KX6D 4H0LC 1BCCG 3CXHI 1KB9I 1X8YA 4JF7A 3Q5PA 1LTJA 1L4AD 1FBMA 1KORA 1NTKJ 3WUVA 3L75E 2IFNA 4L73A 1NU1E 1WT6A 1RH5B 1RF1B 1N2DC 1SP4A 2N1TD 2KOGA 1OX3A 2PGDA 2M5AB 1Y8AA 4YTMD 1K05A 3U1AA 1H88A 4JBZA 3UIAA 3IAOA 3HE5A 2Q5UA 3Q5RA 2JJLA 4JPZB 3AEGD 1J1EC 1IJDB 1KF6D 1ZLLA 3KPEA 1D7MA 2KSJA 4A7PA 2WDRD 3QH9A 1KILE 3VMYA 1SQQG 1PGQA 2O01N 1ZP0C 2GA1A 3USSA 3H1JD 2V4HA 3ABVC 1YJWP 1L2PA 3WU2E 4EYYQ 2PP6A 5DJTB 1YBKA 3BVHA 1BE3G 4L75A 3D70A 3VN0A 1T2KC 1G1JA 3L71E 2QM7A 2NPSA 5AW3B 2H89C 2WU2C 2PAJA 4YXDD 2FYNB 1YTZT 3GHGC 5KJ7D 5KLVD 2OTKE 4C7NB 1GW4A 5KLIB 3H6PA 2MJZA 4DOJA 1FZAA 1RE3A 1NGMB 1BGYE 2BCCE 4I2LC 4ZKPA 1W2EA 4PV1B 2UWJE 1SFCA 1Q82Q 2RH0A 4IL6E 5C2TC 1QEXA 3V4QA 2WT7B 2ZAEB 3CLQA 5DJUB 1HH0A 1EDLA 3RK2D 4LC1A 1N8RQ 2WDVD 1JB0J 1A02J 3V5BA 2PFXA 3VRBD 3H1JJ 3ABVD 1LP1B 2JDIH 1LWUB 1FDIA 1XTGB 1L0NE 1GZLA 2R44A 1N73A 2N9BA 3P8MC 1H0TB 3AE8D 5K5GB 1YHQP 2H89D 2R3CA 3FXDA 1Q86Q 3RK3B 3TSIA 3V6IA 5KLVJ 3VRAC 1KC8Q 3FGAD 3SFDD 1T6AA 1HF9A 1J1DB 3NXSA 2I8DA 2ZFYA 1X0TA 2HPCB 5CBNA 1WMKA 3VMZA 1KFYD 3Q3DA 2Q6QA 5C2TD 4W80A 1PP9E 2E74D 3CD6P 1JEKA 2E76B 3AE5D 4GKGA 4R4MA 2M8RA 2FXOA 3IF4A 1URQD 5B5EH 3CIRC 1EDKA 1GL2A 5AVUB 2BCCG 1SQXJ 4C7NA 4HYTB 1KYOD 4WY4B 2XKMA 4OGQC 3PH0A 1GMJA 5CCGA 2M0BA 4B86A 1VQ7P 5GTIH 1FZEA 2L91A 1PL5A 1FAVA 1SQBK 1OVRA 1FOSE 3AEBC 4U7JA 5AW4B 3B5NB 2GM4A 3TGUD 4HB1A 1MKMA 3L72J 3L73G 3BCCE 4L74A 1LP1A 3KDPB 1LWUA 1NTMG 2R3SA 1DX7A 1VQKP 1GDTA 2QM8A 1FZCA 4I6LA 1SQBD 3N4XA 3F89A 3V2RA 3CMAP 5TISH 3O8ZA 2Q9IA 5AW1B 3CX5E 2P67A 3AE9C 2KSEA 3TNUB 1NTZK 2E5YA 2HPCA 1K8AQ 2YKQA 1SVFA 2K37A 4IL6X 4DDIA 3H1HG 3C9IA 1AVYA 1KMIZ 3AE1C 1KYOH 3H1KD 4CPGA 2IX7C 2ZYDA 1OW6A 3N7NA 1NTZD 3SSUA 5H2FE 3P4QD 2HLOA 2ZYGA 1S9KD 2HR3A 3TGUJ 2E75D 4YTPC 4PV1D 3P4RC 4WY4A 4IOIH 3P4SC 1SQBJ 1BCCJ 1PPJE 2WSCH 1AV1A 1ZRTE 3AECD 1KILC 4PJ0E 2IYPA 3AE9D 2OYOA 1N7SA 1U7MA 3H1LE 3I56P 1NU1K 4KJMA 2KZIA 1R5LA 1K9MQ 1T3UA 1SQPG 2ZVOB 3I55P 4YSZD 2A45I 3CI9A 3L75D 1M1JC 4WWIA 1L4AB 1NU1D 1OZHA 2OYIA 3GLMA 3M0DA 2W27A 5C39A 2K9JB 2ZVNB 1VF5C 3A2AA 4I7ZB 2A06E 3P4SD 2E76D 1BDDA 3OAKA 3TNUA 2W83C 1YQ4C 2C0XA 1M56D 5KTBA 1BE3J 1WRGA 1GU4A 1KILD 2JEEA 1W2BO 3V4WA 2QSIA 3AEED 1FJPA 2DW3A 1YI2P 3A7OA 4U3FE 3L70G 4DHJA 5AW9B 1ZR4A 3HD7C 1KYOI 1EQ7A 4UB8H 3SFEC 2FYUK 1CI6B 4H0LB 5CCHC 1VQPP 5CMZA 1JCDA 3E1IA 1KFNA 1RE4A 3L75J 2ACZC 3L71D 4K3AA 3TYYA 5TJHA 4C7RA 4H44C 3M9QA 1KB9H 4GDOA 4RJTA 1GK4A 5AVZB 1EC5A 2Q3IA 1BGYD 2FXPA 3IN6A 2E43A 1L0LK 2NZ2A 1J1EB 1YQ4D 1VQ9P 1VQ4P 2B76C 1VPCA 3PHLA 1L0NK 2LKMA 2LXBA 3W68A 5AVYB 2RKLA 3VR9C 1EXIA 1L0LD 5E79H 1L4AA 2KI7B 1NTKK 2R32A 2VRSA 1L0ND 1NEKC 2K9JA 3V2NA 2N1TA 3M0AA 3H32A 1RF0C 1CZQA 3LW5J 3KXDA 1OFCX 3L71J 4FJVA 2ZXXA 1M8OB 1LJ2A 3KHUA 1LTBC 3WU2H 5M1BA 1LT1A 3GHGB 1SQQE 3S9OA 1U7JA 1T3JA 1BGYJ 3LW5H 2BCCJ 4NPEA 4YPCA 1OMIA 2CK3H 4GODA 4RESB 1CSBA 1PP9D 1FU1A 2W90A 2JWAA 2KS1B 4XFJA 2KIKA 3E7KA 5AW5B 1CI6A 1DEBA 4N3YB 1M90Q 1SQVG 1OW8A 4IL6H 3AEFD 3CL3D 1T8ZA 1L0NJ 4OWFA 3T97B 5KJ7A 3WMM0 5AW8B 3H1IG 1OW7A 3MUDC 1NAFA 2YXQB 3RBXA 2AXTE 2YKPA 3LIEA 1LT9A 2IDBA 1VQMP 1NKZB 3BCCD 3MD0A 1PP9J 1VQ6P 2H43A 2YO3A 1YQ3D 2OTJP 3C8VA 3BATA 2V7QJ 4R4LA 1KZUB 3CCEP 1VDFA 1LTJC 3NTNA 3CX5D 2Q3EA 5BU8B 5KAFE 3H25A 