1ZOYC

Crystal structure of mitochondrial respiratory complex ii from porcine heart at 2.4 angstroms
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords FAD-binding protein
publication title Crystal Structure of Mitochondrial Respiratory Membrane Protein Complex II
pubmed doi rcsb
total genus 50
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2005-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1zoyC01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 1zoyC02
3AE6D 1YQ3C 4YTND 1NENC 1KF6D 3AECD 3VR8C 3AE2C 3AE8D 2FBWC 3AEFD 3VR9C 2WU5D 3SFEC 3SFDC 4YTMC 4YT0C 4YSYD 3P4SD 2WDRD 3AEDD 2WS3C 5C2TD 2WU2D 2H88D 3P4PD 1OW6A 4YTPD 3CIRC 3P4QD 3AE6C 4YTNC 1ZOYD 3B71A 1KF6C 3AE9D 3AECC 3VRBC 1KFYD 4YSZD 3AE8C 3AE7D 2WU5C 3VRAC 3AEGC 1NEKD 2WQYD 3AEED 3AE4D 2ACZD 2BS3C 3P4SC 3AEDC 2WDRC 5C2TC 2WU2C 2G3AA 2H88C 3P4PC 4YTPC 2BS2C 5C3JD 3P4QC 3ABVD 2B76D 4YSXD 3AE9C 3AE1D 3AEAD 1KFYC 4YSZC 3AE7C 1YQ4D 1NEKC 3AE5D 2WQYC 3AEFC 1KTMA 2WP9D 2ACZC 2H89D 2WDVD 4YSYC 4KX6D 4YXDD 5C3JC 4YT0D 1PV3A 3ABVC 2BS4C 3AE3D 2WDQD 4YSXC 3P4RD 3AE1C 3AEAC 1L0VD 1E7PC 1YQ4C 1ZOYC 3AEBD 1ZP0D 3AE5C 3VRBD 2WP9C 1YQ3D 1NEND 2H89C 3AEEC 3VRAD 3AE4C 2WDVC 3AEGD 1OW8A 3VR8D 1QLBC 3AE2D 4KX6C 1K05A 2FBWD 3VR9D 4YXDC 3SFED 3S9OA 3SFDD 4YTMD 3AE3C 2WDQC 1K04A 3P4RC 2WS3D 2B76C 1L0VC 3AEBC 1ZP0C 3CIRD 1OW7A
chains in the Genus database with same CATH superfamily
3I56P 3CC7P 2AXTE 2QJYC 2XV5A 1G1JA 2B89A 1OZHA 5KAFE 3AEDD 5AW8B 2IYOA 4M3LA 2OGUA 1OX3A 1VQ8P 2CPSA 1ZXGA 1OVRA 2K37A 2E74C 2WZ7A 2YMYA 1SFCD 1NTKE 2IBZE 2MJZA 3VOPA 2KSEA 5GTIE 3RK3C 1MZ9A 2ZYDA 5AVZB 1SLQA 1YBKA 2LXBA 5KAIE 3KPEA 2GA1A 1S3JA 4Z1MH 3H1IJ 1G1IA 3L70J 1QVGO 3I5CA 1SS1A 1M56D 1NU1E 2E75B 2Z4EA 5TISE 3L72G 3H32A 2XNDH 1XTGB 1PV3A 3GMAA 2H7HA 2QRXA 1KQGB 1E7PC 2ZFYA 3A5TA 1SQVG 3M9HA 4AUWA 1YQ3D 2PAJA 2WPQA 3AEGD 3L70D 4ASVA 2O01J 3S9OA 2N1TA 2RH0A 2YMKA 2HFED 5AVVB 2O1KA 2E76C 1SQXE 2KUBA 1KF6D 5AW1B 4DDGA 3VR9C 2OTLP 2PFXA 1GZLA 4YSYD 1NHLA 2QJPB 4GKGA 3U1AA 5CHXA 5GTHE 3TGUE 4H0LD 3L72J 4I6LA 2UWJE 2N1TB 3L75E 3AEED 1LT9C 1IFIA 1S5LH 1NTMK 2FYNB 2ZT9B 1SQVJ 5C3JD 2ZVNB 1T2KC 2VRSA 1X8YA 2SPZA 4UB6H 1K73Q 2HYNA 1BCCG 4EYYQ 3G6EP 1N86A 3LW5H 5B5EH 3HD7D 3Q3DA 3GLMA 5APUA 1BGYG 2LR2A 5CCGC 1QVFO 2JJLA 1SQBK 1CW5A 2POHA 2R32A 3AE3D 2WDQD 3B5NC 3GHGB 2YKQA 2K9JA 1DEBA 1ZRTD 1SQVD 2BCCG 2HPCA 3PP5A 2YXQB 4D6TD 3CCMP 3AE4C 1L0LJ 2D2CD 3AE2D 3CXHD 3CCLP 3RBZA 2QM8A 1PGJA 1LTJA 2NPSA 3H1IE 3VMXA 4PV1D 1UIIA 3M91A 2PGDA 3L70E 1JM0A 5C39A 4I7ZC 4H13C 1P84H 1FZBA 2K9JB 2JEEA 1BCCJ 1AV1A 4WBAA 1VQMP 1NU1K 4W7YA 3CCVP 2XDJA 4BWNA 5AW2B 1NJIQ 1H8AA 1M57D 1ZR2A 1ZOYD 1KILE 4R4LA 1LGHB 3JC22 1LTJB 2BS3C 3CCQP 3CMEP 3L74D 3V2NA 1LTAC 2BCCJ 2BS2C 3VP8A 1EXIA 4JF7A 4DHJA 1KILB 3Q5SA 3AEAD 4RO0A 1KFYC 3OW2O 3CCEP 1PP9G 3JCUE 4IOIH 5CCHD 2HG5D 2ZFCA 3TNUA 3RL0C 1BGYD 2Z5IA 3FWNA 3KXDA 5APSA 1IJDB 1U7MA 2V4HA 1SQXK 1IFDA 2WSCJ 3P4RD 1LTSC 1USEA 5AW0B 4PJ0E 3AEBD 3KZIH 5CBOA 3I55P 3AE5C 3L72E 3MD0A 1IFMA 3VR8D 1NTMG 4WVZA 4EIJA 1URQD 3CWBG 1H0TA 2OYIA 4YTMD 1N2DC 2BEZF 1HJBA 1K04A 2NRGA 4W7ZA 3TNUB 3H1HG 3Q1MA 1SQVE 2C9LY 2IYPA 2AXCA 3HUSC 3L36A 3BRVB 2M0BA 2AEJA 2WSFJ 1KYOE 1JCDA 1GK4A 3AE8D 3TF5A 1HF9A 2WU5D 4LGDE 1SQBG 5BU8B 1M1KQ 2YXRB 2YIUB 4WWIA 2ZYAA 2WDRD 2BEQD 2E5TA 1PP9J 4DHIB 1P84I 2OYIB 1USDA 1FC2C 1DD3A 3KQGA 2W6JH 3VRBC 4R4MA 1MUUA 2OYHB 3MUDC 3AEDC 3PH0A 2B87A 2A45G 2V7QJ 3TDKA 2GM4A 5AVXB 1NTMJ 1SFCC 3CWBJ 2QJYB 1RF0C 