1ZOYC

Crystal structure of mitochondrial respiratory complex ii from porcine heart at 2.4 angstroms
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAD-binding protein
publication title Crystal Structure of Mitochondrial Respiratory Membrane Protein Complex II
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 50
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2005-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1zoyC01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 1zoyC02
3AE8D 2WS3C 3SFDD 3AEED 2WP9D 3AE1C 2B76D 2WDVD 1NENC 2BS3C 1PV3A 2WU5C 3AE3D 3P4SD 3AE2C 4YXDC 2G3AA 1K04A 1E7PC 3VRBC 3P4PC 2H88D 3AE4C 2WQYC 1KF6D 3AEGC 2WU2C 3SFEC 2H89C 3AE5C 1YQ3D 4KX6C 3AEAC 3AE8C 3SFDC 3AEEC 5C3JD 1YQ4D 2WP9C 4YSYC 1NEKD 3AECD 4YSXD 3AE9D 2B76C 2WDVC 1L0VD 1QLBC 3ABVC 1KTMA 3AE3C 2BS4C 3P4SC 4YTMC 1OW7A 3AEFD 3AEDD 2FBWD 2BS2C 2H88C 1KF6C 3AE6D 3VRAC 2WDQD 3AEBD 3CIRD 4YTND 5C2TD 1ZOYD 2WDRD 3P4QD 4YT0D 1NEND 5C3JC 1OW6A 1YQ4C 1K05A 4YTPD 1NEKC 2WU5D 3AECC 4YSXC 3VR9D 4YXDD 3VR8D 1L0VC 3AE7D 4YSZD 3VRBD 2ACZD 3P4RD 3AEFC 3AEDC 2FBWC 3B71A 1ZP0D 1KFYD 3AE6C 3AEAD 1YQ3C 2WDQC 3AEBC 3CIRC 4YTNC 5C2TC 2WS3D 1ZOYC 2WDRC 4YSYD 3P4QC 4YT0C 1OW8A 3AE1D 3ABVD 4YTPC 3VR9C 3AE9C 4YTMD 3AE2D 3VR8C 3AE7C 3S9OA 4YSZC 2ACZC 3P4PD 3AE4D 2WQYD 3P4RC 3AEGD 2WU2D 3VRAD 1ZP0C 3SFED 2H89D 3AE5D 1KFYC 4KX6D
chains in the Genus database with same CATH superfamily
2Q1KA 1SQPK 2HPCA 2KI7B 3WMM0 3BVHA 2E43A 2D2CC 4ZMDA 1L0LE 2E74D 2K88A 1RF0C 2IDBA 3V2PA 4ZKUA 4GOEA 2RKLA 2VRSA 1T2KD 3AE8C 1SQVD 4WY4A 4YXWH 1RE4A 3H1KJ 1HH0A 1JB0J 5B66H 1KTMA 1SQQK 5AVVB 3A0BH 3OW2O 4DHIB 4RJTA 1RF1C 1IJDB 2IBZG 1ZOYD 1R8EA 1RF0A 3B4SA 1OW6A 1J1DC 2K9YA 1L0VC 1GU5A 3AEFC 2QIWA 2Y0DA 1GW3A 2YIUC 3MZWB 2JP3A 3M0DC 3AEBC 1MZ9A 2ZJSE 3CMAP 1SQVG 1RF1A 4C7NB 2J5UA 4LC1A 1FDOA 3UIAA 2NPSD 3G3ZA 2HFED 3SFED 3G9RA 1L0NE 3CCSP 3L71J 5E79E 2WP9D 3M0DA 1LNQA 3AE3D 1KD1Q 1KFMA 1URQB 1FDIA 1JCCA 1JTHA 1ZV8A 3P4PC 1S3JA 1GL2D 2OTJP 2WT7A 2E76B 4H13D 3Q5RA 1ZRTE 5AW2B 4GOFA 2KIKA 3TDKA 3M91A 2BCCE 1XTGB 2FXPA 4U3FD 3CLQA 3CWBE 1MV8A 3Q3DA 1Y47A 2FYUD 1EQ7A 4YTMC 2QJPB 4PD4H 3RK3C 5AVYB 4PV1B 1S9KE 1JY2N 5CJ4A 2IYOA 3NMDA 3VP9A 1NEND 2C9NY 2XNDH 4YSXC 1KB9H 3USSA 3T97A 3MGNA 1CZQA 3WUUA 3H6PA 2P7JA 4U3FJ 2AXCA 3N4XA 1EXIA 1JY3P 2M5AA 2C0WA 4ZKPA 3BCCD 1X8YA 3H1JG 2FYUG 1SS1A 5B66E 3CX5D 3TNUB 3VRAD 2KS1A 1JY3O 3A0BE 1NTKJ 1BE3E 1EDKA 4DHZA 1FAVA 1BCCD 3FXEA 1AQ5A 1NTZJ 1MUUA 1YHQP 1KN7A 4KT0J 1SFCD 5APTA 2WQYC 3Q1MA 4L76A 2W6AA 4H44D 1N7SB 2Q7CA 3VN0A 3L73G 3CC7P 5KLVE 4AQRD 4QMAA 4NPDA 4EIJA 1FZFA 1DH3A 2R5DA 3BCCG 2PGDA 5APQA 1SQVK 3JCUH 2Q9IA 1BCCJ 1ZN5A 3MD0A 2V4HA 1KYOI 4YTND 1H0TA 3P8CE 1S72P 3L75J 4JQ0D 2RMZA 1PGPA 3B71A 1SP4A 3O6QB 2OYIB 4L73A 3AE6C 1N73B 4DHJA 2Q5UA 3TSIA 3V4WA 3OJAB 1N2DC 2P58A 4YT0C 3H1LE 2CPSA 3CCLP 2B89A 2IYPA 4DT0A 2FYNB 1M56D 4PD4E 1T3UA 1LTSC 3L73E 4BWNA 3AEED 1QL2A 1YJ9P 3EWKA 1ZMEC 1EDIA 1U7JA 3KXDA 2WITA 4UB8H 3GF3A 1LTGC 3KHUA 2JWDA 3SWYA 1KB9E 1SQPD 3AE4C 1KF6D 1ZXGA 3L4FA 3CPWO 1KYOD 1NAYA 2MJZA 1SQBE 2FFDC 3CC4P 2XDJA 1PP9G 2YMYA 1FJPA 2LKMA 1OW7A 1P84H 4R4MA 4HKZH 4FJVA 1KILC 1JMMA 1DIPA 2KK7A 3L36A 1SQXD 2O01N 2V7QH 2J59M 2FYUK 4JBZA 2NPSB 2P67A 1R5SA 1J1EC 2K9JB 2AXTH 3P4QD 1K8AQ 4GDOA 5C3JC 1SQPJ 2HR3A 1NEKC 2B9BA 2FFDA 2H7HA 1G1IA 1M1JC 1LT1A 1Z56A 2FBWC 1OZHA 2ZAEB 2FKWB 3CCMP 2Z5IA 3CMEP 3L74G 4D6TJ 1K73Q 3VMAA 1KILA 4H0LD 1GL2B 1OWAA 2L5GB 2OARA 2QEXP 4H13B 4K35A 3RK2C 3AE1D 2E5YA 3AE9C 3H1HD 4YTMD 1G2CB 3A2AA 2Q3IA 3RK3D 2W6JH 4EYYQ 1ZR2A 3P4RC 2A06E 1IZNB 5AVXB 1SQQJ 1SQXG 1M1JA 3JCUE 1W2BO 1HJBA 5KJ7D 1H88A 3BRVB 5AW9B 1PGQA 2YXQB 2HODB 3U1CA 1NVOA 2N1TC 4KHXA 4WB4A 1VQ5P 