1JMMA 1OXZA 2V7QH 5KLVK 4H0LD 2WSFJ 3HTKA 5AW2B 5AVWB 2FFDA 1JY3O 2OYHA 1JY2P 3U1CA 1NWQA 2ITAA 4D6TG 2WSFH 3S1KA 2W6BA 3PP5A 1VL2A 3PRJA 1URQA 1H8AA 3BCCJ 3CWBE 1HGVA 2E75B 1SQXK 1MZ9A 2XZRA 1PPJD 1RHZB 1ZRTD 2CPBA 1S5LE 1KD1Q 3CC2P 2WU5C 2W8ZA 1ZP0D 2NPSC 3CPWO 1RF1A 1SQXD 2Z4EA 3AEAC 3H1LD 1LTAC 4GOFA 4KHXA 2M5AA 3GW6A 3HE4B 1KQSO 1X22A 1UIXA 3MIWA 3L73E 1NTME 3CX5H 3EWKA 1T2KD 3OJAB 1SFCC 2WU2D 3RBZA 1KN7A 2FKWB 1TU3F 2KZJA 2IBZE 1HWTC 2QJPC 3IR9A 2C0WA 1A02F 2WS3C 2KNCB 2QJYB 2A06D 3L72D 5H2FH 4PD4E 5APXA 1PIXA 3U59A 1QVFO 1N73C 1HVVA 2I1JA 2WU5D 3H1HE 1PGJA 3D71A 1KILB 2G8YA 3MP7B 3AEAD 2ZJSE 3H1LJ 3CWBG 2IPPA 4U3FD 4MN4C 5C3JC 4M3LA 3A3YB 1QX8A 5AVXB 1JTHB 1VQLP 3VRAD 1E79H 1HUCA 5B66E 2B88A 2WT7A 1M1JB 3CC4P 2Q7CA 1W5CE 1OIPA 2A45H 2YIUC 3JSVC 1GL2C 2Y0DA 2LXCB 2PRRA 4LDTA 1OVUA 2WDQC 3RL0C 1VF5B 4Y99C 1R5SA 1M57D 1N7LA 4DHZA 4AYCA 5L8RJ 3BRTB 2C9NY 2WQYC 1BCCD 5CCGC 1SQPE 3CIRD 4OH8B 2ZT9C 2IBZG 1H0TA 1FZFA 3II6A 3AE6C 3G71P 2P58A 3AE7C 3GF3A 4U3FJ 1PZQA 3ITKA 3CX5I 4OGQD 1ZR2A 5C3JD 1NTKG 5EFWB 3G9RA 2KLUA 2WPVB 3VYIA 5KAIE 1SQQK 2K1AA 1JOCA 5KKZC 2WPSA 5CBOA 2O01J 1LWUC 2P10A 2WPRA 5APQA 4HKZH 1NENC 4GT1A 4EI2A 1S5LX 1FZCC 3TF5A 4YXWH 4H44B 1QLBC 3AEBD 3VP9A 1BSHA 4YSXC 1EZVE 1SQQD 1MFTA 3VTPC 1GL2D 3MZWB 1JO5A 1KILA 1VQ5P 2H88C 3RL0D 2O01H 3P32A 3L70E 2Q1KA 2FY8A 3I5CA 1P84E 2KLVA 1GW3A 2YKOA 2B87B 1JMBA 1G1IA 1BE3D 1X79B 1S72P 2WSEJ 1FZGA 1HJBA 3VR8C 4JQ0D 4N6JA 3JCUE 3FXEA 3B5NA 5APVA 3P4PC 5AW7B 1KQGB 3A0HH 1LGHB 3AE1D 1DD3A 2M3EA 2AEFA 1Z56A 1N86A 1NHLA 4WY4C 2HODB 1CW5A 5GTIE 5CJ0A 3Q1MA 1SQQJ 2QVAA 4YTPD 1FC2C 1MUUA 2YXRB 2H88D 3P4RD 4YT0C 1N7SC 2BS3C 1H89A 4ZKUA 1DD4A 4UB6E 3B4SA 2K9YA 3KZIH 4NPDA 2FBWC 1EZVG 2Y0EA 4D6TJ 1YITP 3MGNA 2Y0CA 5AVRB 1IC2A 1QVGO 1IFIA 5KLVG 2OYIC 2D2CC 3M0DC 4GOEA 2WPQA 2GUVA 2KXPB 2MKVA 2B87A 1K73Q 3P7KA 2E5TA 1VF5D 1SQVE 2BCCD 3CWBD 1JCCA 2AXTH 1BDCA 1RQVA 1IFNA 1QGKB 2O1KA 2OQQA 3H1IE 4TT3H 2ZYAA 3Q2YA 1YIJP 5CHXA 3TK1A 2BS2C 1NTMK 1RE4C 4LGDE 3Q5SA 1GTWA 1YTZI 1LTJB 4H13C 5AW6B 1EXJA 3HD7D 3SFED 3PTZA 4DT0A 1OVVA 3CMEP 3VMXA 2Z5IA 2O3JA 5CCHD 1NOHA 3L73D 1NTMD 2ACZD 2YMYA 2I1KA 3CCQP 4H44D 5KAFH 3HE5B 2JO1A 2WSSH 3L74E 2BASA 3LIDA 3A0BE 4WB4A 3HUSC 1PFIA 2JWDA 4KX6C 4ASVA 3CWBJ 2P7JA 2G3AA 3H1KE 1LTSC 1NTZE 2B76D 3PJSK 4PD4D 4ZMDA 2Y9YA 2N1TC 3AEDC 3VR9D 3H1HD 4N78E 2J5UA 2M3BA 4YTMC 4D6TE 1HGZA 3AEGC 3W67A 3BASA 1KF6C 1NEKD 1HTLC 1JM0A 1S5LH 2WDRC 3L73J 4UB8E 1NTMJ 3TGUG 5GTHE 2QJKC 1S4XA 2ZFCA 2HYNA 3CXHE 3KYQA 4DHIB 1SQBG 1KB9E 2K3RA 1AA0A 3M91A 3RK3E 1SQPK 2QJPB 2WP9C 2XU6A 3AE3C 1QL1A 2R5DA 1JNMA 4EDFA 1JUNA 2N9YB 1USDA 4YXDC 3M9BA 5KJ7C 5APWA 3L74G 3V2QA 3VP8A 3AEDD 4W7YA 1SQPD 3H1HJ 1N73B 1LTIC 3CCJP 3OA7A 5CJ4A 1IFMA 3D6YA 5E79E 1KFMA 4PD4H 2Z5HA 3H1KG 3GHGA 1LT9C 4DCKA 1NTZG 4OGQB 3EFFK 2QEXP 3RK2C 2WDVC 1LTTC 1UIIA 2HG5D 3QWOC 3EQ2A 4HJGH 3VRBC 3ZDMA 4IFFA 2KS1A 1MFZA 3B8EB 2H8PD 1EZVD 2WP9D 1KQFB 3AE3D 2XNXA 1AQTA 1YJNP 2YIUB 2XV5A 3SWYA 1GL2B 3AE8C 1G2CB 5B66H 3L70D 4I1LA 2WMMA 3RL0B 4Y99B 3T97A 2FYZA 2FYUE 1P84D 4XE5B 1SQPJ 3CC7P 3RGUA 3SFDC 4KT0J 2L5GB 2C9LY 1SLQA 3CCMP 5APYA 2BEZF 2ZT9B 2FFDC 2YNYA 3OW2O 2OYHC 1KFYC 4LLHA 1FOSF 1K04A 3L75G 2XNDH 2E74C 2E42A 1IK9A 1NU1G 3AE5C 3CCUP 1RE3C 5BVZA 1URQC 1XTCC 1L0LE 5AVTB 1J2JB 5AVSB 5KKZB 4AQRD 4BXLA 1FZCB