1PP9D 3S1KA 2ITAA 4DJGA 2MKVA 1SQQD 3H1HJ 1BSNA 3RK3E 2WPRA 4EOTA 4PD4D 2WSEH 3MIWA 2M5AA 3B4SA 1KFNA 4JYBA 4AQRD 5AW3B 2E74B 1NO4A 1KB9H 3D70A 1SQBJ 2B87B 1BGYE 2WWWA 3A0BH 3RK3B 3N4XA 4ZNCA 2IZ0A 1QEXA 3QWOC 2C0XA 3VMZA 2BCCE 2RKLA 5B66H 3CX5D 1VDFA 2M5AB 3BCCD 3CIRD 1OXZA 5KKZC 2HLOA 1HUCA 2C9NY 1YQ3C 3QH9A 1QX8A 3V6IA 2Y9ZA 1JY2O 3P4PD 3HE4A 2WTYA 3P4QD 3E1RA 1FE6A 1T3JA 3W67A 1KF6C 4JQ0D 1AFOA 2I8DA 2B9BA 1RHZB 5AVRB 1LP1A 3RK2D 1J2JB 1LT9A 2QEXP 2E76B 3UIAA 4H0LC 3VYIA 2QE7H 3ITKA 1FS0E 1XTCC 2WMMA 1JY3P 1SQVK 2QJKC 2WP9D 1RF1C 5C3JC 2BASA 2E75D 4NPFX 4K35A 1OMIA 5CCGA 4UB8H 1PP9E 1M1JC 1ZV8A 3HD7C 1LP1B 1ZP0D 1VQ5P 1SQXJ 1KZUB 1LT9B 4PD4E 1IFPA 4ZKUA 1HBWA 2KI7B 3BATA 3T97A 3PRJA 3WMM0 4LLHA 1FBMA 1Q86Q 3C1LA 1KB9I 2E5YA 3AE3C 2WDQC 3PTZA 2B76C 1NTZG 2KLVA 4L76A 2ZAEB 3SSUA 4JBZA 1NTME 3CWBE 1M8OB 3AECD 1YJ9P 3AE2C 3Q5RA 3H1HE 3B5NB 1PL5A 3CX5E 3SWYA 3P4SD 3T97B 4JYCA 5GTHH 1SQPD 3Q2YA 4DZOA 3CC4P 1SQBE 2E42A 1W2EA 1N7SD 1AVOA 2P2UA 1JTHA 1VF5D 3A2AA 1LWUC 1N7LA 2K3RA 2IBZI 2FXPA 5APTA 1PIXA 4H44D 2IFNA 1NAYA 5DJUB 4DOJA 4YSXD 2LXCB 4I7ZB 1RE4C 4H13B 1S9KD 1NTZJ 1QGKB 3P8MC 1EQ7A 2KS1A 1JTHB 1FZCC 1L4AD 5KLVD 3G4SP 2BS4C 2QM7A 3AEAC 1VL2A 2FYZA 5CCHC 4KHXA 1YTZI 1X79B 2QIWA 2L5GB 1HGZA 2Q5UA 1OW8A 3O8ZA 1K05A 3SFED 1GDTA 3P4RC 3NTNA 1NTZD 4U3FD 1NH4A 2O1JA 3AEBC 4EI2A 2KS1B 1YIJP 3RL0B 4YTND 1H89A 3VR8C 1UIXA 1FJKA 1S2EA 2R44A 3HUSA 1URQC 4D6TG 2Q7CA 4YTMC 5KLIC 4HH2A 5KJ7D 2KLUA 2AEFA 2P67A 5E79E 5APXA 3CD6P 2FYUG 3AE8C 2R3CA 2WU5C 3VONA 2WQYD 2O01H 2ZYGA 2ACZD 1NVOA 1SQQK 5CMZA 2WDRC 3TYYA 4WB4A 2NPSD 3HUSB 1VQNP 3EFGA 4TT3H 3IF4A 1KV4A 2XU6A 1KQLA 2AEMA 1SFCA 1RF0A 4ZKPA 3G71P 1S1CX 2XNXA 3GHGA 1K8AQ 3L71D 4YT0D 3L74G 3RBXA 2J59M 3CMAP 1N73C 1OWAA 1S9KE 4DCKA 4PJ0H 1W2BO 4D6TJ 1IZNB 1HTLC 1ZR4A 1BDDA 1GD2E 1QL2A 3VRAD 4HYTB 1KQFB 3B8EB 3SFDD 3V4WA 2FY8A 2FYUJ 1SFCB 2M8RA 1JCCA 4C7NA 1KYOH 1JMMA 1GMJA 2IZ1A 3C9IA 3AEFD 1E5WA 2WVRA 1NTZE 1DH3A 3CIRC 3MHVA 5CJ4A 4XFJA 1KN7A 3AE9D 4N6JA 3H1KD 2FYUD 4C7NB 1ZMEC 3L74J 2JP3A 2QA4P 2IDBA 4OGQD 1VQOP 2JWDA 2YNYA 1KILA 3P4PC 4HB1A 3P4QC 3ABVD 5KKZB 1J1DC 1HH0A 4RESB 1BGYJ 3NMDA 3CI9A 2N9YB 3CCSP 1RE3A 1MFZA 3RK2C 1Y8AA 4KX6D 5AW9B 5H2FH 1P84D 4XE5B 4W80A 1RF1A 5DJTB 1GL2D 3O6QB 1YJWP 4I6MC 1EZVI 2WP9C 1RH5B 1M1JA 4O9BA 4U7JA 1SQQG 3HD7A 2FBWD 3KDPB 1PPJD 4Y99C 4H0LB 3K5BA 1RQVA 4LDTA 1ZP0C 3USSA 3A3YB 5AW5B 2QJKB 2Q1KA 1SQPK 3CCJP 4IFFA 1RF1B 2W6AA 2N9BA 3CCRP 1MV8A 1EC5A 1KYOI 3M9QA 3F5HA 1M1JB 3HD7B 2H88D 3P8CD 1ZRTE 4UB6E 1T6AA 3BCCG 4D6TE 2OYHA 3AECC 3OJAB 3CXHE 2JR8A 3R2PA 1E79H 4HKZH 3P4SC 2R5DA 2C0WA 1GW3A 3E7KA 4GT1A 2FFDC 2FYUE 1SQQJ 2K1AA 1N7SC 2WSFH 1VF5C 5BVZA 2PRRA 3H25A 4B86A 4GIFA 2W6BA 1AA0A 3WUTA 4H44C 1YI2P 4YSXC 1FZCA 2KZIA 1DD4A 1NTZK 3HE5A 1YITP 1YTZT 1LWUB 1FDIA 1NEND 3L74E 2KP8A 1BE3D 2ZXXA 1P84E 5CCHA 2WSEJ 3BCCJ 1L4AC 1DX7A 1ZN5A 1PGQA 4YPCA 2V7QH 2WSSH 5AVTB 2JWAA 4NPDA 3TK1A 3AE6D 2OTJP 5APYA 1LJ2A 1FZGA 1FZCB 3SFEC 4DT0A 3HE5B 2P10A 1J1EC 3V4QA 3L37A 2K9YA 1JOCA 4GDOA 2WU2D 1URQA 5AVWB 3II6A 3A0HE 1FOSF 4YTPD 4TLFA 2J5UA 2FXOA 1LTTC 1L0ND 2KYVA 4RKUJ 3KYQA 4WY4D 4YTNC 4GODA 3ZDMA 2HR3A 2A06G 3AE7D 1QLED 2AXTH 2JDIH 1KB9D 3AEGC 3AE4D 5KJ7C 5KAFH 3JSVC 2OTKE 4BXLA 4IL6E 1T8ZA 2M3EA 1NGMB 1EDLA 1ZLLA 3GF3A 3V2QA 1SQPG 3AE1D 1URQB 4L75A 2A45H 1GTWA 3KZIE 2WQYC 5KLIB 1HGVA 2ACZC 3P7KA 1Y47A 5GTIH 1EDJA 2FKWB 3V2RA 1JO5A 2H89D 4L74A 2WDVD 4YSYC 5KAIH 2NPSC 4YXDD 3D71A 1OVUA 5AVSB 1TFFA 