1L0LD 4N3YB 3D6ZA 3RBXA 2W27A 3H1HJ 1BSHA 1GD2E 2R32A 1LTIC 5KLIB 3P4SC 3H1HG 1CI6B 1VF5C 3L74E 1YITP 2N1TA 3A5TA 2QJKB 1OX3A 3F89A 2W8ZA 3M9HA 5BU5A 2OQQA 3H32A 2OYHB 4YSZD 3EFFK 5H2FH 1PPJE 4UB8E 1L0LG 2IPPA 1SFCB 1FZBA 2E75C 4H44B 3PH0A 3M9BA 1MFZA 3AE2D 3VR8C 1YI2P 2JR8A 3L37A 1P84E 1OXZA 2QA4P 4KX6D 1L0ND 1N8RQ 1LT9B 2CPBA 2IFNA 3I5CA 5CCGD 2AXTE 1VDFA 2L91A 1E7PC 3FWNA 2IFMA 3V4QA 2Y0CA 2C9LY 3FWLA 4B86A 1EC5A 4ASWA 2BCCD 1LWUC 2KNCA 1GTWA 1GZLA 2N9YB 2M3BA 3IR9A 5AVWB 2HYNA 2QM7A 1S9KD 2BEQD 4BRYA 3CIRD 4DCKA 2WDRD 1VQ4P 1L0NG 3B5NB 1LGHB 3GG2A 3MTUE 1SQXK 4YTPD 5CJ0A 3CD6P 3RL0B 2B88A 4BXLA 4W7YA 1LWUA 3R4YA 1OIPA 1X22A 1VQ9P 1FZAA 1ZW0A 1YQ3C 1KMIZ 2I1JA 1VQMP 3TYYA 1OW8A 3KZIH 2O01J 2BCCG 2WVRA 4JF7A 3WUTA 3CWBG 3H1IE 2JWAA 2LR2A 3GMAA 3HE4A 1L2PA 2WU2D 1SQVJ 3LIDA 1W2EA 5DJUB 2WS3C 2IZ1A 3SFDD 5C39A 2B76D 2WDVD 1SLQA 2BS3C 1NWQA 2JDIH 3CCRP 1HF9A 2J58A 5KTBA 5H2FE 4Z1MH 3HTKB 1JMBA 3GHGB 4PD4I 1GK4A 4GIFA 3CCEP 1L0LK 1ZLLA 1BGYE 5KAIH 1YQ4D 2BASA 3AE9D 1NAFA 4H0LB 3ABVC 1YBKA 1ZR4A 1LTJB 1RQVA 3PLNA 2OTKE 3L72E 3CCJP 2POHA 1KB9I 3KQGA 5APSA 5AW4B 2M5AB 1N7LA 1JNMA 3S4RA 1BE3G 2O3JA 1KFNA 3P8CD 1QL1A 3H1JD 1YTZT 3PHLA 3H1KE 2W6BA 1AJYA 1R5LA 4OH8B 3V2QA 4OGQD 1URQC 1D7MA 3H1LD 1NGMB 5KLVG 4C7NA 5BU8B 2QJYC 3AE7C 2E76C 3SSUA 1JM0A 1HGZA 2FY8A 1USEA 3GLMA 3BATA 1KFYC 3L73D 5KKZB 3H1JJ 2FYUJ 4JYBA 4WWIA 2QJPC 1L4AD 1E5WA 3CX5H 2P1JA 4DJGA 4PV1C 3LW5J 1L0NK 1KILE 1URQA 2ZXXA 2H88D 2WSSH 4I1LA 1KB9D 1KORA 3AEGC 2PFXA 3NFQA 3H1LJ 3C8VA 1WT6A 2A45H 1SQBD 1USDA 4AYCA 1TU3F 1YIJP 3L71E 1IFJA 3KZIE 3S1KA 3H1LG 1FDMA 3L73J 3AEDD 5GTHH 2FXMA 3N7NA 1Q86Q 3JSVC 5AVQB 3M0AA 3M06A 1S5LH 2WDQD 3BCCJ 3HD7B 3PRJA 1LP1B 5KAFH 3AECC 3HE5B 2ACZD 2HG5D 1SQBJ 1ZP0D 4WY4D 1IK9A 2WSEJ 4WBAA 5APWA 1T8ZA 5C2TC 2QVAA 1YTZI 2UWJE 3O8ZA 4L75A 1SQBG 1KQGB 3VR9C 1Q81Q 3CC2P 1X79B 2D2CD 5KAIE 1AQTA 5GTIH 1N7SC 2B87A 4I7ZB 3TNUA 2A06D 4O9BA 1X9VA 1EXJA 4NPEA 3CXHI 3MHVA 4U3FE 3AE8D 1LTTC 1PP9D 2YKPA 2E74B 1T3JA 1FBMA 5CCHC 3E1IA 4RKUJ 3PJSK 4DOJA 1KQLA 3G4SP 4IOIH 2H89C 3AE5C 1YQ3D 2WPRA 1N7SA 1P84I 4PJ0H 2Q3EA 2YNYA 1HVVA 3TK1A 1NTKE 3M9QA 1L0VD 4UB6H 2OYIC 1N73C 1H8AA 5AVUB 3AEFD 3CXHH 1NJIQ 1NTZE 1PP9J 5KLVK 3L74D 5CCHA 4Y28J 2A06G 3B8EB 1KQSO 3AEBD 4XE5B 3QWOC 1VQ8P 1T2KC 3FGAD 4DDGA 2FYNC 2LXCB 3CX5E 3CCQP 3OAKA 3ITKA 4EOTA 1Y8AA 2WSFJ 3O6QA 4Y99B 2OYIA 1N73A 1FE6A 1WRGA 1UIIA 2WPQA 1QGKB 4IFFA 5AW6B 1ZOYC 1BCCE 3L74J 3ABVD 1NU1E 1NKZB 4DZOA 3P4PD 2GUVA 3L75E 2ZYGA 3NTNA 1P84D 1NTME 5GTHE 3II6A 5APYA 3FXDA 3CCVP 2Y9YA 1S5LE 1CW5A 1RHZB 1EDJA 1JCDA 1SQXJ 1A02F 1OMIA 5KAFE 3TGUE 3P8MC 3VOPA 1QLED 1IFDA 3RL0g 2G3AA 3SWFA 1Q2NA 2G8YA 2NPSC 2JJLA 1PPJG 3SFEC 4DDIA 2PP6A 1FZCB 4IFDK 2CK3H 4N78E 1JY3N 2WP9C 2Y0EA 4YSXD 5DJTB 3AE3C 3KYQA 4OGQB 1QX8A 4JYCA 1SQBK 4GT1A 1GL2C 1NH4A 2V7QJ 2Z5HA 5GTIE 4H13C 1WMKA 1EZVE 1JOCA 1DEBA 2NPSA 1M8OB 2K9JA 1RE3C 5APVA 3VTPC 2WSCJ 1L4AB 2YMKA 2JO1A 3KDPB 1GK6A 1IO4A 3RBZA 3HUSB 1XTCC 2ZXEB 1GL2A 2E42A 3V6IA 4L74A 4PJ0E 2WMMA 5B5EH 1L0LJ 1KV4A 1G2CA 1RE3A 3PP5A 3R2PA 5BVZA 1GMJA 2KYVA 3H1ID 2WQYD 3V2RA 4UB6E 1JY2P 3P32A 3CXHE 2IBZI 2IZ0A 4XA4A 1CSBA 5KLIC 2HPCB 4D6TE 1EDLA 3VP8A 2ZYDA 3I55P 2HODA 3U1AA 1JY2O 1X0TA 2O1KA 2QJKC 1H89A 1S1CX 4BRYB 3PTZA 1SQQE 2OYHC 1HWTC 2KSJA 4WY4B 2M3EA 1BGYD 1VQ6P 2P2UA 2ZVOB 2SPZA 1QEXA 1W5CE 2XKMA 2QE7H 1N7SD 1Y9BA 2I8DA 1GDTA 2C0XA 1MFTA 1CI6A 1M57D 3L72D 2KSEA 3H1IG 1AFOA 2D2CB 5AVRB 1K9MQ 4NPFX 2RH0A 3AE6D 4IL6H 4H44C 2HLOA 1ZRTD 2YXRB 2KB7P 4OVNF 1JEKA 5AVSB 4YT0D 1PL5A 5EFWB 3RGUA 1J2JB 1A02J 2O01H 5CCHD 1VQLP 3CWBD 4M3LA 2OYHA 3IN6A 1L0NJ 3H1KD 3WU2H 2AEFA 1LT9C 2GA1A 3G6EP 2FXOA 5CMZA 4YTNC 1BDCA 2ZT9C 1SVFA 4GODA 2QSIA 1PIXA 2OGUA 3L72J 