chains in the Genus database with same CATH topology
3AE4C 1S5LX 2ACZC 1ZRTE 4H44B 3D6YA 1QLBC 3D71A 3Q5PA 3AEBD 4H44C 1U57A 1KORA 2D2CD 4YSXC 3AECD 2G8YA 4KX6C 2WDVD 1PL5A 1OW8A 3AEAD 4YTND 5C2TC 1JB0J 1VL2A 4GDOA 1DIPA 3AEFD 2G3AA 2YMKA 2H88C 3AE9D 4OGQB 1AJYA 2D2CB 3AEBC 3VRBD 4U7JA 2D2CC 4YSYC 3AECC 5C3JC 3ABVD 4Y28J 3T97B 2FXPA 2E75B 2WDVC 3IN6A 1FDIA 2B76D 1MKMA 4YTMD 1K05A 1OW7A 3AEFC 1L0VD 2NZ2A 3IAOA 3VRBC 3Q5RA 3O6QA 1YQ4D 3AEDC 3AEGD 3VR9D 3VRAD 1KF6D 3AE2C 2J5UA 2B76C 2MKVA 4YTMC 3AE8D 3VR8D 1RQUA 4YSZD 2BS4C 2WP9D 2WU5C 2H89D 2WDRD 1KQFB 3AE3D 2WDQD 1KILE 3RL0g 1R8EA 3AEGC 1KTMA 2WSEJ 3VR9C 3VRAC 3P4PD 1NYHA 1VF5D 1KF6C 1EXIA 1NEKD 1ZP0D 3FGAD 2BEQD 2YIUC 1ZOYD 3AE8C 3VR8C 3SFDD 4YSZC 3GLMA 2IDBA 1HF9A 2JP3A 3AEAC 4YTNC 2QIWA 2WDRC 2WQYD 1Y9BA 4Z1MH 2WDQC 3AE9C 1VF5B 1RQVA 3P4PC 1ZP0C 1VF5C 2ZT9D 2WSCJ 2OQQA 1NEKC 4I7ZB 4RKUJ 3ABVC 1UIXA 1WMKA 1S1CX 1KQGB 4I7ZC 4TT3H 3AE6D 1KFYD 3SFDC 3P4SD 2E76D 2QJYC 3Q3DA 2QJKC 3EWKA 5L8RJ 1DD3A 4KT0J 1YQ3D 2WQYC 3AE1D 5C2TD 1L0VC 3LW5J 1PV3A 2BEZF 3AE7D 4H13D 3AE4D 2ZT9B 3C8VA 2E74D 3Q2YA 4IL6X 2WU2D 3CIRD 2ZT9C 1YQ4C 2V7QJ 4R4LA 3Q1MA 2E76B 3AE6C 2BS2C 1TU3F 1ZMEC 1KFYC 2WS3D 3AE5D 2E76C 4R4MA 1KMIZ 1E7PC 1HJ0A 3AE1C 3Q5SA 3D70A 1YQ3C 4YT0D 4H13B 2QSIA 3RK3E 4YTPD 1OW6A 3AEED 2E74B 3AE7C 3GF3A 4H13C 5M1BA 1K04A 2WP9C 2E74C 2H89C 3CIRC 2H88D 3AE3C 2QJPC 2WU2C 3S9OA 4YXDD 3P4RD 1EXJA 4OGQD 3P4QD 2FYNC 4YSYD 5C3JD 3AE5C 3SFED 2WS3C 1FDOA 3D6ZA 5KLIC 1ZOYC 3H25A 4YT0C 1IK7A 2E75D 4YTPC 4PV1D 3AEEC 2FBWD 3G9RA 2WPVB 4H0LD 3GMAA 4YXDC 1NGMB 1OMIA 1NEND 2WSFJ 3GF7A 2BS3C 3P4RC 4OGQC 2ACZD 3P4QC 3R4YA 1GMJA 3SFEC 3AEDD 5KKZC 1DD4A 3B71A 4H44D 1PIXA 4PV1B 3AE2D 4YSXD 2O01J 1Q90D 2E75C 2JO1A 2K9YA 4H0LB 2P10A 4PV1C 3P4SC 2FBWC 4KX6D 4H0LC 4XFJA 1NENC 2WU5D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AE4 C;  2ACZ C;  1QLB C;  3AEB D;  4YSX C;  3AEC D;  4KX6 C;  2WDV D;  1OW8 A;  3AEA D;  4YTN D;  5C2T C;  3AEF D;  2G3A A;  2H88 C;  3AE9 D;  3AEB C;  3VRB D;  5C3J C;  4YSY C;  3AEC C;  3ABV D;  2WDV C;  2B76 D;  4YTM D;  1K05 A;  1OW7 A;  3AEF C;  1L0V D;  3VRB C;  1YQ4 D;  3AED C;  3AEG D;  3VR9 D;  3VRA D;  1KF6 D;  3AE2 C;  2B76 C;  4YTM C;  3AE8 D;  3VR8 D;  4YSZ D;  2BS4 C;  2WP9 D;  2WU5 C;  2H89 D;  2WDR D;  3AE3 D;  2WDQ D;  3AEG C;  1KTM A;  3VR9 C;  3VRA C;  3P4P D;  1KF6 C;  1NEK D;  1ZP0 D;  1ZOY D;  3AE8 C;  3VR8 C;  3SFD D;  4YSZ C;  3AEA C;  4YTN C;  2WQY D;  2WDR C;  2WDQ C;  3AE9 C;  3P4P C;  1ZP0 C;  1NEK C;  3ABV C;  3AE6 D;  3P4S D;  1KFY D;  3SFD C;  3AE1 D;  1YQ3 D;  2WQY C;  5C2T D;  1L0V C;  1PV3 A;  3AE7 D;  3AE4 D;  3CIR D;  2WU2 D;  1YQ4 C;  3AE6 C;  2BS2 C;  1KFY C;  3AE5 D;  2WS3 D;  1E7P C;  3AE1 C;  1YQ3 C;  4YT0 D;  4YTP D;  1OW6 A;  3AEE D;  3AE7 C;  1K04 A;  2WP9 C;  2H89 C;  3CIR C;  2H88 D;  3AE3 C;  2WU2 C;  4YXD D;  3S9O A;  3P4R D;  3P4Q D;  5C3J D;  4YSY D;  3AE5 C;  3SFE D;  2WS3 C;  1ZOY C;  4YT0 C;  4YTP C;  3AEE C;  2FBW D;  4YXD C;  1NEN D;  2BS3 C;  3P4R C;  2ACZ D;  3P4Q C;  3SFE C;  3AED D;  3B71 A;  3AE2 D;  4YSX D;  3P4S C;  2FBW C;  4KX6 D;  1NEN C;  2WU5 D; 