1TU3F 2IPPA 1ZW0A 2ZVOB 1N73A 2WITA 3IFMA 3AEEC 5TISH 3IAOA 1NTKD 2IBZD 2G8YA 3GW6A 2W83C 2JO1A 4N78D 5KLVG 1S72P 3G3ZA 2P1JA 2IX7C 1SQQE 1FOSE 1BE3E 1KQSO 3B5NA 3P32A 3CL3D 2FYUK 3RL0D 3MGNA 3SFDC 5APQA 1N73B 1SQPJ 2CK3H 5C2TD 1SP4A 4U3FG 4DDIA 2A06D 2OARA 1EDIA 2D2CC 3WU2E 3PJSK 2KNCA 1Z56A 1VQPP 2LKMA 3BCCE 4PV1C 3AE9C 3L73D 2KXPB 3SWFA 1JEKA 2R3SA 5CJ0A 3M0AA 3A0BE 4OGQC 5KLVJ 1GK6A 1HVVA 1KC8Q 1JY2P 2N1TD 1LTBC 2QG4A 3FXEA 3EQ2A 3ABVC 3M0DC 2P58A 2A45I 1NOHA 1VQ7P 2KNCB 3VN0A 1L0VD 1ZOYC 3CLQA 1JY3N 2ZT9D 1R5LA 3VRBD 3HRNA 1EXJA 3TGUD 3L75D 1QLBC 4KX6C 1Q82Q 4U3FJ 1GU5A 1J1DB 3L71G 4IFDK 5EFWB 2WS3D 1Q90D 1IO4A 1GL2C 2H43A 1KFMA 2J58A 1OW7A 3EFFK 2W8ZA 3VP9A 3RK2B 2FBWC 4N78E 3BRTB 1U57A 2L91A 1VQLP 3CPWO 3M06A 1A02F 2Y0EA 4KT0J 1EZVG 4YSZD 3FGAD 1MFTA 2KZJA 2E43A 4Y99B 4GOFA 2H88C 1X0TA 2WT7A 2A06E 4UB8E 1S4XA 2FFDA 4K3AA 3H1KG 3H1ID 1JY2N 3FXDA 3L71J 1X22A 3NFQA 1FDOA 1KTMA 2Z5HA 1N7SA 4N3YB 2YO3A 1SQPE 3L73E 3RGUA 1VPCA 3H1JG 3H32B 3SWKA 2CPBA 3MUDA 2QVAA 3GF7A 3OA7A 3JCUH 2WT7B 1KILD 1KORA 1VQ4P 2FFDB 2Y0CA 2Y9YA 5AVYB 4GOEA 1L0LG 2YKOA 2YKPA 1N7SB 1JB0J 1VF5B 1L4AA 3HTKA 4OH8B 3LW5J 3N7NA 5AW4B 1FZFA 1L0NK 1NENC 2ZXEB 5CBNA 4C7RA 4H44B 2I1KA 1LTGC 5KLVE 2WPVB 1KMIZ 2Q3IA 4NPEA 3D6YA 1PPJG 4MN4C 5KTBA 2YO2A 5AVUB 3H1KJ 3VMYA 3V5BA 2R5BA 3AE6C 4L73A 3MTUE 1EZVD 2HODA 1EDKA 1Q2NA 3CXHH 2Y0DA 1JNMA 3RL0g 1L4AB 1NEKD 3OAKA 3HTKB 1N8RQ 3L72D 2JKVA 3H1JJ 2RN0A 2WU2C 4U3FE 2Q9IA 3FWLA 4YTPC 5KJ7A 3H1LG 1FAVA 2B76D 1YJNP 4WY4C 3AE7C 1YQ4D 1PZQA 1J1EB 1KYOD 2HODB 1NTKK 4JPZB 5L8RJ 1DEEG 3O6QA 4YXWH 1LT1A 4FJVA 2OQQA 3H1JD 3AE1C 1NAFA 1D7MA 4LC1A 3FX0A 4RJTA 2H89C 2NZ2A 2WDVC 1JMBA 4YXDC 5APWA 1AVYA 2HPCB 3Q5PA 1L0LD 2XKMA 1X9VA 4HJGH 3M9BA 1M90Q 1G2CA 2E74D 5K5GB 4DHZA 3W68A 2NPSB 2O01N 3L71E 3H1LJ 1BE3G 2E75C 3A0HH 3RK3D 2OYOA 4OWFA 1OW6A 1BCCD 3PHLA 3WUVA 2KIKA 1DIPA 2KSJA 3G9RA 1SVFA 1PGOA 3NXSA 1G2CB 4IL6H 1PFIA 4A7PA 5C2TC 1S5LE 2G3AA 2Q6QA 1VQ6P 1EZVE 2WSCH 3CXHI 3H1LD 5APVA 1WRGA 1L0NG 2BCCD 5B5EE 5AW7B 3MZWB 1OIPA 1FZAA 4IFMA 2H8PD 1M7LA 1U7JA 3A7OA 1FDMA 1AJYA 1LWUA 3H1KE 1Q7YQ 5KLVK 3M0DA 1BE3J 2D2CB 2QJPC 4OVNF 1CI6A 2E76D 1YHQP 4EDFA 1FU1A 2N1TC 1RE4A 3VR9D 1HJ0A 1QL1A 3H1JE 1MKMA 4PV1B 2ZJSE 1NWQA 1L0VC 4BRYA 2IFMA 1H0TB 2FYNC 2ZT9C 4C46A 3L35A 4OGQB 4PD4H 3WUUA 5M1BA 2W27A 1GL2A 3L4FA 5TJHA 2KK7A 1RY3A 3U1CA 2KOGA 1L0LE 1JY3O 1NTKG 2IBZG 3MP7B 1L0NJ 4QMAA 1CI6B 2WS3C 1AQ5A 1RQUA 1FZEA 1T2KD 1NYHA 3B71A 1IK9A 4KJMA 3GHGC 3TSIA 3WU2H 4BRYB 4I1LA 1PPJE 1S5LX 1AQTA 3CX5H 1BCCE 1NU1G 1GL2B 5CCGD 3IN6A 1GW4A 5H2FE 3H6PA 3CC2P 2Q3EA 2M3BA 3B5ND 1IFJA 4YSZC 3C8VA 2W90A 3S4RA 2QSIA 1NTMD 1CZQA 3CWBD 3H1LE 1NKZB 3P8CE 4XA4A 2RMZA 3H1HD 1Q81Q 2WPSA 2FXMA 5BU5A 1NTKJ 3L73G 1WT6A 1JUNA 1SQBD 2XZRA 4H13D 1SQXG 1R8EA 1LTJC 1YYCA 3BASA 1R5SA 1HWTC 1L2PA 3VTPC 2DW3A 1OFCX 4AYCA 1NU1J 1IC2A 3GG2A 1KILC 3LIEA 3TGUG 3PLNA 3L75G 2I1JA 4YT0C 2K88A 4PD4I 3IR9A 4I2LC 1T3UA 1RE3C 1PGPA 2PP6A 3HE4B 1NKNA 1KFYD 4Y28J 1W5CE 3VRAC 3V2PA 5AVQB 2O3JA 1NU1D 3CCUP 4ASWA 3L73J 5E79H 1OVVA 1IFNA 1LTIC 3EWKA 3CX5I 1IK7A 3R4YA 2GUVA 1NEKC 3AE5D 4WY4A 3AEFC 3F89A 1H88A 4IL6X 3E1IA 1WMKA 1Y9BA 1FJPA 1L0NE 1VQ9P 1BSHA 2YIUC 3D6ZA 1VQKP 1L0LK 4ZMDA 2P7JA 3TGUJ 2KB7P 2GUSA 1YQ4C 3KHUA 1KB9E 3L75J 3BVHA 5AW6B 1A02J 3LIDA 1GU4A 2OYIC 3H1IG 2B88A 1K9MQ 1SQXD 3VMAA 3L70G 1KD1Q 1CSBA 3U59A 1LNQA 4WY4B 1BDCA 2OYHC 5B66E 4CPGA
chains in the Genus database with same CATH topology