1RF1B 1BGYG 2H43A 3S9OA 1DEEG 1VQOP 3P7KA 3AE4D 1J1DB 2YO2A 2BCCJ 4ASVA 2KZIA 2FYZA 3L72G 3L70E 3OA7A 2KUBA 1UIXA 3CWBJ 1QVFO 2MKVA 2WWWA 1LT9A 3C9IA 2YIUB 1IK7A 5AW3B 2N9BA 5M1BA 3F5HA 5L8RJ 1KILD 1JTHB 3V5BA 2WT7B 3H1KG 3B5NC 4C46A 3VYIA 3AEAC 1IFNA 3QH9A 3RL0C 1FS0E 2QM8A 3VONA 5C3JD 3AEEC 1BE3D 1NEKD 1QLBC 3Q5PA 2Y9ZA 5B5EE 3L71D 1PZQA 2FBWD 2BS2C 1MKMA 4HYTB 1KF6C 4LGDE 3FX0A 1DD3A 3RK2D 3B5NA 4K3AA 3SWKA 1Q90D 5KLVD 1HTLC 3T97B 1JO5A 3VMXA 3P4RD 2YO3A 1BE3J 2Q6QA 3U59A 5TISH 5CBNA 3RK3B 1AA0A 1NYHA 1N86A 2I1KA 2QG4A 4AUWA 3P4QC 2WPSA 2DW3A 5APXA 5AW0B 2N1TD 3LW5H 2H8PD 1HGVA 3L71G 5CBOA 2QJYB 2R3SA 3CX5I 3GHGC 4I6MC 1U57A 1S5LX 2KS1B 5KLVJ 2IBZE 1TFFA 3GF7A 2KZJA 4XFJA 5AVTB 4H0LC 2P10A 4EDFA 4IL6E 2WPVB 3IF4A 1LTJC 2PAJA 3AE1C 2KLUA 3P4SD 4YXDC 2NRGA 2A45I 1VF5D 5TJHA 2Z4EA 1JUNA 2AEMA 1HJ0A 3LIEA 3HTKA 1Q7YQ 4PD4D 3WU2E 3GHGA 1FU1A 1SQVE 5KJ7C 1AVOA 1NTKD 4RESB 1LTJA 2XNXA 1M90Q 3EQ2A 1IFMA 1RY3A 1NTZD 1T6AA 2WSEH 2E75D 3K5BA 1H0TB 4U3FG 1VQ7P 3VR8D 5KJ7A 3TF5A 3D6YA 2B87B 1FZEA 1HBWA 5KKZC 2PRRA 2JEEA 2JKVA 2M0BA 2R3CA 1EZVI 4A7PA 2K3RA 1NU1D 3MUDC 1NTKG 4YSZC 1IC2A 3D71A 1PFIA 1DX7A 3CI9A 3L75D 4LLHA 1HUCA 1NTZG 2AEJA 1YYCA 1NTMD 3Q2YA 1YJNP 2XZRA 2YKOA 1FOSE 2BEZF 2OYOA 2W90A 1RH5B 3EFGA 2R44A 3W67A 2ITAA 2WU5C 2K37A 3AE2C 3TGUD 1K04A 3VRBC 2WZ7A 1KZUB 3HD7C 3MUDA 3BRTB 3A0HH 3V2NA 1NU1J 4KX6C 3HRNA 2ZT9D 5TISE 1KQFB 3ZDMA 2XV5A 4YSYC 1VQPP 4N78D 5CCGC 1BCCG 3H1JE 2FYUE 2BS4C 1NTMJ 1NU1G 1QVGO 2A45G 2WSFH 3L75G 3HD7A 1EZVD 1NTMG 3TGUJ 1LP1A 1LTAC 4R4LA 1GU4A 1PGJA 1NHLA 4I7ZC 3CCUP 2FFDB 1LJ2A 3HE5A 1KYOH 5CCGA 3TGUG 3B5ND 1E79H 3AEAD 2E74C 1IFIA 1KILB 3RL0D 3CIRC 2QRXA 3CL3D 2WS3D 2WDRC 4EI2A 4YTPC 3BCCE 1J1EB 2WTYA 1PPJD 2E5TA 3G71P 4I2LC 1GW4A 1M1JB 3CXHD 3MIWA 4W80A 4W7ZA 5AW1B 1EZVG 4D6TD 1PV3A 1AV1A 3NXSA 1Q82Q 2RN0A 3RK2B 3JC22 3MP7B 4C7RA 2WU2C 1LTBC 3VMYA 3A7OA 4ZNCA 1KC8Q 2IX7C 1NKNA 1SQQD 3SFDC 1YJWP 1DD4A 3IAOA 5CHXA 2B76C 2WDVC 4HB1A 2M8RA 4Y99C 2WSCH 1NOHA 2ZFYA 1SQPG 4RO0A 2GM4A 3D70A 1M7LA 3BASA 1NTKK 2N1TB 1OVVA 1AVYA 1URQD 1NTZK 1YQ4C 3I56P 4D6TG 2ZVNB 3H32B 2LXBA 2YKQA 4YXDD 3AE7D 2ZYAA 2E76D 1PGOA 5APUA 2KOGA 3WUVA 4KJMA 2R5BA 1KFYD 3IFMA 1VF5B 1VL2A 2K1AA 2OTLP 1PP9E 1M1KQ 3A0HE 4TLFA 4MN4C 5AW8B 1SQQG 1VPCA 4PV1D 4CPGA 4N6JA 1FZCC 3E7KA 4IL6X 3AEGD 1S4XA 3E1RA 3A3YB 1NU1K 3W68A 4I6LA 3L70D 1S2EA 4LDTA 5AVZB 1FZGA 1IFPA 4OGQC 4TT3H 1NENC 1NTMK 2E75B 2XU6A 4OWFA 1BDDA 1FJKA 3L35A 1SQPE 1OVUA 1KYOE 1VQNP 2NZ2A 3H25A 2ZFCA 1FZCA 4IFMA 2W83C 3Q5SA 1OVRA 1L4AC 2KNCB 3AECD 3KPEA 3C1LA 3L70J 4YPCA 3HUSC 1VQKP 1BSNA 1SQXE 2H88C 2KXPB 4U7JA 4JPZB 3VRAC 1FC2C 5E79H 2KLVA 5C2TD 3L70G 3VMZA 5AW5B 5K5GB 3H1IJ 1K05A 4WVZA 2WU5D 3VR9D 2O1JA 1U7MA 3VRBD 1LWUB 1L4AA 3HD7D 3AEDC 1SFCC 4HJGH 3GW6A 4GKGA 2GUSA 3HUSA 2WDQC 2KP8A 4YSYD 1NO4A 3H1HE 2ZT9B 1OFCX 3RK3E 2ACZC 4HH2A 1RQUA 1FOSF 3HE4B 1ZP0C 5AW7B 2H89D 3AE5D 1BGYJ 4WY4C 2IBZD 1RE4C 1SFCA 1G1JA
chains in the Genus database with same CATH topology
2P10A 5KLIC 2BEZF 3AE8D 2WPVB 2WS3C 3SFDD 3AEED 3EWKA 1IK7A 2WP9D 2E74B 2QJPC 4OGQC 4TT3H 1ZMEC 3AE1C 2B76D 2WDVD 1NENC 2BS3C 5M1BA 1PV3A 1OMIA 2WU5C 3AE3D 4PV1C 2E75B 3LW5J 3P4SD 3AE2C 4YXDC 2D2CC 1KILE 3GF3A 5L8RJ 2G3AA 3RL0g 1K04A 4KT0J 4RKUJ 1HF9A 1VF5D 1E7PC 2QJKC 1FDIA 3VRBC 3P4PC 2H88D 3AE4C 2WQYC 2G8YA 3Q1MA 1KORA 1KF6D 3D6ZA 3AEGC 2WU2C 2E74D 3SFEC 2E76B 4H13D 1HJ0A 2H89C 3AE5C 1ZRTE 1S1CX 2NZ2A 4H44D 4Z1MH 2IDBA 3C8VA 3H25A 3Q5RA 4KX6C 3AEAC 2ZT9D 3AE8C 2FXPA 3SFDC 3AEEC 5C3JD 1KQFB 3Q5SA 1YQ4D 2WP9C 1YQ3D 4YSYC 1NEKD 1DD4A 3IAOA 3AECD 1TU3F 2B76C 2WDVC 3AE9D 4YSXD 4H0LB 3Q3DA 1JB0J 1L0VD 1QLBC 3ABVC 3Q5PA 1KTMA 3AE3C 2BS4C 3P4SC 4YTMC 1OW7A 4R4MA 1RQVA 4OGQB 1Y9BA 