#chains in the Genus database with same CATH topology
 5KAI H;  1VQO P;  1Q81 Q;  2OAR A;  2IBZ I;  1U57 A;  1ZN5 A;  3P8C E;  4L76 A;  2CPS A;  3L70 J;  3TDK A;  1Q7Y Q;  1DIP A;  1NTK E;  1IFP A;  1AJY A;  1RF1 C;  3L4F A;  3A5T A;  2WTY A;  2WWW A;  3O6Q B;  2SPZ A;  4PD4 I;  1IZN B;  5APT A;  1JY3 N;  2NPS D;  4QMA A;  3CCV P;  2IFM A;  1GU5 A;  1P84 H;  1AFO A;  3L71 G;  3G4S P;  2BEQ D;  1FZB A;  2FYU G;  3HRN A;  4PJ0 H;  1G2C A;  4DZO A;  1NH4 A;  1SFC D;  1SQV K;  1LTG C;  1BGY G;  3SWF A;  3JCU H;  3K5B A;  1QL2 A;  3L37 A;  3R2P A;  2WS3 D;  3VON A;  1SQV D;  3S4R A;  1ZXG A;  2FYN C;  1L0L G;  1FDO A;  5KLI C;  1ZOY C;  1NKN A;  2H7H A;  1N7S B;  1IK7 A;  4W7Z A;  3CCR P;  3H1I D;  3HE4 A;  2QE7 H;  3FX0 A;  1L0N G;  3P4Q C;  1AVO A;  1DH3 A;  2E75 C;  4I6M C;  5BU5 A;  4PV1 C;  4TLF A;  1YYC A;  4ASW A;  1BSN A;  3WUT A;  3AE4 C;  2KK7 A;  4DJG A;  2KB7 P;  3EFG A;  4DDG A;  4UB6 H;  5AVQ B;  2IZ1 A;  3V2P A;  3HD7 B;  2OYI B;  2KNC A;  2D2C B;  3AEC C;  2J59 M;  4Y28 J;  1NJI Q;  3H1J E;  3L74 D;  3PLN A;  3O6Q A;  2P2U A;  3NMD A;  1PP9 G;  3L35 A;  3AE2 C;  1S2E A;  1NVO A;  2HFE D;  1RQU A;  1SQV J;  1Y47 A;  1PGO A;  2ZXE B;  3FWL A;  1EZV I;  2WDQ D;  1USE A;  3RL0 g;  3RK3 C;  1KTM A;  1M1K Q;  2KYV A;  4K35 A;  1ZOY D;  2YO2 A;  1GK6 A;  4YSZ C;  5KLV E;  3H1I J;  1J1D C;  2WQY D;  1Y9B A;  5CCG D;  3NFQ A;  2NRG A;  2ZT9 D;  2WSC J;  4RKU J;  1S1C X;  3AE6 D;  1P84 I;  1JTH A;  2RN0 A;  2QJY C;  4N78 D;  5B5E E;  4GIF A;  3AE7 D;  3AE4 D;  4D6T D;  2W6J H;  1M1J A;  2E76 C;  1VQ8 P;  2AXC A;  2O1J A;  4H13 B;  1GD2 E;  3E1R A;  2OTL P;  3WUU A;  1JY3 P;  3D6Z A;  3AEE C;  1FJK A;  1MV8 A;  2WSE H;  1NEN D;  3L74 J;  1FDM A;  1SQX E;  2AEM A;  3BCC G;  4RO0 A;  1EDI A;  3B71 A;  4WBA A;  3AE2 D;  3FWN A;  2XDJ A;  2QA4 P;  1PGP A;  4YSX D;  3CXH D;  3G3Z A;  3MHV A;  3HUS B;  1KB9 D;  3VMA A;  3RK3 D;  1ZW0 A;  4NPF X;  3H1K J;  1VQN P;  1EDJ A;  1S3J A;  2WZ7 A;  1NTZ J;  3A0B H;  1JY2 O;  1IO4 A;  4YSY C;  3H1J G;  3B5N C;  3HD7 A;  3CCS P;  3VOP A;  2N1T B;  5CCH A;  3H32 B;  5TIS E;  1IFD A;  3IFM A;  3L72 E;  4ZNC A;  4JYC A;  4AUW A;  3VR8 D;  2BS4 C;  3M06 A;  1FE6 A;  3P4P D;  2B9B A;  2JP3 A;  4YTN C;  2QIW A;  4JYB A;  4OVN F;  2KUB A;  4WVZ A;  2K88 A;  4WY4 D;  1IFJ A;  1E5W A;  1AQ5 A;  4EOT A;  1YJ9 P;  1KYO E;  2QJK B;  3C1L A;  4XA4 A;  2J58 A;  1L0V C;  5AVV B;  4HH2 A;  1PPJ G;  1KV4 A;  1ZME C;  1HJ0 A;  5GTH H;  4BRY B;  4YT0 D;  1N7S D;  2QG4 A;  2WVR A;  2QRX A;  1NU1 J;  4YSY D;  4BWN A;  3CXH H;  3B5N D;  2RMZ A;  3L36 A;  1SQX G;  2IZ0 A;  1NO4 A;  2R5B A;  2FYU D;  3H1L G;  2FBW D;  1M7L A;  2AEJ A;  3TGU E;  2LR2 A;  1HBW A;  1RF0 A;  1ZV8 A;  1Q90 D;  2A45 G;  2HOD A;  2OGU A;  4C46 A;  1SQB E;  1SS1 A;  3F5H A;  1Q2N A;  1BCC E;  2D2C D;  3HUS A;  1LT9 B;  1NAY A;  2FXM A;  4YTN D;  2YMK A;  2KP8 A;  2Y9Z A;  3RK2 B;  5APU A;  3A0H E;  2A06 G;  1JY2 N;  3GG2 A;  3L72 G;  3AEF C;  1L0V D;  4O9B A;  2WIT A;  2POH A;  1OWA A;  2IBZ D;  4IFD K;  2W6A A;  1LNQ A;  1QLE D;  3P8C D;  5AW0 B;  2B89 A;  1R8E A;  1KQL A;  1NYH A;  1L4A C;  1NTK D;  2P1J A;  2FYU J;  4Z1M H;  4U3F G;  1S9K E;  3SWK A;  