1GMJA 4OGQB 3LW5J 3AE6D 5M1BA 2E76C 1YQ3C 4YTND 1NENC 2WSFJ 2E74D 1KF6D 4I7ZC 3AECD 4H13C 3VR8C 1UIXA 3AE2C 2FBWC 4H44B 3AE8D 1HF9A 2WU5D 3AEFD 3VR9C 2QJYC 3SFEC 3Q5RA 3SFDC 2WPVB 2P10A 1KMIZ 4YTMC 5KLIC 1PL5A 4YT0C 4YSYD 1U57A 2E75C 2K9YA 3P4SD 2WDRD 3AEDD 3D6YA 2WS3C 3T97B 2BEQD 5C2TD 4GDOA 2WU2D 2H88D 1RQUA 3P4PD 1OW6A 1ZRTE 4YTPD 3CIRC 3P4QD 2J5UA 3AE6C 4KT0J 3Q2YA 4RKUJ 4XFJA 4YTNC 1NYHA 1ZOYD 1KILE 1DD3A 2E74C 3B71A 4H0LD 4R4LA 1DIPA 1KF6C 3AE9D 3AECC 1ZMEC 1KFYD 3FGAD 4R4MA 3VR8D 4Y28J 3AE8C 3AE7D 3VRBC 4YSZD 1VF5D 2WU5C 2JP3A 3G9RA 3RL0g 3VRAC 3AEGC 1NEKD 2IDBA 2WQYD 1S5LX 2D2CC 3AEED 3AE4D 4OGQD 2ACZD 2BS3C 3P4SC 3AEDC 2WDRC 5C2TC 2FXPA 2WU2C 3IN6A 2G3AA 1PIXA 2H88C 3P4PC 2ZT9B 4H44D 4YTPC 2BS2C 5C3JD 3P4QC 3ABVD 1NGMB 4Z1MH 2V7QJ 2E76B 2B76D 3GF3A 1EXIA 4YSXD 4PV1C 3EWKA 3AE9C 4H0LC 4I7ZB 3Q5SA 4H13B 3AEAD 3AE1D 4TT3H 1KFYC 4YSZC 1IK7A 3AE7C 3R4YA 1YQ4D 1VF5C 3C8VA 3Q3DA 3H25A 1NEKC 3AE5D 2WQYC 2QSIA 2MKVA 3AEFC 1FDOA 3GLMA 2QJKC 4OGQC 1KTMA 2E75B 2ACZC 2WP9D 3RK3E 2H89D 2WDVD 4YSYC 1S1CX 4IL6X 4KX6D 1WMKA 4H44C 4YXDD 1Y9BA 3D71A 4YT0D 1PV3A 3ABVC 5L8RJ 2E75D 5C3JC 3O6QA 1AJYA 1OMIA 3GMAA 2BS4C 2WSCJ 3AE3D 2WDQD 4YSXC 2OQQA 3P4RD 2E74B 2YIUC 3D6ZA 3AE1C 3AEAC 1KQGB 3D70A 1L0VD 1E7PC 1TU3F 1YQ4C 1ZOYC 1VL2A 1DD4A 3AEBD 2ZT9D 1ZP0D 3GF7A 2D2CB 3AE5C 2QJPC 1FDIA 3VRBD 2E76D 2WP9C 2QIWA 1EXJA 1YQ3D 4U7JA 1NEND 2H89C 2NZ2A 3AEEC 3VRAD 3AE4C 2WDVC 3AEGD 3IAOA 1OW8A 4H13D 1KORA 1QLBC 2D2CD 3AE2D 2G8YA 1K05A 2FBWD 1HJ0A 1R8EA 4KX6C 3VR9D 2O01J 2WSEJ 1KQFB 4YXDC 3SFED 3S9OA 3SFDD 4YTMD 1MKMA 3Q5PA 2BEZF 3AE3C 2WDQC 1K04A 2JO1A 4PV1B 3P4RC 4H0LB 2YMKA 3Q1MA 2WS3D 1Q90D 2B76C 1L0VC 1JB0J 1VF5B 1RQVA 2FYNC 3AEBC 1ZP0C 2ZT9C 3CIRD 4PV1D 1OW7A 5KKZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AE6 D;  1YQ3 C;  4YTN D;  1NEN C;  1KF6 D;  3AEC D;  3VR8 C;  3AE2 C;  3AE8 D;  2FBW C;  3AEF D;  3VR9 C;  2WU5 D;  3SFE C;  3SFD C;  4YTM C;  4YT0 C;  4YSY D;  3P4S D;  2WDR D;  3AED D;  2WS3 C;  5C2T D;  2WU2 D;  2H88 D;  3P4P D;  1OW6 A;  4YTP D;  3CIR C;  3P4Q D;  3AE6 C;  4YTN C;  1ZOY D;  3B71 A;  1KF6 C;  3AE9 D;  3AEC C;  3VRB C;  1KFY D;  4YSZ D;  3AE8 C;  3AE7 D;  2WU5 C;  3VRA C;  3AEG C;  1NEK D;  2WQY D;  3AEE D;  3AE4 D;  2ACZ D;  2BS3 C;  3P4S C;  3AED C;  2WDR C;  5C2T C;  2WU2 C;  2G3A A;  2H88 C;  3P4P C;  4YTP C;  2BS2 C;  5C3J D;  3P4Q C;  3ABV D;  2B76 D;  4YSX D;  3AE9 C;  3AE1 D;  3AEA D;  1KFY C;  4YSZ C;  3AE7 C;  1YQ4 D;  1NEK C;  3AE5 D;  2WQY C;  3AEF C;  1KTM A;  2WP9 D;  2ACZ C;  2H89 D;  2WDV D;  4YSY C;  4KX6 D;  4YXD D;  5C3J C;  4YT0 D;  1PV3 A;  3ABV C;  2BS4 C;  3AE3 D;  2WDQ D;  4YSX C;  3P4R D;  3AE1 C;  3AEA C;  1L0V D;  1E7P C;  1YQ4 C;  1ZOY C;  3AEB D;  1ZP0 D;  3AE5 C;  3VRB D;  2WP9 C;  1YQ3 D;  1NEN D;  2H89 C;  3AEE C;  3VRA D;  3AE4 C;  2WDV C;  3AEG D;  1OW8 A;  3VR8 D;  1QLB C;  3AE2 D;  4KX6 C;  1K05 A;  2FBW D;  3VR9 D;  4YXD C;  3SFE D;  3S9O A;  3SFD D;  4YTM D;  3AE3 C;  2WDQ C;  1K04 A;  3P4R C;  2WS3 D;  2B76 C;  1L0V C;  3AEB C;  1ZP0 C;  3CIR D;  1OW7 A; 
#chains in the Genus database with same CATH topology