3AEFD 1VF5C 3AEDD 2FBWD 2BS2C 1DIPA 2H88C 1MKMA 4U7JA 4PV1B 2V7QJ 1KF6C 2D2CB 4Y28J 3D70A 3AE6D 3VRAC 2BEQD 4H13C 1WMKA 4H44C 2WDQD 3AEBD 3CIRD 4YTND 5C2TD 1ZOYD 2E75D 2WDRD 3P4QD 4YT0D 1DD3A 1R8EA 1NEND 1PL5A 4GDOA 5C3JC 1OW6A 1Q90D 1YQ4C 4R4LA 1K05A 4YTPD 1NEKC 2WU5D 3AECC 4YSXC 3VR9D 2K9YA 4I7ZC 2OQQA 3VR8D 4YXDD 1L0VC 3FGAD 3AE7D 3T97B 2FYNC 2E76D 2WSCJ 3IN6A 4YSZD 3VRBD 3D6YA 2ACZD 3R4YA 2YMKA 3AEFC 3P4RD 2QIWA 2JO1A 3AEDC 2FBWC 5KKZC 1AJYA 3B71A 1ZP0D 2WSFJ 3O6QA 2YIUC 3AE6C 1KFYD 3AEAD 2E74C 2JP3A 1VF5B 1YQ3C 1VL2A 2WSEJ 4H0LD 2WDQC 3AEBC 1KMIZ 1EXIA 3CIRC 4YTNC 1NYHA 5C2TC 2WS3D 1ZOYC 2E75C 2ZT9C 2WDRC 4YSYD 3P4QC 2QSIA 4OGQD 1PIXA 4YT0C 1OW8A 4H13B 4H44B 3AE1D 2O01J 3ABVD 1KQGB 4YTPC 1NGMB 3VR9C 2ZT9B 3AE9C 4PV1D 4YTMD 3AE2D 3VR8C 2D2CD 2QJYC 3AE7C 3RK3E 3S9OA 2E76C 2J5UA 4YSZC 1GMJA 2ACZC 1FDOA 3P4PD 3AE4D 1RQUA 2WQYD 3P4RC 4I7ZB 3GMAA 4IL6X 3AEGD 2WU2D 1U57A 3D71A 1S5LX 3VRAD 1ZP0C 3SFED 3G9RA 3GLMA 2H89D 3AE5D 3GF7A 1EXJA 1KFYC 4KX6D 4XFJA 1UIXA 3Q2YA 2MKVA 4H0LC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AE8 D;  2WS3 C;  3SFD D;  3AEE D;  2WP9 D;  3AE1 C;  2B76 D;  2WDV D;  1NEN C;  2BS3 C;  1PV3 A;  2WU5 C;  3AE3 D;  3P4S D;  3AE2 C;  4YXD C;  2G3A A;  1K04 A;  1E7P C;  3VRB C;  3P4P C;  2H88 D;  3AE4 C;  2WQY C;  1KF6 D;  3AEG C;  2WU2 C;  3SFE C;  2H89 C;  3AE5 C;  1YQ3 D;  4KX6 C;  3AEA C;  3AE8 C;  3SFD C;  3AEE C;  5C3J D;  1YQ4 D;  2WP9 C;  4YSY C;  1NEK D;  3AEC D;  4YSX D;  3AE9 D;  2B76 C;  2WDV C;  1L0V D;  1QLB C;  3ABV C;  1KTM A;  3AE3 C;  2BS4 C;  3P4S C;  4YTM C;  1OW7 A;  3AEF D;  3AED D;  2FBW D;  2BS2 C;  2H88 C;  1KF6 C;  3AE6 D;  3VRA C;  2WDQ D;  3AEB D;  3CIR D;  4YTN D;  5C2T D;  1ZOY D;  2WDR D;  3P4Q D;  4YT0 D;  1NEN D;  5C3J C;  1OW6 A;  1YQ4 C;  1K05 A;  4YTP D;  1NEK C;  2WU5 D;  3AEC C;  4YSX C;  3VR9 D;  4YXD D;  3VR8 D;  1L0V C;  3AE7 D;  4YSZ D;  3VRB D;  2ACZ D;  3P4R D;  3AEF C;  3AED C;  2FBW C;  3B71 A;  1ZP0 D;  1KFY D;  3AE6 C;  3AEA D;  1YQ3 C;  2WDQ C;  3AEB C;  3CIR C;  4YTN C;  5C2T C;  2WS3 D;  1ZOY C;  2WDR C;  4YSY D;  3P4Q C;  4YT0 C;  1OW8 A;  3AE1 D;  3ABV D;  4YTP C;  3VR9 C;  3AE9 C;  4YTM D;  3AE2 D;  3VR8 C;  3AE7 C;  3S9O A;  4YSZ C;  2ACZ C;  3P4P D;  3AE4 D;  2WQY D;  3P4R C;  3AEG D;  2WU2 D;  3VRA D;  1ZP0 C;  3SFE D;  2H89 D;  3AE5 D;  1KFY C;  4KX6 D; 
#chains in the Genus database with same CATH topology
 2Q1K A;  1SQP K;  2HPC A;  2KI7 B;  3WMM 0;  3BVH A;  2E43 A;  2D2C C;  4ZMD A;  1L0L E;  2E74 D;  2K88 A;  1RF0 C;  2IDB A;  3V2P A;  4ZKU A;  4GOE A;  2RKL A;  2VRS A;  1T2K D;  3AE8 C;  1SQV D;  4WY4 A;  4YXW H;  1RE4 A;  3H1K J;  1HH0 A;  1JB0 J;  5B66 H;  1KTM A;  1SQQ K;  5AVV B;  3A0B H;  3OW2 O;  4DHI B;  4RJT A;  1RF1 C;  1IJD B;  2IBZ G;  1ZOY D;  1R8E A;  1RF0 A;  3B4S A;  1OW6 A;  1J1D C;  2K9Y A;  1L0V C;  1GU5 A;  3AEF C;  2QIW A;  2Y0D A;  1GW3 A;  2YIU C;  3MZW B;  2JP3 A;  3M0D C;  3AEB C;  1MZ9 A;  2ZJS E;  3CMA P;  1SQV G;  1RF1 A;  4C7N B;  2J5U A;  4LC1 A;  1FDO A;  3UIA A;  2NPS D;  3G3Z A;  2HFE D;  3SFE D;  3G9R A;  1L0N E;  3CCS P;  3L71 J;  5E79 E;  2WP9 D;  3M0D A;  1LNQ A;  3AE3 D;  1KD1 Q;  1KFM A;  1URQ B;  1FDI A;  1JCC A;  1JTH A;  1ZV8 A;  3P4P C;  1S3J A;  1GL2 D;  2OTJ P;  2WT7 A;  2E76 B;  4H13 D;  3Q5R A;  1ZRT E;  5AW2 B;  4GOF A;  2KIK A;  3TDK A;  3M91 A;  2BCC E;  1XTG B;  2FXP A;  4U3F D;  3CLQ A;  3CWB E;  1MV8 A;  3Q3D A;  1Y47 A;  2FYU D;  1EQ7 A;  4YTM C;  2QJP B;  4PD4 H;  3RK3 C;  5AVY B;  4PV1 B;  1S9K E;  1JY2 N;  5CJ4 A;  2IYO A;  3NMD A;  3VP9 A;  1NEN D;  2C9N Y;  2XND H;  4YSX C;  1KB9 H;  3USS A;  3T97 A;  3MGN A;  1CZQ A;  3WUU A;  3H6P A;  2P7J