3KZI E;  3MUD A;  4I7Z C;  2GUS A;  3HTK B;  4EIJ A;  3M9H A;  2JKV A;  3KQG A;  1PV3 A;  2FFD B;  4H13 D;  1FS0 E;  2OYH B;  2NPS B;  4IFM A;  1E7P C;  1YQ3 C;  2E74 B;  3G6E P;  1BE3 E;  4BRY A;  2IYO A;  1L0L J;  5APS A;  1URQ B;  1TFF A;  1RY3 A;  3GMA A;  1X9V A;  3GF7 A;  1SFC B;  3MTU E;  3R4Y A;  3CCL P;  3JC2 2;  3BRV B;  1DEE G;  2JR8 A;  4KX6 D;  4H0L C;  1BCC G;  3CXH I;  1KB9 I;  1X8Y A;  4JF7 A;  3Q5P A;  1LTJ A;  1L4A D;  1FBM A;  1KOR A;  1NTK J;  3WUV A;  3L75 E;  2IFN A;  4L73 A;  1NU1 E;  1WT6 A;  1RH5 B;  1RF1 B;  1N2D C;  1SP4 A;  2N1T D;  2KOG A;  1OX3 A;  2PGD A;  2M5A B;  1Y8A A;  4YTM D;  1K05 A;  3U1A A;  1H88 A;  4JBZ A;  3UIA A;  3IAO A;  3HE5 A;  2Q5U A;  3Q5R A;  2JJL A;  4JPZ B;  3AEG D;  1J1E C;  1IJD B;  1KF6 D;  1ZLL A;  3KPE A;  1D7M A;  2KSJ A;  4A7P A;  2WDR D;  3QH9 A;  1KIL E;  3VMY A;  1SQQ G;  1PGQ A;  2O01 N;  1ZP0 C;  2GA1 A;  3USS A;  3H1J D;  2V4H A;  3ABV C;  1YJW P;  1L2P A;  3WU2 E;  4EYY Q;  2PP6 A;  5DJT B;  1YBK A;  3BVH A;  1BE3 G;  4L75 A;  3D70 A;  3VN0 A;  1T2K C;  1G1J A;  3L71 E;  2QM7 A;  2NPS A;  5AW3 B;  2H89 C;  2WU2 C;  2PAJ A;  4YXD D;  2FYN B;  1YTZ T;  3GHG C;  5KJ7 D;  5KLV D;  2OTK E;  4C7N B;  1GW4 A;  5KLI B;  3H6P A;  2MJZ A;  4DOJ A;  1FZA A;  1RE3 A;  1NGM B;  1BGY E;  2BCC E;  4I2L C;  4ZKP A;  1W2E A;  4PV1 B;  2UWJ E;  1SFC A;  1Q82 Q;  2RH0 A;  4IL6 E;  5C2T C;  1QEX A;  3V4Q A;  2WT7 B;  2ZAE B;  3CLQ A;  5DJU B;  1HH0 A;  1EDL A;  3RK2 D;  4LC1 A;  1N8R Q;  2WDV D;  1JB0 J;  1A02 J;  3V5B A;  2PFX A;  3VRB D;  3H1J J;  3ABV D;  1LP1 B;  2JDI H;  1LWU B;  1FDI A;  1XTG B;  1L0N E;  1GZL A;  2R44 A;  1N73 A;  2N9B A;  3P8M C;  1H0T B;  3AE8 D;  5K5G B;  1YHQ P;  2H89 D;  2R3C A;  3FXD A;  1Q86 Q;  3RK3 B;  3TSI A;  3V6I A;  5KLV J;  3VRA C;  1KC8 Q;  3FGA D;  3SFD D;  1T6A A;  1HF9 A;  1J1D B;  3NXS A;  2I8D A;  2ZFY A;  1X0T A;  2HPC B;  5CBN A;  1WMK A;  3VMZ A;  1KFY D;  3Q3D A;  2Q6Q A;  5C2T D;  4W80 A;  1PP9 E;  2E74 D;  3CD6 P;  1JEK A;  2E76 B;  3AE5 D;  4GKG A;  4R4M A;  2M8R A;  2FXO A;  3IF4 A;  1URQ D;  5B5E H;  3CIR C;  1EDK A;  1GL2 A;  5AVU B;  2BCC G;  1SQX J;  4C7N A;  4HYT B;  1KYO D;  4WY4 B;  2XKM A;  4OGQ C;  3PH0 A;  1GMJ A;  5CCG A;  2M0B A;  4B86 A;  1VQ7 P;  5GTI H;  1FZE A;  2L91 A;  1PL5 A;  1FAV A;  1SQB K;  1OVR A;  1FOS E;  3AEB C;  4U7J A;  5AW4 B;  3B5N B;  2GM4 A;  3TGU D;  4HB1 A;  1MKM A;  3L72 J;  3L73 G;  3BCC E;  4L74 A;  1LP1 A;  3KDP B;  1LWU A;  1NTM G;  2R3S A;  1DX7 A;  1VQK P;  1GDT A;  2QM8 A;  1FZC A;  4I6L A;  1SQB D;  3N4X A;  3F89 A;  3V2R A;  3CMA P;  5TIS H;  3O8Z A;  2Q9I A;  5AW1 B;  3CX5 E;  2P67 A;  3AE9 C;  2KSE A;  3TNU B;  1NTZ K;  2E5Y A;  2HPC A;  1K8A Q;  2YKQ A;  1SVF A;  2K37 A;  4IL6 X;  4DDI A;  3H1H G;  3C9I A;  1AVY A;  1KMI Z;  3AE1 C;  1KYO H;  3H1K D;  4CPG A;  2IX7 C;  2ZYD A;  1OW6 A;  3N7N A;  1NTZ D;  3SSU A;  5H2F E;  3P4Q D;  2HLO A;  2ZYG A;  1S9K D;  2HR3 A;  3TGU J;  2E75 D;  4YTP C;  4PV1 D;  3P4R C;  4WY4 A;  4IOI H;  3P4S C;  1SQB J;  1BCC J;  1PPJ E;  2WSC H;  1AV1 A;  1ZRT E;  3AEC D;  1KIL C;  4PJ0 E;  2IYP A;  3AE9 D;  2OYO A;  1N7S A;  1U7M A;  3H1L E;  3I56 P;  1NU1 K;  4KJM