 3I56 P;  3CC7 P;  2AXT E;  2QJY C;  2XV5 A;  1G1J A;  2B89 A;  1OZH A;  5KAF E;  3AED D;  5AW8 B;  2IYO A;  4M3L A;  2OGU A;  1OX3 A;  1VQ8 P;  2CPS A;  1ZXG A;  1OVR A;  2K37 A;  2E74 C;  2WZ7 A;  2YMY A;  1SFC D;  1NTK E;  2IBZ E;  2MJZ A;  3VOP A;  2KSE A;  5GTI E;  3RK3 C;  1MZ9 A;  2ZYD A;  5AVZ B;  1SLQ A;  1YBK A;  2LXB A;  5KAI E;  3KPE A;  2GA1 A;  1S3J A;  4Z1M H;  3H1I J;  1G1I A;  3L70 J;  1QVG O;  3I5C A;  1SS1 A;  1M56 D;  1NU1 E;  2E75 B;  2Z4E A;  5TIS E;  3L72 G;  3H32 A;  2XND H;  1XTG B;  1PV3 A;  3GMA A;  2H7H A;  2QRX A;  1KQG B;  1E7P C;  2ZFY A;  3A5T A;  1SQV G;  3M9H A;  4AUW A;  1YQ3 D;  2PAJ A;  2WPQ A;  3AEG D;  3L70 D;  4ASV A;  2O01 J;  3S9O A;  2N1T A;  2RH0 A;  2YMK A;  2HFE D;  5AVV B;  2O1K A;  2E76 C;  1SQX E;  2KUB A;  1KF6 D;  5AW1 B;  4DDG A;  3VR9 C;  2OTL P;  2PFX A;  1GZL A;  4YSY D;  1NHL A;  2QJP B;  4GKG A;  3U1A A;  5CHX A;  5GTH E;  3TGU E;  4H0L D;  3L72 J;  4I6L A;  2UWJ E;  2N1T B;  3L75 E;  3AEE D;  1LT9 C;  1IFI A;  1S5L H;  1NTM K;  2FYN B;  2ZT9 B;  1SQV J;  5C3J D;  2ZVN B;  1T2K C;  2VRS A;  1X8Y A;  2SPZ A;  4UB6 H;  1K73 Q;  2HYN A;  1BCC G;  4EYY Q;  3G6E P;  1N86 A;  3LW5 H;  5B5E H;  3HD7 D;  3Q3D A;  3GLM A;  5APU A;  1BGY G;  2LR2 A;  5CCG C;  1QVF O;  2JJL A;  1SQB K;  1CW5 A;  2POH A;  2R32 A;  3AE3 D;  2WDQ D;  3B5N C;  3GHG B;  2YKQ A;  2K9J A;  1DEB A;  1ZRT D;  1SQV D;  2BCC G;  2HPC A;  3PP5 A;  2YXQ B;  4D6T D;  3CCM P;  3AE4 C;  1L0L J;  2D2C D;  3AE2 D;  3CXH D;  3CCL P;  3RBZ A;  2QM8 A;  1PGJ A;  1LTJ A;  2NPS A;  3H1I E;  3VMX A;  4PV1 D;  1UII A;  3M91 A;  2PGD A;  3L70 E;  1JM0 A;  5C39 A;  4I7Z C;  4H13 C;  1P84 H;  1FZB A;  2K9J B;  2JEE A;  1BCC J;  1AV1 A;  4WBA A;  1VQM P;  1NU1 K;  4W7Y A;  3CCV P;  2XDJ A;  4BWN A;  5AW2 B;  1NJI Q;  1H8A A;  1M57 D;  1ZR2 A;  1ZOY D;  1KIL E;  4R4L A;  1LGH B;  3JC2 2;  1LTJ B;  2BS3 C;  3CCQ P;  3CME P;  3L74 D;  3V2N A;  1LTA C;  2BCC J;  2BS2 C;  3VP8 A;  1EXI A;  4JF7 A;  4DHJ A;  1KIL B;  3Q5S A;  3AEA D;  4RO0 A;  1KFY C;  3OW2 O;  3CCE P;  1PP9 G;  3JCU E;  4IOI H;  5CCH D;  2HG5 D;  2ZFC A;  3TNU A;  3RL0 C;  1BGY D;  2Z5I A;  3FWN A;  3KXD A;  5APS A;  1IJD B;  1U7M A;  2V4H A;  1SQX K;  1IFD A;  2WSC J;  3P4R D;  1LTS C;  1USE A;  5AW0 B;  4PJ0 E;  3AEB D;  3KZI H;  5CBO A;  3I55 P;  3AE5 C;  3L72 E;  3MD0 A;  1IFM A;  3VR8 D;  1NTM G;  4WVZ A;  4EIJ A;  1URQ D;  3CWB G;  1H0T A;  2OYI A;  4YTM D;  1N2D C;  2BEZ F;  1HJB A;  1K04 A;  2NRG A;  4W7Z A;  3TNU B;  3H1H G;  3Q1M A;  1SQV E;  2C9L Y;  2IYP A;  2AXC A;  3HUS C;  3L36 A;  3BRV B;  2M0B A;  2AEJ A;  2WSF J;  1KYO E;  1JCD A;  1GK4 A;  3AE8 D;  3TF5 A;  1HF9 A;  2WU5 D;  4LGD E;  1SQB G;  5BU8 B;  1M1K Q;  2YXR B;  2YIU B;  4WWI A;  2ZYA A;  2WDR D;  2BEQ D;  2E5T A;  1PP9 J;  4DHI B;  1P84 I;  2OYI B;  1USD A;  1FC2 C;  1DD3 A;  3KQG A;  2W6J H;  3VRB C;  4R4M A;  1MUU A;  2OYH B;  3MUD C;  3AED C;  3PH0 A;  2B87 A;  2A45 G;  2V7Q J;  3TDK A;  2GM4 A;  5AVX B;  1NTM J;  1SFC C;  3CWB J;  2QJY B;  1RF0 C;  1PP9 D;  3S1K A;  2ITA A;  4DJG A;  2MKV A;  1SQQ D;  3H1H J;  1BSN A;  3RK3 E;  2WPR A;  4EOT A;  4PD4 D;  2WSE H;  3MIW A;  2M5A A;  3B4S A;  1KFN A;  4JYB A;  4AQR D;  5AW3 B;  2E74 B;  1NO4 A;  1KB9 H;  3D70 A;  1SQB J;  2B87 B;  1BGY E;  2WWW A;  3A0B H;  3RK3 B;  3N4X A;  4ZNC A;  2IZ0 A;  1QEX A;  3QWO C;  2C0X A;  3VMZ A;  2BCC E;  2RKL A;  5B66 H;  3CX5 D;  1VDF A;  2M5A B;  3BCC D;  3CIR D;  1OXZ A;  5KKZ C;  2HLO A;  1HUC A;  2C9N Y;  1YQ3 C;  3QH9 A;  1QX8 A;  3V6I A;  2Y9Z A;  1JY2 O;  3P4P D;  3HE4 A;  2WTY A;  3P4Q D;  3E1R A;  1FE6 A;  1T3J A;  3W67 A;  1KF6 C;  4JQ0 D;  1AFO A;  2I8D A;  2B9B A;  1RHZ B;  5AVR B;  1LP1 A;  3RK2 D;  1J2J B;  1LT9 A;  2QEX P;  2E76 B;  3UIA A;  4H0L