A;  4U3F J;  2AXC A;  3N4X A;  1EXI A;  1JY3 P;  2M5A A;  2C0W A;  4ZKP A;  3BCC D;  1X8Y A;  3H1J G;  2FYU G;  1SS1 A;  5B66 E;  3CX5 D;  3TNU B;  3VRA D;  2KS1 A;  1JY3 O;  3A0B E;  1NTK J;  1BE3 E;  1EDK A;  4DHZ A;  1FAV A;  1BCC D;  3FXE A;  1AQ5 A;  1NTZ J;  1MUU A;  1YHQ P;  1KN7 A;  4KT0 J;  1SFC D;  5APT A;  2WQY C;  3Q1M A;  4L76 A;  2W6A A;  4H44 D;  1N7S B;  2Q7C A;  3VN0 A;  3L73 G;  3CC7 P;  5KLV E;  4AQR D;  4QMA A;  4NPD A;  4EIJ A;  1FZF A;  1DH3 A;  2R5D A;  3BCC G;  2PGD A;  5APQ A;  1SQV K;  3JCU H;  2Q9I A;  1BCC J;  1ZN5 A;  3MD0 A;  2V4H A;  1KYO I;  4YTN D;  1H0T A;  3P8C E;  1S72 P;  3L75 J;  4JQ0 D;  2RMZ A;  1PGP A;  3B71 A;  1SP4 A;  3O6Q B;  2OYI B;  4L73 A;  3AE6 C;  1N73 B;  4DHJ A;  2Q5U A;  3TSI A;  3V4W A;  3OJA B;  1N2D C;  2P58 A;  4YT0 C;  3H1L E;  2CPS A;  3CCL P;  2B89 A;  2IYP A;  4DT0 A;  2FYN B;  1M56 D;  4PD4 E;  1T3U A;  1LTS C;  3L73 E;  4BWN A;  3AEE D;  1QL2 A;  1YJ9 P;  3EWK A;  1ZME C;  1EDI A;  1U7J A;  3KXD A;  2WIT A;  4UB8 H;  3GF3 A;  1LTG C;  3KHU A;  2JWD A;  3SWY A;  1KB9 E;  1SQP D;  3AE4 C;  1KF6 D;  1ZXG A;  3L4F A;  3CPW O;  1KYO D;  1NAY A;  2MJZ A;  1SQB E;  2FFD C;  3CC4 P;  2XDJ A;  1PP9 G;  2YMY A;  1FJP A;  2LKM A;  1OW7 A;  1P84 H;  4R4M A;  4HKZ H;  4FJV A;  1KIL C;  1JMM A;  1DIP A;  2KK7 A;  3L36 A;  1SQX D;  2O01 N;  2V7Q H;  2J59 M;  2FYU K;  4JBZ A;  2NPS B;  2P67 A;  1R5S A;  1J1E C;  2K9J B;  2AXT H;  3P4Q D;  1K8A Q;  4GDO A;  5C3J C;  1SQP J;  2HR3 A;  1NEK C;  2B9B A;  2FFD A;  2H7H A;  1G1I A;  1M1J C;  1LT1 A;  1Z56 A;  2FBW C;  1OZH A;  2ZAE B;  2FKW B;  3CCM P;  2Z5I A;  3CME P;  3L74 G;  4D6T J;  1K73 Q;  3VMA A;  1KIL A;  4H0L D;  1GL2 B;  1OWA A;  2L5G B;  2OAR A;  2QEX P;  4H13 B;  4K35 A;  3RK2 C;  3AE1 D;  2E5Y A;  3AE9 C;  3H1H D;  4YTM D;  1G2C B;  3A2A A;  2Q3I A;  3RK3 D;  2W6J H;  4EYY Q;  1ZR2 A;  3P4R C;  2A06 E;  1IZN B;  5AVX B;  1SQQ J;  1SQX G;  1M1J A;  3JCU E;  1W2B O;  1HJB A;  5KJ7 D;  1H88 A;  3BRV B;  5AW9 B;  1PGQ A;  2YXQ B;  2HOD B;  3U1C A;  1NVO A;  2N1T C;  4KHX A;  4WB4 A;  1VQ5 P;  1L0L D;  4N3Y B;  3D6Z A;  3RBX A;  2W27 A;  3H1H J;  1BSH A;  1GD2 E;  2R32 A;  1LTI C;  5KLI B;  3P4S C;  3H1H G;  1CI6 B;  1VF5 C;  3L74 E;  1YIT P;  2N1T A;  3A5T A;  2QJK B;  1OX3 A;  3F89 A;  2W8Z A;  3M9H A;  5BU5 A;  2OQQ A;  3H32 A;  2OYH B;  4YSZ D;  3EFF K;  5H2F H;  1PPJ E;  4UB8 E;  1L0L G;  2IPP A;  1SFC B;  1FZB A;  2E75 C;  4H44 B;  3PH0 A;  3M9B A;  1MFZ A;  3AE2 D;  3VR8 C;  1YI2 P;  2JR8 A;  3L37 A;  1P84 E;  1OXZ A;  2QA4 P;  4KX6 D;  1L0N D;  1N8R Q;  1LT9 B;  2CPB A;  2IFN A;  3I5C A;  5CCG D;  2AXT E;  1VDF A;  2L91 A;  1E7P C;  3FWN A;  2IFM A;  3V4Q A;  2Y0C A;  2C9L Y;  3FWL A;  4B86 A;  1EC5 A;  4ASW A;  2BCC D;  1LWU C;  2KNC A;  1GTW A;  1GZL A;  2N9Y B;  2M3B A;  3IR9 A;  5AVW B;  2HYN A;  2QM7 A;  1S9K D;  2BEQ D;  4BRY A;  3CIR D;  4DCK A;  2WDR D;  1VQ4 P;  1L0N G;  3B5N B;  1LGH B;  3GG2 A;  3MTU E;  1SQX K;  4YTP D;  5CJ0 A;  3CD6 P;  3RL0 B;  2B88 A;  4BXL A;  4W7Y A;  1LWU A;  3R4Y A;  1OIP A;  1X22 A;  1VQ9 P;  1FZA A;  1ZW0 A;  1YQ3 C;  1KMI Z;  2I1J A;  1VQM P;  3TYY A;  1OW8 A;  3KZI H;  2O01 J;  2BCC G;  2WVR A;  4JF7 A;  3WUT A;  3CWB G;  3H1I E;  2JWA A;  2LR2 A;  3GMA A;  3HE4 A;  1L2P A;  2WU2 D;  1SQV J;  3LID A;  1W2E A;  5DJU B;  2WS3 C;  2IZ1 A;  3SFD D;  5C39 A;  2B76 D;  2WDV D;  1SLQ A;  2BS3 C;  1NWQ A;  2JDI H;  3CCR P;  1HF9 A;  2J58 A;  5KTB A;  5H2F E;  4Z1M H;  3HTK B;  1JMB A;  3GHG B;  4PD4 I;  1GK4 A;  4GIF A;  3CCE P;  1L0L K;  1ZLL A;  1BGY E;  5KAI H;  1YQ4 D;  2BAS A;  3AE9 D;  1NAF A;  4H0L B;  3ABV C;  1YBK A;  1ZR4 A;  1LTJ B;  