A;  2KZI A;  1R5L A;  1K9M Q;  1T3U A;  1SQP G;  2ZVO B;  3I55 P;  4YSZ D;  2A45 I;  3CI9 A;  3L75 D;  1M1J C;  4WWI A;  1L4A B;  1NU1 D;  1OZH A;  2OYI A;  3GLM A;  3M0D A;  2W27 A;  5C39 A;  2K9J B;  2ZVN B;  1VF5 C;  3A2A A;  4I7Z B;  2A06 E;  3P4S D;  2E76 D;  1BDD A;  3OAK A;  3TNU A;  2W83 C;  1YQ4 C;  2C0X A;  1M56 D;  5KTB A;  1BE3 J;  1WRG A;  1GU4 A;  1KIL D;  2JEE A;  1W2B O;  3V4W A;  2QSI A;  3AEE D;  1FJP A;  2DW3 A;  1YI2 P;  3A7O A;  4U3F E;  3L70 G;  4DHJ A;  5AW9 B;  1ZR4 A;  3HD7 C;  1KYO I;  1EQ7 A;  4UB8 H;  3SFE C;  2FYU K;  1CI6 B;  4H0L B;  5CCH C;  1VQP P;  5CMZ A;  1JCD A;  3E1I A;  1KFN A;  1RE4 A;  3L75 J;  2ACZ C;  3L71 D;  4K3A A;  3TYY A;  5TJH A;  4C7R A;  4H44 C;  3M9Q A;  1KB9 H;  4GDO A;  4RJT A;  1GK4 A;  5AVZ B;  1EC5 A;  2Q3I A;  1BGY D;  2FXP A;  3IN6 A;  2E43 A;  1L0L K;  2NZ2 A;  1J1E B;  1YQ4 D;  1VQ9 P;  1VQ4 P;  2B76 C;  1VPC A;  3PHL A;  1L0N K;  2LKM A;  2LXB A;  3W68 A;  5AVY B;  2RKL A;  3VR9 C;  1EXI A;  1L0L D;  5E79 H;  1L4A A;  2KI7 B;  1NTK K;  2R32 A;  2VRS A;  1L0N D;  1NEK C;  2K9J A;  3V2N A;  2N1T A;  3M0A A;  3H32 A;  1RF0 C;  1CZQ A;  3LW5 J;  3KXD A;  1OFC X;  3L71 J;  4FJV A;  2ZXX A;  1M8O B;  1LJ2 A;  3KHU A;  1LTB C;  3WU2 H;  5M1B A;  1LT1 A;  3GHG B;  1SQQ E;  3S9O A;  1U7J A;  1T3J A;  1BGY J;  3LW5 H;  2BCC J;  4NPE A;  4YPC A;  1OMI A;  2CK3 H;  4GOD A;  4RES B;  1CSB A;  1PP9 D;  1FU1 A;  2W90 A;  2JWA A;  2KS1 B;  4XFJ A;  2KIK A;  3E7K A;  5AW5 B;  1CI6 A;  1DEB A;  4N3Y B;  1M90 Q;  1SQV G;  1OW8 A;  4IL6 H;  3AEF D;  3CL3 D;  1T8Z A;  1L0N J;  4OWF A;  3T97 B;  5KJ7 A;  3WMM 0;  5AW8 B;  3H1I G;  1OW7 A;  3MUD C;  1NAF A;  2YXQ B;  3RBX A;  2AXT E;  2YKP A;  3LIE A;  1LT9 A;  2IDB A;  1VQM P;  1NKZ B;  3BCC D;  3MD0 A;  1PP9 J;  1VQ6 P;  2H43 A;  2YO3 A;  1YQ3 D;  2OTJ P;  3C8V A;  3BAT A;  2V7Q J;  4R4L A;  1KZU B;  3CCE P;  1VDF A;  1LTJ C;  3NTN A;  3CX5 D;  2Q3E A;  5BU8 B;  5KAF E;  3H25 A;  1JMM A;  1OXZ A;  2V7Q H;  5KLV K;  4H0L D;  2WSF J;  3HTK A;  5AW2 B;  5AVW B;  2FFD A;  1JY3 O;  2OYH A;  1JY2 P;  3U1C A;  1NWQ A;  2ITA A;  4D6T G;  2WSF H;  3S1K A;  2W6B A;  3PP5 A;  1VL2 A;  3PRJ A;  1URQ A;  1H8A A;  3BCC J;  3CWB E;  1HGV A;  2E75 B;  1SQX K;  1MZ9 A;  2XZR A;  1PPJ D;  1RHZ B;  1ZRT D;  2CPB A;  1S5L E;  1KD1 Q;  3CC2 P;  2WU5 C;  2W8Z A;  1ZP0 D;  2NPS C;  3CPW O;  1RF1 A;  1SQX D;  2Z4E A;  3AEA C;  3H1L D;  1LTA C;  4GOF A;  4KHX A;  2M5A A;  3GW6 A;  3HE4 B;  1KQS O;  1X22 A;  1UIX A;  3MIW A;  3L73 E;  1NTM E;  3CX5 H;  3EWK A;  1T2K D;  3OJA B;  1SFC C;  2WU2 D;  3RBZ A;  1KN7 A;  2FKW B;  1TU3 F;  2KZJ A;  2IBZ E;  1HWT C;  2QJP C;  3IR9 A;  2C0W A;  1A02 F;  2WS3 C;  2KNC B;  2QJY B;  2A06 D;  3L72 D;  5H2F H;  4PD4 E;  5APX A;  1PIX A;  3U59 A;  1QVF O;  1N73 C;  1HVV A;  2I1J A;  2WU5 D;  3H1H E;  1PGJ A;  3D71 A;  1KIL B;  2G8Y A;  3MP7 B;  3AEA D;  2ZJS E;  3H1L J;  3CWB G;  2IPP A;  4U3F D;  4MN4 C;  5C3J C;  4M3L A;  3A3Y B;  1QX8 A;  5AVX B;  1JTH B;  1VQL P;  3VRA D;  1E79 H;  1HUC A;  5B66 E;  2B88 A;  2WT7 A;  1M1J B;  3CC4 P;  2Q7C A;  1W5C E;  1OIP A;  2A45 H;  2YIU C;  3JSV C;  1GL2 C;  2Y0D A;  2LXC B;  2PRR A;  4LDT A;  1OVU