C;  3VYI A;  2QE7 H;  3ITK A;  1FS0 E;  1XTC C;  2WMM A;  1JY3 P;  1SQV K;  2QJK C;  2WP9 D;  1RF1 C;  5C3J C;  2BAS A;  2E75 D;  4NPF X;  4K35 A;  1OMI A;  5CCG A;  4UB8 H;  1PP9 E;  1M1J C;  1ZV8 A;  3HD7 C;  1LP1 B;  1ZP0 D;  1VQ5 P;  1SQX J;  1KZU B;  1LT9 B;  4PD4 E;  1IFP A;  4ZKU A;  1HBW A;  2KI7 B;  3BAT A;  3T97 A;  3PRJ A;  3WMM 0;  4LLH A;  1FBM A;  1Q86 Q;  3C1L A;  1KB9 I;  2E5Y A;  3AE3 C;  2WDQ C;  3PTZ A;  2B76 C;  1NTZ G;  2KLV A;  4L76 A;  2ZAE B;  3SSU A;  4JBZ A;  1NTM E;  3CWB E;  1M8O B;  3AEC D;  1YJ9 P;  3AE2 C;  3Q5R A;  3H1H E;  3B5N B;  1PL5 A;  3CX5 E;  3SWY A;  3P4S D;  3T97 B;  4JYC A;  5GTH H;  1SQP D;  3Q2Y A;  4DZO A;  3CC4 P;  1SQB E;  2E42 A;  1W2E A;  1N7S D;  1AVO A;  2P2U A;  1JTH A;  1VF5 D;  3A2A A;  1LWU C;  1N7L A;  2K3R A;  2IBZ I;  2FXP A;  5APT A;  1PIX A;  4H44 D;  2IFN A;  1NAY A;  5DJU B;  4DOJ A;  4YSX D;  2LXC B;  4I7Z B;  1RE4 C;  4H13 B;  1S9K D;  1NTZ J;  1QGK B;  3P8M C;  1EQ7 A;  2KS1 A;  1JTH B;  1FZC C;  1L4A D;  5KLV D;  3G4S P;  2BS4 C;  2QM7 A;  3AEA C;  1VL2 A;  2FYZ A;  5CCH C;  4KHX A;  1YTZ I;  1X79 B;  2QIW A;  2L5G B;  1HGZ A;  2Q5U A;  1OW8 A;  3O8Z A;  1K05 A;  3SFE D;  1GDT A;  3P4R C;  3NTN A;  1NTZ D;  4U3F D;  1NH4 A;  2O1J A;  3AEB C;  4EI2 A;  2KS1 B;  1YIJ P;  3RL0 B;  4YTN D;  1H89 A;  3VR8 C;  1UIX A;  1FJK A;  1S2E A;  2R44 A;  3HUS A;  1URQ C;  4D6T G;  2Q7C A;  4YTM C;  5KLI C;  4HH2 A;  5KJ7 D;  2KLU A;  2AEF A;  2P67 A;  5E79 E;  5APX A;  3CD6 P;  2FYU G;  3AE8 C;  2R3C A;  2WU5 C;  3VON A;  2WQY D;  2O01 H;  2ZYG A;  2ACZ D;  1NVO A;  1SQQ K;  5CMZ A;  2WDR C;  3TYY A;  4WB4 A;  2NPS D;  3HUS B;  1VQN P;  3EFG A;  4TT3 H;  3IF4 A;  1KV4 A;  2XU6 A;  1KQL A;  2AEM A;  1SFC A;  1RF0 A;  4ZKP A;  3G71 P;  1S1C X;  2XNX A;  3GHG A;  1K8A Q;  3L71 D;  4YT0 D;  3L74 G;  3RBX A;  2J59 M;  3CMA P;  1N73 C;  1OWA A;  1S9K E;  4DCK A;  4PJ0 H;  1W2B O;  4D6T J;  1IZN B;  1HTL C;  1ZR4 A;  1BDD A;  1GD2 E;  1QL2 A;  3VRA D;  4HYT B;  1KQF B;  3B8E B;  3SFD D;  3V4W A;  2FY8 A;  2FYU J;  1SFC B;  2M8R A;  1JCC A;  4C7N A;  1KYO H;  1JMM A;  1GMJ A;  2IZ1 A;  3C9I A;  3AEF D;  1E5W A;  2WVR A;  1NTZ E;  1DH3 A;  3CIR C;  3MHV A;  5CJ4 A;  4XFJ A;  1KN7 A;  3AE9 D;  4N6J A;  3H1K D;  2FYU D;  4C7N B;  1ZME C;  3L74 J;  2JP3 A;  2QA4 P;  2IDB A;  4OGQ D;  1VQO P;  2JWD A;  2YNY A;  1KIL A;  3P4P C;  4HB1 A;  3P4Q C;  3ABV D;  5KKZ B;  1J1D C;  1HH0 A;  4RES B;  1BGY J;  3NMD A;  3CI9 A;  2N9Y B;  3CCS P;  1RE3 A;  1MFZ A;  3RK2 C;  1Y8A A;  4KX6 D;  5AW9 B;  5H2F H;  1P84 D;  4XE5 B;  4W80 A;  1RF1 A;  5DJT B;  1GL2 D;  3O6Q B;  1YJW P;  4I6M C;  1EZV I;  2WP9 C;  1RH5 B;  1M1J A;  4O9B A;  4U7J A;  1SQQ G;  3HD7 A;  2FBW D;  3KDP B;  1PPJ D;  4Y99 C;  4H0L B;  3K5B A;  1RQV A;  4LDT A;  1ZP0 C;  3USS A;  3A3Y B;  5AW5 B;  2QJK B;  2Q1K A;  1SQP K;  3CCJ P;  4IFF A;  1RF1 B;  2W6A A;  2N9B A;  3CCR P;  1MV8 A;  1EC5 A;  1KYO I;  3M9Q A;  3F5H A;  1M1J B;  3HD7 B;  2H88 D;  3P8C D;  1ZRT E;  4UB6 E;  1T6A A;  3BCC G;  4D6T E;  2OYH A;  3AEC C;  3OJA B;  3CXH E;  2JR8 A;  3R2P A;  1E79 H;  4HKZ H;  3P4S C;  2R5D A;  2C0W A;  1GW3 A;  3E7K A;  4GT1 A;  2FFD C;  2FYU E;  1SQQ J;  2K1A A;  1N7S C;  2WSF H;  1VF5 C;  5BVZ A;  2PRR A;  3H25 A;  4B86 A;  4GIF A;  2W6B A;  1AA0 A;  3WUT A;  4H44 C;  1YI2 P;  4YSX C;  1FZC A;  2KZI A;  1DD4 A;  1NTZ K;  3HE5 A;  1YIT P;  1YTZ T;  1LWU B;  1FDI A;  1NEN D;  