1RQV A;  3PLN A;  2OTK E;  3L72 E;  3CCJ P;  2POH A;  1KB9 I;  3KQG A;  5APS A;  5AW4 B;  2M5A B;  1N7L A;  1JNM A;  3S4R A;  1BE3 G;  2O3J A;  1KFN A;  3P8C D;  1QL1 A;  3H1J D;  1YTZ T;  3PHL A;  3H1K E;  2W6B A;  1AJY A;  1R5L A;  4OH8 B;  3V2Q A;  4OGQ D;  1URQ C;  1D7M A;  3H1L D;  1NGM B;  5KLV G;  4C7N A;  5BU8 B;  2QJY C;  3AE7 C;  2E76 C;  3SSU A;  1JM0 A;  1HGZ A;  2FY8 A;  1USE A;  3GLM A;  3BAT A;  1KFY C;  3L73 D;  5KKZ B;  3H1J J;  2FYU J;  4JYB A;  4WWI A;  2QJP C;  1L4A D;  1E5W A;  3CX5 H;  2P1J A;  4DJG A;  4PV1 C;  3LW5 J;  1L0N K;  1KIL E;  1URQ A;  2ZXX A;  2H88 D;  2WSS H;  4I1L A;  1KB9 D;  1KOR A;  3AEG C;  2PFX A;  3NFQ A;  3H1L J;  3C8V A;  1WT6 A;  2A45 H;  1SQB D;  1USD A;  4AYC A;  1TU3 F;  1YIJ P;  3L71 E;  1IFJ A;  3KZI E;  3S1K A;  3H1L G;  1FDM A;  3L73 J;  3AED D;  5GTH H;  2FXM A;  3N7N A;  1Q86 Q;  3JSV C;  5AVQ B;  3M0A A;  3M06 A;  1S5L H;  2WDQ D;  3BCC J;  3HD7 B;  3PRJ A;  1LP1 B;  5KAF H;  3AEC C;  3HE5 B;  2ACZ D;  2HG5 D;  1SQB J;  1ZP0 D;  4WY4 D;  1IK9 A;  2WSE J;  4WBA A;  5APW A;  1T8Z A;  5C2T C;  2QVA A;  1YTZ I;  2UWJ E;  3O8Z A;  4L75 A;  1SQB G;  1KQG B;  3VR9 C;  1Q81 Q;  3CC2 P;  1X79 B;  2D2C D;  5KAI E;  1AQT A;  5GTI H;  1N7S C;  2B87 A;  4I7Z B;  3TNU A;  2A06 D;  4O9B A;  1X9V A;  1EXJ A;  4NPE A;  3CXH I;  3MHV A;  4U3F E;  3AE8 D;  1LTT C;  1PP9 D;  2YKP A;  2E74 B;  1T3J A;  1FBM A;  5CCH C;  3E1I A;  4RKU J;  3PJS K;  4DOJ A;  1KQL A;  3G4S P;  4IOI H;  2H89 C;  3AE5 C;  1YQ3 D;  2WPR A;  1N7S A;  1P84 I;  4PJ0 H;  2Q3E A;  2YNY A;  1HVV A;  3TK1 A;  1NTK E;  3M9Q A;  1L0V D;  4UB6 H;  2OYI C;  1N73 C;  1H8A A;  5AVU B;  3AEF D;  3CXH H;  1NJI Q;  1NTZ E;  1PP9 J;  5KLV K;  3L74 D;  5CCH A;  4Y28 J;  2A06 G;  3B8E B;  1KQS O;  3AEB D;  4XE5 B;  3QWO C;  1VQ8 P;  1T2K C;  3FGA D;  4DDG A;  2FYN C;  2LXC B;  3CX5 E;  3CCQ P;  3OAK A;  3ITK A;  4EOT A;  1Y8A A;  2WSF J;  3O6Q A;  4Y99 B;  2OYI A;  1N73 A;  1FE6 A;  1WRG A;  1UII A;  2WPQ A;  1QGK B;  4IFF A;  5AW6 B;  1ZOY C;  1BCC E;  3L74 J;  3ABV D;  1NU1 E;  1NKZ B;  4DZO A;  3P4P D;  2GUV A;  3L75 E;  2ZYG A;  3NTN A;  1P84 D;  1NTM E;  5GTH E;  3II6 A;  5APY A;  3FXD A;  3CCV P;  2Y9Y A;  1S5L E;  1CW5 A;  1RHZ B;  1EDJ A;  1JCD A;  1SQX J;  1A02 F;  1OMI A;  5KAF E;  3TGU E;  3P8M C;  3VOP A;  1QLE D;  1IFD A;  3RL0 g;  2G3A A;  3SWF A;  1Q2N A;  2G8Y A;  2NPS C;  2JJL A;  1PPJ G;  3SFE C;  4DDI A;  2PP6 A;  1FZC B;  4IFD K;  2CK3 H;  4N78 E;  1JY3 N;  2WP9 C;  2Y0E A;  4YSX D;  5DJT B;  3AE3 C;  3KYQ A;  4OGQ B;  1QX8 A;  4JYC A;  1SQB K;  4GT1 A;  1GL2 C;  1NH4 A;  2V7Q J;  2Z5H A;  5GTI E;  4H13 C;  1WMK A;  1EZV E;  1JOC A;  1DEB A;  2NPS A;  1M8O B;  2K9J A;  1RE3 C;  5APV A;  3VTP C;  2WSC J;  1L4A B;  2YMK A;  2JO1 A;  3KDP B;  1GK6 A;  1IO4 A;  3RBZ A;  3HUS B;  1XTC C;  2ZXE B;  1GL2 A;  2E42 A;  3V6I A;  4L74 A;  4PJ0 E;  2WMM A;  5B5E H;  1L0L J;  1KV4 A;  1G2C A;  1RE3 A;  3PP5 A;  3R2P A;  5BVZ A;  1GMJ A;  2KYV A;  3H1I D;  2WQY D;  3V2R A;  4UB6 E;  1JY2 P;  3P32 A;  3CXH E;  2IBZ I;  2IZ0 A;  4XA4 A;  1CSB A;  5KLI C;  2HPC B;  4D6T E;  1EDL A;  3VP8 A;  2ZYD A;  3I55 P;  2HOD A;  3U1A A;  1JY2 O;  1X0T A;  2O1K A;  2QJK C;  1H89 A;  1S1C X;  4BRY B;  3PTZ A;  1SQQ E;  2OYH C;  1HWT C;  2KSJ A;  4WY4 B;  2M3E A;  1BGY D;  1VQ6 P;  2P2U A;  2ZVO B;  2SPZ A;  1QEX A;  1W5C E;  2XKM A;  2QE7 H;  1N7S D;  1Y9B A;  2I8D A;  1GDT A;  2C0X A;  1MFT A;  1CI6 A;  1M57 D;  3L72 D;  2KSE A;  3H1I G;  1AFO A;  2D2C B;  5AVR B;  1K9M Q;  4NPF X;  2RH0 A;  3AE6 D;  4IL6 H;  4H44 C;  2HLO A;  1ZRT D;  2YXR B;  2KB7 P;  4OVN F;  1JEK A;  5AVS B;  4YT0 D;  1PL5 A;  