A;  2WDQ C;  3RL0 C;  1VF5 B;  4Y99 C;  1R5S A;  1M57 D;  1N7L A;  4DHZ A;  4AYC A;  5L8R J;  3BRT B;  2C9N Y;  2WQY C;  1BCC D;  5CCG C;  1SQP E;  3CIR D;  4OH8 B;  2ZT9 C;  2IBZ G;  1H0T A;  1FZF A;  3II6 A;  3AE6 C;  3G71 P;  2P58 A;  3AE7 C;  3GF3 A;  4U3F J;  1PZQ A;  3ITK A;  3CX5 I;  4OGQ D;  1ZR2 A;  5C3J D;  1NTK G;  5EFW B;  3G9R A;  2KLU A;  2WPV B;  3VYI A;  5KAI E;  1SQQ K;  2K1A A;  1JOC A;  5KKZ C;  2WPS A;  5CBO A;  2O01 J;  1LWU C;  2P10 A;  2WPR A;  5APQ A;  4HKZ H;  1NEN C;  4GT1 A;  4EI2 A;  1S5L X;  1FZC C;  3TF5 A;  4YXW H;  4H44 B;  1QLB C;  3AEB D;  3VP9 A;  1BSH A;  4YSX C;  1EZV E;  1SQQ D;  1MFT A;  3VTP C;  1GL2 D;  3MZW B;  1JO5 A;  1KIL A;  1VQ5 P;  2H88 C;  3RL0 D;  2O01 H;  3P32 A;  3L70 E;  2Q1K A;  2FY8 A;  3I5C A;  1P84 E;  2KLV A;  1GW3 A;  2YKO A;  2B87 B;  1JMB A;  1G1I A;  1BE3 D;  1X79 B;  1S72 P;  2WSE J;  1FZG A;  1HJB A;  3VR8 C;  4JQ0 D;  4N6J A;  3JCU E;  3FXE A;  3B5N A;  5APV A;  3P4P C;  5AW7 B;  1KQG B;  3A0H H;  1LGH B;  3AE1 D;  1DD3 A;  2M3E A;  2AEF A;  1Z56 A;  1N86 A;  1NHL A;  4WY4 C;  2HOD B;  1CW5 A;  5GTI E;  5CJ0 A;  3Q1M A;  1SQQ J;  2QVA A;  4YTP D;  1FC2 C;  1MUU A;  2YXR B;  2H88 D;  3P4R D;  4YT0 C;  1N7S C;  2BS3 C;  1H89 A;  4ZKU A;  1DD4 A;  4UB6 E;  3B4S A;  2K9Y A;  3KZI H;  4NPD A;  2FBW C;  1EZV G;  2Y0E A;  4D6T J;  1YIT P;  3MGN A;  2Y0C A;  5AVR B;  1IC2 A;  1QVG O;  1IFI A;  5KLV G;  2OYI C;  2D2C C;  3M0D C;  4GOE A;  2WPQ A;  2GUV A;  2KXP B;  2MKV A;  2B87 A;  1K73 Q;  3P7K A;  2E5T A;  1VF5 D;  1SQV E;  2BCC D;  3CWB D;  1JCC A;  2AXT H;  1BDC A;  1RQV A;  1IFN A;  1QGK B;  2O1K A;  2OQQ A;  3H1I E;  4TT3 H;  2ZYA A;  3Q2Y A;  1YIJ P;  5CHX A;  3TK1 A;  2BS2 C;  1NTM K;  1RE4 C;  4LGD E;  3Q5S A;  1GTW A;  1YTZ I;  1LTJ B;  4H13 C;  5AW6 B;  1EXJ A;  3HD7 D;  3SFE D;  3PTZ A;  4DT0 A;  1OVV A;  3CME P;  3VMX A;  2Z5I A;  2O3J A;  5CCH D;  1NOH A;  3L73 D;  1NTM D;  2ACZ D;  2YMY A;  2I1K A;  3CCQ P;  4H44 D;  5KAF H;  3HE5 B;  2JO1 A;  2WSS H;  3L74 E;  2BAS A;  3LID A;  3A0B E;  4WB4 A;  3HUS C;  1PFI A;  2JWD A;  4KX6 C;  4ASV A;  3CWB J;  2P7J A;  2G3A A;  3H1K E;  1LTS C;  1NTZ E;  2B76 D;  3PJS K;  4PD4 D;  4ZMD A;  2Y9Y A;  2N1T C;  3AED C;  3VR9 D;  3H1H D;  4N78 E;  2J5U A;  2M3B A;  4YTM C;  4D6T E;  1HGZ A;  3AEG C;  3W67 A;  3BAS A;  1KF6 C;  1NEK D;  1HTL C;  1JM0 A;  1S5L H;  2WDR C;  3L73 J;  4UB8 E;  1NTM J;  3TGU G;  5GTH E;  2QJK C;  1S4X A;  2ZFC A;  2HYN A;  3CXH E;  3KYQ A;  4DHI B;  1SQB G;  1KB9 E;  2K3R A;  1AA0 A;  3M91 A;  3RK3 E;  1SQP K;  2QJP B;  2WP9 C;  2XU6 A;  3AE3 C;  1QL1 A;  2R5D A;  1JNM A;  4EDF A;  1JUN A;  2N9Y B;  1USD A;  4YXD C;  3M9B A;  5KJ7 C;  5APW A;  3L74 G;  3V2Q A;  3VP8 A;  3AED D;  4W7Y A;  1SQP D;  3H1H J;  1N73 B;  1LTI C;  3CCJ P;  3OA7 A;  5CJ4 A;  1IFM A;  3D6Y A;  5E79 E;  1KFM A;  4PD4 H;  2Z5H A;  3H1K G;  3GHG A;  1LT9 C;  4DCK A;  1NTZ G;  4OGQ B;  3EFF K;  2QEX P;  3RK2 C;  2WDV C;  1LTT C;  1UII A;  2HG5 D;  3QWO C;  3EQ2 A;  4HJG H;  3VRB C;  3ZDM A;  4IFF A;  2KS1 A;  1MFZ A;  3B8E B;  2H8P D;  1EZV D;  2WP9 D;  1KQF B;  3AE3 D;  2XNX A;  1AQT A;  1YJN P;  2YIU B;  2XV5 A;  3SWY A;  1GL2 B;  