3L74 E;  2KP8 A;  1BE3 D;  2ZXX A;  1P84 E;  5CCH A;  2WSE J;  3BCC J;  1L4A C;  1DX7 A;  1ZN5 A;  1PGQ A;  4YPC A;  2V7Q H;  2WSS H;  5AVT B;  2JWA A;  4NPD A;  3TK1 A;  3AE6 D;  2OTJ P;  5APY A;  1LJ2 A;  1FZG A;  1FZC B;  3SFE C;  4DT0 A;  3HE5 B;  2P10 A;  1J1E C;  3V4Q A;  3L37 A;  2K9Y A;  1JOC A;  4GDO A;  2WU2 D;  1URQ A;  5AVW B;  3II6 A;  3A0H E;  1FOS F;  4YTP D;  4TLF A;  2J5U A;  2FXO A;  1LTT C;  1L0N D;  2KYV A;  4RKU J;  3KYQ A;  4WY4 D;  4YTN C;  4GOD A;  3ZDM A;  2HR3 A;  2A06 G;  3AE7 D;  1QLE D;  2AXT H;  2JDI H;  1KB9 D;  3AEG C;  3AE4 D;  5KJ7 C;  5KAF H;  3JSV C;  2OTK E;  4BXL A;  4IL6 E;  1T8Z A;  2M3E A;  1NGM B;  1EDL A;  1ZLL A;  3GF3 A;  3V2Q A;  1SQP G;  3AE1 D;  1URQ B;  4L75 A;  2A45 H;  1GTW A;  3KZI E;  2WQY C;  5KLI B;  1HGV A;  2ACZ C;  3P7K A;  1Y47 A;  5GTI H;  1EDJ A;  2FKW B;  3V2R A;  1JO5 A;  2H89 D;  4L74 A;  2WDV D;  4YSY C;  5KAI H;  2NPS C;  4YXD D;  3D71 A;  1OVU A;  5AVS B;  1TFF A;  1TU3 F;  2IPP A;  1ZW0 A;  2ZVO B;  1N73 A;  2WIT A;  3IFM A;  3AEE C;  5TIS H;  3IAO A;  1NTK D;  2IBZ D;  2G8Y A;  3GW6 A;  2W83 C;  2JO1 A;  4N78 D;  5KLV G;  1S72 P;  3G3Z A;  2P1J A;  2IX7 C;  1SQQ E;  1FOS E;  1BE3 E;  1KQS O;  3B5N A;  3P32 A;  3CL3 D;  2FYU K;  3RL0 D;  3MGN A;  3SFD C;  5APQ A;  1N73 B;  1SQP J;  2CK3 H;  5C2T D;  1SP4 A;  4U3F G;  4DDI A;  2A06 D;  2OAR A;  1EDI A;  2D2C C;  3WU2 E;  3PJS K;  2KNC A;  1Z56 A;  1VQP P;  2LKM A;  3BCC E;  4PV1 C;  3AE9 C;  3L73 D;  2KXP B;  3SWF A;  1JEK A;  2R3S A;  5CJ0 A;  3M0A A;  3A0B E;  4OGQ C;  5KLV J;  1GK6 A;  1HVV A;  1KC8 Q;  1JY2 P;  2N1T D;  1LTB C;  2QG4 A;  3FXE A;  3EQ2 A;  3ABV C;  3M0D C;  2P58 A;  2A45 I;  1NOH A;  1VQ7 P;  2KNC B;  3VN0 A;  1L0V D;  1ZOY C;  3CLQ A;  1JY3 N;  2ZT9 D;  1R5L A;  3VRB D;  3HRN A;  1EXJ A;  3TGU D;  3L75 D;  1QLB C;  4KX6 C;  1Q82 Q;  4U3F J;  1GU5 A;  1J1D B;  3L71 G;  4IFD K;  5EFW B;  2WS3 D;  1Q90 D;  1IO4 A;  1GL2 C;  2H43 A;  1KFM A;  2J58 A;  1OW7 A;  3EFF K;  2W8Z A;  3VP9 A;  3RK2 B;  2FBW C;  4N78 E;  3BRT B;  1U57 A;  2L91 A;  1VQL P;  3CPW O;  3M06 A;  1A02 F;  2Y0E A;  4KT0 J;  1EZV G;  4YSZ D;  3FGA D;  1MFT A;  2KZJ A;  2E43 A;  4Y99 B;  4GOF A;  2H88 C;  1X0T A;  2WT7 A;  2A06 E;  4UB8 E;  1S4X A;  2FFD A;  4K3A A;  3H1K G;  3H1I D;  1JY2 N;  3FXD A;  3L71 J;  1X22 A;  3NFQ A;  1FDO A;  1KTM A;  2Z5H A;  1N7S A;  4N3Y B;  2YO3 A;  1SQP E;  3L73 E;  3RGU A;  1VPC A;  3H1J G;  3H32 B;  3SWK A;  2CPB A;  3MUD A;  2QVA A;  3GF7 A;  3OA7 A;  3JCU H;  2WT7 B;  1KIL D;  1KOR A;  1VQ4 P;  2FFD B;  2Y0C A;  2Y9Y A;  5AVY B;  4GOE A;  1L0L G;  2YKO A;  2YKP A;  1N7S B;  1JB0 J;  1VF5 B;  1L4A A;  3HTK A;  4OH8 B;  3LW5 J;  3N7N A;  5AW4 B;  1FZF A;  1L0N K;  1NEN C;  2ZXE B;  5CBN A;  4C7R A;  4H44 B;  2I1K A;  1LTG C;  5KLV E;  2WPV B;  1KMI Z;  2Q3I A;  4NPE A;  3D6Y A;  1PPJ G;  4MN4 C;  5KTB A;  2YO2 A;  5AVU B;  3H1K J;  3VMY A;  3V5B A;  2R5B A;  3AE6 C;  4L73 A;  3MTU E;  1EZV D;  2HOD A;  1EDK A;  1Q2N A;  3CXH H;  2Y0D A;  1JNM A;  3RL0 g;  1L4A B;  1NEK D;  3OAK A;  3HTK B;  1N8R Q;  3L72 D;  2JKV A;  3H1J J;  2RN0 A;  2WU2 C;  4U3F E;  2Q9I A;  3FWL A;  4YTP C;  5KJ7 A;  3H1L G;  1FAV A;  2B76 D;  1YJN P;  4WY4 C;  3AE7 C;  1YQ4 D;  1PZQ A;  1J1E B;  1KYO D;  2HOD B;  1NTK K;  4JPZ B;  5L8R J;  1DEE G;  3O6Q A;  4YXW H;  1LT1 A;  4FJV A;  2OQQ A;  3H1J D;  3AE1 C;  1NAF A;  1D7M A;  4LC1 A;  3FX0 A;  4RJT A;  