5EFW B;  3RGU A;  1J2J B;  1A02 J;  2O01 H;  5CCH D;  1VQL P;  3CWB D;  4M3L A;  2OYH A;  3IN6 A;  1L0N J;  3H1K D;  3WU2 H;  2AEF A;  1LT9 C;  2GA1 A;  3G6E P;  2FXO A;  5CMZ A;  4YTN C;  1BDC A;  2ZT9 C;  1SVF A;  4GOD A;  2QSI A;  1PIX A;  2OGU A;  3L72 J;  1RF1 B;  1BGY G;  2H43 A;  3S9O A;  1DEE G;  1VQO P;  3P7K A;  3AE4 D;  1J1D B;  2YO2 A;  2BCC J;  4ASV A;  2KZI A;  2FYZ A;  3L72 G;  3L70 E;  3OA7 A;  2KUB A;  1UIX A;  3CWB J;  1QVF O;  2MKV A;  2WWW A;  1LT9 A;  3C9I A;  2YIU B;  1IK7 A;  5AW3 B;  2N9B A;  5M1B A;  3F5H A;  5L8R J;  1KIL D;  1JTH B;  3V5B A;  2WT7 B;  3H1K G;  3B5N C;  4C46 A;  3VYI A;  3AEA C;  1IFN A;  3QH9 A;  3RL0 C;  1FS0 E;  2QM8 A;  3VON A;  5C3J D;  3AEE C;  1BE3 D;  1NEK D;  1QLB C;  3Q5P A;  2Y9Z A;  5B5E E;  3L71 D;  1PZQ A;  2FBW D;  2BS2 C;  1MKM A;  4HYT B;  1KF6 C;  4LGD E;  3FX0 A;  1DD3 A;  3RK2 D;  3B5N A;  4K3A A;  3SWK A;  1Q90 D;  5KLV D;  1HTL C;  3T97 B;  1JO5 A;  3VMX A;  3P4R D;  2YO3 A;  1BE3 J;  2Q6Q A;  3U59 A;  5TIS H;  5CBN A;  3RK3 B;  1AA0 A;  1NYH A;  1N86 A;  2I1K A;  2QG4 A;  4AUW A;  3P4Q C;  2WPS A;  2DW3 A;  5APX A;  5AW0 B;  2N1T D;  3LW5 H;  2H8P D;  1HGV A;  3L71 G;  5CBO A;  2QJY B;  2R3S A;  3CX5 I;  3GHG C;  4I6M C;  1U57 A;  1S5L X;  2KS1 B;  5KLV J;  2IBZ E;  1TFF A;  3GF7 A;  2KZJ A;  4XFJ A;  5AVT B;  4H0L C;  2P10 A;  4EDF A;  4IL6 E;  2WPV B;  3IF4 A;  1LTJ C;  2PAJ A;  3AE1 C;  2KLU A;  3P4S D;  4YXD C;  2NRG A;  2A45 I;  1VF5 D;  5TJH A;  2Z4E A;  1JUN A;  2AEM A;  1HJ0 A;  3LIE A;  3HTK A;  1Q7Y Q;  4PD4 D;  3WU2 E;  3GHG A;  1FU1 A;  1SQV E;  5KJ7 C;  1AVO A;  1NTK D;  4RES B;  1LTJ A;  2XNX A;  1M90 Q;  3EQ2 A;  1IFM A;  1RY3 A;  1NTZ D;  1T6A A;  2WSE H;  2E75 D;  3K5B A;  1H0T B;  4U3F G;  1VQ7 P;  3VR8 D;  5KJ7 A;  3TF5 A;  3D6Y A;  2B87 B;  1FZE A;  1HBW A;  5KKZ C;  2PRR A;  2JEE A;  2JKV A;  2M0B A;  2R3C A;  1EZV I;  4A7P A;  2K3R A;  1NU1 D;  3MUD C;  1NTK G;  4YSZ C;  1IC2 A;  3D71 A;  1PFI A;  1DX7 A;  3CI9 A;  3L75 D;  4LLH A;  1HUC A;  1NTZ G;  2AEJ A;  1YYC A;  1NTM D;  3Q2Y A;  1YJN P;  2XZR A;  2YKO A;  1FOS E;  2BEZ F;  2OYO A;  2W90 A;  1RH5 B;  3EFG A;  2R44 A;  3W67 A;  2ITA A;  2WU5 C;  2K37 A;  3AE2 C;  3TGU D;  1K04 A;  3VRB C;  2WZ7 A;  1KZU B;  3HD7 C;  3MUD A;  3BRT B;  3A0H H;  3V2N A;  1NU1 J;  4KX6 C;  3HRN A;  2ZT9 D;  5TIS E;  1KQF B;  3ZDM A;  2XV5 A;  4YSY C;  1VQP P;  4N78 D;  5CCG C;  1BCC G;  3H1J E;  2FYU E;  2BS4 C;  1NTM J;  1NU1 G;  1QVG O;  2A45 G;  2WSF H;  3L75 G;  3HD7 A;  1EZV D;  1NTM G;  3TGU J;  1LP1 A;  1LTA C;  4R4L A;  1GU4 A;  1PGJ A;  1NHL A;  4I7Z C;  3CCU P;  2FFD B;  1LJ2 A;  3HE5 A;  1KYO H;  5CCG A;  3TGU G;  3B5N D;  1E79 H;  3AEA D;  2E74 C;  1IFI A;  1KIL B;  3RL0 D;  3CIR C;  2QRX A;  3CL3 D;  2WS3 D;  2WDR C;  4EI2 A;  4YTP C;  3BCC E;  1J1E B;  2WTY A;  1PPJ D;  2E5T A;  3G71 P;  4I2L C;  1GW4 A;  1M1J B;  3CXH D;  3MIW A;  4W80 A;  4W7Z A;  5AW1 B;  1EZV G;  4D6T D;  1PV3 A;  1AV1 A;  3NXS A;  1Q82 Q;  2RN0 A;  3RK2 B;  3JC2 2;  3MP7 B;  4C7R A;  2WU2 C;  1LTB C;  3VMY A;  3A7O A;  4ZNC A;  1KC8 Q;  2IX7 C;  1NKN A;  1SQQ D;  3SFD C;  1YJW P;  1DD4 A;  3IAO A;  5CHX A;  2B76 C;  2WDV C;  4HB1 A;  2M8R A;  4Y99 C;  2WSC H;  1NOH A;  2ZFY A;  1SQP G;  4RO0 A;  2GM4 A;  3D70 A;  1M7L A;  3BAS A;  1NTK K;  2N1T B;  1OVV A;  1AVY A;  1URQ D;  1NTZ K;  1YQ4 C;  3I56 P;  4D6T G;  2ZVN B;  3H32 B;  2LXB A;  2YKQ A;  4YXD D;  3AE7 D;  2ZYA A;  2E76 D;  1PGO A;  5APU A;  2KOG A;  3WUV A;  4KJM A;  2R5B A;  1KFY D;  3IFM A;  1VF5 B;  1VL2 A;  2K1A A;  2OTL P;  1PP9 E;  1M1K Q;  3A0H E;  4TLF A;  4MN4 C;  5AW8 B;  1SQQ G;  1VPC A;  4PV1 D;  4CPG A;  4N6J