3AE8 C;  1G2C B;  5B66 H;  3L70 D;  4I1L A;  2WMM A;  3RL0 B;  4Y99 B;  3T97 A;  2FYZ A;  2FYU E;  1P84 D;  4XE5 B;  1SQP J;  3CC7 P;  3RGU A;  3SFD C;  4KT0 J;  2L5G B;  2C9L Y;  1SLQ A;  3CCM P;  5APY A;  2BEZ F;  2ZT9 B;  2FFD C;  2YNY A;  3OW2 O;  2OYH C;  1KFY C;  4LLH A;  1FOS F;  1K04 A;  3L75 G;  2XND H;  2E74 C;  2E42 A;  1IK9 A;  1NU1 G;  3AE5 C;  3CCU P;  1RE3 C;  5BVZ A;  1URQ C;  1XTC C;  1L0L E;  5AVT B;  1J2J B;  5AVS B;  5KKZ B;  4AQR D;  4BXL A;  1FZC B; 
#chains in the Genus database with same CATH homology
 3AE4 C;  1S5L X;  2ACZ C;  1ZRT E;  4H44 B;  3D6Y A;  1QLB C;  3D71 A;  3Q5P A;  3AEB D;  4H44 C;  1U57 A;  1KOR A;  2D2C D;  4YSX C;  3AEC D;  2G8Y A;  4KX6 C;  2WDV D;  1PL5 A;  1OW8 A;  3AEA D;  4YTN D;  5C2T C;  1JB0 J;  1VL2 A;  4GDO A;  1DIP A;  3AEF D;  2G3A A;  2YMK A;  2H88 C;  3AE9 D;  4OGQ B;  1AJY A;  2D2C B;  3AEB C;  3VRB D;  4U7J A;  2D2C C;  4YSY C;  3AEC C;  5C3J C;  3ABV D;  4Y28 J;  3T97 B;  2FXP A;  2E75 B;  2WDV C;  3IN6 A;  1FDI A;  2B76 D;  1MKM A;  4YTM D;  1K05 A;  1OW7 A;  3AEF C;  1L0V D;  2NZ2 A;  3IAO A;  3VRB C;  3Q5R A;  3O6Q A;  1YQ4 D;  3AED C;  3AEG D;  3VR9 D;  3VRA D;  1KF6 D;  3AE2 C;  2J5U A;  2B76 C;  2MKV A;  4YTM C;  3AE8 D;  3VR8 D;  1RQU A;  4YSZ D;  2BS4 C;  2WP9 D;  2WU5 C;  2H89 D;  2WDR D;  1KQF B;  3AE3 D;  2WDQ D;  1KIL E;  3RL0 g;  1R8E A;  3AEG C;  1KTM A;  2WSE J;  3VR9 C;  3VRA C;  3P4P D;  1NYH A;  1VF5 D;  1KF6 C;  1EXI A;  1NEK D;  1ZP0 D;  3FGA D;  2BEQ D;  2YIU C;  1ZOY D;  3AE8 C;  3VR8 C;  3SFD D;  4YSZ C;  3GLM A;  2IDB A;  1HF9 A;  2JP3 A;  3AEA C;  4YTN C;  2QIW A;  2WDR C;  2WQY D;  1Y9B A;  4Z1M H;  2WDQ C;  3AE9 C;  1VF5 B;  1RQV A;  3P4P C;  1ZP0 C;  1VF5 C;  2ZT9 D;  2WSC J;  2OQQ A;  1NEK C;  4I7Z B;  4RKU J;  3ABV C;  1UIX A;  1WMK A;  1S1C X;  1KQG B;  4I7Z C;  4TT3 H;  3AE6 D;  1KFY D;  3SFD C;  3P4S D;  2E76 D;  2QJY C;  3Q3D A;  2QJK C;  3EWK A;  5L8R J;  1DD3 A;  4KT0 J;  1YQ3 D;  2WQY C;  3AE1 D;  5C2T D;  1L0V C;  3LW5 J;  1PV3 A;  2BEZ F;  3AE7 D;  4H13 D;  3AE4 D;  2ZT9 B;  3C8V A;  2E74 D;  3Q2Y A;  4IL6 X;  2WU2 D;  3CIR D;  2ZT9 C;  1YQ4 C;  2V7Q J;  4R4L A;  3Q1M A;  2E76 B;  3AE6 C;  2BS2 C;  1TU3 F;  1ZME C;  1KFY C;  2WS3 D;  3AE5 D;  2E76 C;  4R4M A;  1KMI Z;  1E7P C;  1HJ0 A;  3AE1 C;  3Q5S A;  3D70 A;  1YQ3 C;  4YT0 D;  4H13 B;  2QSI A;  3RK3 E;  4YTP D;  1OW6 A;  3AEE D;  2E74 B;  3AE7 C;  3GF3 A;  4H13 C;  5M1B A;  1K04 A;  2WP9 C;  2E74 C;  2H89 C;  3CIR C;  2H88 D;  3AE3 C;  2QJP C;  2WU2 C;  3S9O A;  4YXD D;  3P4R D;  1EXJ A;  4OGQ D;  3P4Q D;  2FYN C;  4YSY D;  5C3J D;  3AE5 C;  3SFE D;  2WS3 C;  1FDO A;  3D6Z A;  5KLI C;  1ZOY C;  3H25 A;  4YT0 C;  1IK7 A;  2E75 D;  4YTP C;  4PV1 D;  3AEE C;  2FBW D;  3G9R A;  2WPV B;  4H0L D;  3GMA A;  4YXD C;  1NGM B;  1OMI A;  1NEN D;  2WSF J;  3GF7 A;  2BS3 C;  3P4R C;  4OGQ C;  2ACZ D;  3P4Q C;  3R4Y A;  1GMJ A;  3SFE C;  3AED D;  5KKZ C;  1DD4 A;  3B71 A;  4H44 D;  1PIX A;  4PV1 B;  3AE2 D;  4YSX D;  2O01 J;  1Q90 D;  2E75 C;  2JO1 A;  2K9Y A;  4H0L B;  2P10 A;  4PV1 C;  3P4S C;  2FBW C;  4KX6 D;  4H0L C;  4XFJ A;  1NEN C;  2WU5 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...