A;  1FZC C;  3E7K A;  4IL6 X;  3AEG D;  1S4X A;  3E1R A;  3A3Y B;  1NU1 K;  3W68 A;  4I6L A;  3L70 D;  1S2E A;  4LDT A;  5AVZ B;  1FZG A;  1IFP A;  4OGQ C;  4TT3 H;  1NEN C;  1NTM K;  2E75 B;  2XU6 A;  4OWF A;  1BDD A;  1FJK A;  3L35 A;  1SQP E;  1OVU A;  1KYO E;  1VQN P;  2NZ2 A;  3H25 A;  2ZFC A;  1FZC A;  4IFM A;  2W83 C;  3Q5S A;  1OVR A;  1L4A C;  2KNC B;  3AEC D;  3KPE A;  3C1L A;  3L70 J;  4YPC A;  3HUS C;  1VQK P;  1BSN A;  1SQX E;  2H88 C;  2KXP B;  4U7J A;  4JPZ B;  3VRA C;  1FC2 C;  5E79 H;  2KLV A;  5C2T D;  3L70 G;  3VMZ A;  5AW5 B;  5K5G B;  3H1I J;  1K05 A;  4WVZ A;  2WU5 D;  3VR9 D;  2O1J A;  1U7M A;  3VRB D;  1LWU B;  1L4A A;  3HD7 D;  3AED C;  1SFC C;  4HJG H;  3GW6 A;  4GKG A;  2GUS A;  3HUS A;  2WDQ C;  2KP8 A;  4YSY D;  1NO4 A;  3H1H E;  2ZT9 B;  1OFC X;  3RK3 E;  2ACZ C;  4HH2 A;  1RQU A;  1FOS F;  3HE4 B;  1ZP0 C;  5AW7 B;  2H89 D;  3AE5 D;  1BGY J;  4WY4 C;  2IBZ D;  1RE4 C;  1SFC A;  1G1J A; 
#chains in the Genus database with same CATH homology
 2P10 A;  5KLI C;  2BEZ F;  3AE8 D;  2WPV B;  2WS3 C;  3SFD D;  3AEE D;  3EWK A;  1IK7 A;  2WP9 D;  2E74 B;  2QJP C;  4OGQ C;  4TT3 H;  1ZME C;  3AE1 C;  2B76 D;  2WDV D;  1NEN C;  2BS3 C;  5M1B A;  1PV3 A;  1OMI A;  2WU5 C;  3AE3 D;  4PV1 C;  2E75 B;  3LW5 J;  3P4S D;  3AE2 C;  4YXD C;  2D2C C;  1KIL E;  3GF3 A;  5L8R J;  2G3A A;  3RL0 g;  1K04 A;  4KT0 J;  4RKU J;  1HF9 A;  1VF5 D;  1E7P C;  2QJK C;  1FDI A;  3VRB C;  3P4P C;  2H88 D;  3AE4 C;  2WQY C;  2G8Y A;  3Q1M A;  1KOR A;  1KF6 D;  3D6Z A;  3AEG C;  2WU2 C;  2E74 D;  3SFE C;  2E76 B;  4H13 D;  1HJ0 A;  2H89 C;  3AE5 C;  1ZRT E;  1S1C X;  2NZ2 A;  4H44 D;  4Z1M H;  2IDB A;  3C8V A;  3H25 A;  3Q5R A;  4KX6 C;  3AEA C;  2ZT9 D;  3AE8 C;  2FXP A;  3SFD C;  3AEE C;  5C3J D;  1KQF B;  3Q5S A;  1YQ4 D;  2WP9 C;  1YQ3 D;  4YSY C;  1NEK D;  1DD4 A;  3IAO A;  3AEC D;  1TU3 F;  2B76 C;  2WDV C;  3AE9 D;  4YSX D;  4H0L B;  3Q3D A;  1JB0 J;  1L0V D;  1QLB C;  3ABV C;  3Q5P A;  1KTM A;  3AE3 C;  2BS4 C;  3P4S C;  4YTM C;  1OW7 A;  4R4M A;  1RQV A;  4OGQ B;  1Y9B A;  3AEF D;  1VF5 C;  3AED D;  2FBW D;  2BS2 C;  1DIP A;  2H88 C;  1MKM A;  4U7J A;  4PV1 B;  2V7Q J;  1KF6 C;  2D2C B;  4Y28 J;  3D70 A;  3AE6 D;  3VRA C;  2BEQ D;  4H13 C;  1WMK A;  4H44 C;  2WDQ D;  3AEB D;  3CIR D;  4YTN D;  5C2T D;  1ZOY D;  2E75 D;  2WDR D;  3P4Q D;  4YT0 D;  1DD3 A;  1R8E A;  1NEN D;  1PL5 A;  4GDO A;  5C3J C;  1OW6 A;  1Q90 D;  1YQ4 C;  4R4L A;  1K05 A;  4YTP D;  1NEK C;  2WU5 D;  3AEC C;  4YSX C;  3VR9 D;  2K9Y A;  4I7Z C;  2OQQ A;  3VR8 D;  4YXD D;  1L0V C;  3FGA D;  3AE7 D;  3T97 B;  2FYN C;  2E76 D;  2WSC J;  3IN6 A;  4YSZ D;  3VRB D;  3D6Y A;  2ACZ D;  3R4Y A;  2YMK A;  3AEF C;  3P4R D;  2QIW A;  2JO1 A;  3AED C;  2FBW C;  5KKZ C;  1AJY A;  3B71 A;  1ZP0 D;  2WSF J;  3O6Q A;  2YIU C;  3AE6 C;  1KFY D;  3AEA D;  2E74 C;  2JP3 A;  1VF5 B;  1YQ3 C;  1VL2 A;  2WSE J;  4H0L D;  2WDQ C;  3AEB C;  1KMI Z;  1EXI A;  3CIR C;  4YTN C;  1NYH A;  5C2T C;  2WS3 D;  1ZOY C;  2E75 C;  2ZT9 C;  2WDR C;  4YSY D;  3P4Q C;  2QSI A;  4OGQ D;  1PIX A;  4YT0 C;  1OW8 A;  4H13 B;  4H44 B;  3AE1 D;  2O01 J;  3ABV D;  1KQG B;  4YTP C;  1NGM B;  3VR9 C;  2ZT9 B;  3AE9 C;  4PV1 D;  4YTM D;  3AE2 D;  3VR8 C;  2D2C D;  2QJY C;  3AE7 C;  3RK3 E;  3S9O A;  2E76 C;  2J5U A;  4YSZ C;  1GMJ A;  2ACZ C;  1FDO A;  3P4P D;  3AE4 D;  1RQU A;  2WQY D;  3P4R C;  4I7Z B;  3GMA A;  4IL6 X;  3AEG D;  2WU2 D;  1U57 A;  3D71 A;  1S5L X;  3VRA D;  1ZP0 C;  3SFE D;  3G9R A;  3GLM A;  2H89 D;  3AE5 D;  3GF7 A;  1EXJ A;  1KFY C;  4KX6 D;  4XFJ A;  1UIX A;  3Q2Y A;  2MKV A;  4H0L C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...