2H89 C;  2NZ2 A;  2WDV C;  1JMB A;  4YXD C;  5APW A;  1AVY A;  2HPC B;  3Q5P A;  1L0L D;  2XKM A;  1X9V A;  4HJG H;  3M9B A;  1M90 Q;  1G2C A;  2E74 D;  5K5G B;  4DHZ A;  3W68 A;  2NPS B;  2O01 N;  3L71 E;  3H1L J;  1BE3 G;  2E75 C;  3A0H H;  3RK3 D;  2OYO A;  4OWF A;  1OW6 A;  1BCC D;  3PHL A;  3WUV A;  2KIK A;  1DIP A;  2KSJ A;  3G9R A;  1SVF A;  1PGO A;  3NXS A;  1G2C B;  4IL6 H;  1PFI A;  4A7P A;  5C2T C;  1S5L E;  2G3A A;  2Q6Q A;  1VQ6 P;  1EZV E;  2WSC H;  3CXH I;  3H1L D;  5APV A;  1WRG A;  1L0N G;  2BCC D;  5B5E E;  5AW7 B;  3MZW B;  1OIP A;  1FZA A;  4IFM A;  2H8P D;  1M7L A;  1U7J A;  3A7O A;  1FDM A;  1AJY A;  1LWU A;  3H1K E;  1Q7Y Q;  5KLV K;  3M0D A;  1BE3 J;  2D2C B;  2QJP C;  4OVN F;  1CI6 A;  2E76 D;  1YHQ P;  4EDF A;  1FU1 A;  2N1T C;  1RE4 A;  3VR9 D;  1HJ0 A;  1QL1 A;  3H1J E;  1MKM A;  4PV1 B;  2ZJS E;  1NWQ A;  1L0V C;  4BRY A;  2IFM A;  1H0T B;  2FYN C;  2ZT9 C;  4C46 A;  3L35 A;  4OGQ B;  4PD4 H;  3WUU A;  5M1B A;  2W27 A;  1GL2 A;  3L4F A;  5TJH A;  2KK7 A;  1RY3 A;  3U1C A;  2KOG A;  1L0L E;  1JY3 O;  1NTK G;  2IBZ G;  3MP7 B;  1L0N J;  4QMA A;  1CI6 B;  2WS3 C;  1AQ5 A;  1RQU A;  1FZE A;  1T2K D;  1NYH A;  3B71 A;  1IK9 A;  4KJM A;  3GHG C;  3TSI A;  3WU2 H;  4BRY B;  4I1L A;  1PPJ E;  1S5L X;  1AQT A;  3CX5 H;  1BCC E;  1NU1 G;  1GL2 B;  5CCG D;  3IN6 A;  1GW4 A;  5H2F E;  3H6P A;  3CC2 P;  2Q3E A;  2M3B A;  3B5N D;  1IFJ A;  4YSZ C;  3C8V A;  2W90 A;  3S4R A;  2QSI A;  1NTM D;  1CZQ A;  3CWB D;  3H1L E;  1NKZ B;  3P8C E;  4XA4 A;  2RMZ A;  3H1H D;  1Q81 Q;  2WPS A;  2FXM A;  5BU5 A;  1NTK J;  3L73 G;  1WT6 A;  1JUN A;  1SQB D;  2XZR A;  4H13 D;  1SQX G;  1R8E A;  1LTJ C;  1YYC A;  3BAS A;  1R5S A;  1HWT C;  1L2P A;  3VTP C;  2DW3 A;  1OFC X;  4AYC A;  1NU1 J;  1IC2 A;  3GG2 A;  1KIL C;  3LIE A;  3TGU G;  3PLN A;  3L75 G;  2I1J A;  4YT0 C;  2K88 A;  4PD4 I;  3IR9 A;  4I2L C;  1T3U A;  1RE3 C;  1PGP A;  2PP6 A;  3HE4 B;  1NKN A;  1KFY D;  4Y28 J;  1W5C E;  3VRA C;  3V2P A;  5AVQ B;  2O3J A;  1NU1 D;  3CCU P;  4ASW A;  3L73 J;  5E79 H;  1OVV A;  1IFN A;  1LTI C;  3EWK A;  3CX5 I;  1IK7 A;  3R4Y A;  2GUV A;  1NEK C;  3AE5 D;  4WY4 A;  3AEF C;  3F89 A;  1H88 A;  4IL6 X;  3E1I A;  1WMK A;  1Y9B A;  1FJP A;  1L0N E;  1VQ9 P;  1BSH A;  2YIU C;  3D6Z A;  1VQK P;  1L0L K;  4ZMD A;  2P7J A;  3TGU J;  2KB7 P;  2GUS A;  1YQ4 C;  3KHU A;  1KB9 E;  3L75 J;  3BVH A;  5AW6 B;  1A02 J;  3LID A;  1GU4 A;  2OYI C;  3H1I G;  2B88 A;  1K9M Q;  1SQX D;  3VMA A;  3L70 G;  1KD1 Q;  1CSB A;  3U59 A;  1LNQ A;  4WY4 B;  1BDC A;  2OYH C;  5B66 E;  4CPG A; 
#chains in the Genus database with same CATH homology
 1GMJ A;  4OGQ B;  3LW5 J;  3AE6 D;  5M1B A;  2E76 C;  1YQ3 C;  4YTN D;  1NEN C;  2WSF J;  2E74 D;  1KF6 D;  4I7Z C;  3AEC D;  4H13 C;  3VR8 C;  1UIX A;  3AE2 C;  2FBW C;  4H44 B;  3AE8 D;  1HF9 A;  2WU5 D;  3AEF D;  3VR9 C;  2QJY C;  3SFE C;  3Q5R A;  3SFD C;  2WPV B;  2P10 A;  1KMI Z;  4YTM C;  5KLI C;  1PL5 A;  4YT0 C;  4YSY D;  1U57 A;  2E75 C;  2K9Y A;  3P4S D;  2WDR D;  3AED D;  3D6Y A;  2WS3 C;  3T97 B;  2BEQ D;  5C2T D;  4GDO A;  2WU2 D;  2H88 D;  1RQU A;  3P4P D;  1OW6 A;  1ZRT E;  4YTP D;  3CIR C;  3P4Q D;  2J5U A;  3AE6 C;  4KT0 J;  3Q2Y A;  4RKU J;  4XFJ A;  4YTN C;  1NYH A;  1ZOY D;  1KIL E;  1DD3 A;  2E74 C;  3B71 A;  4H0L D;  4R4L A;  1DIP A;  1KF6 C;  3AE9 D;  3AEC C;  1ZME C;  1KFY D;  3FGA D;  4R4M A;  3VR8 D;  4Y28 J;  3AE8 C;  3AE7 D;  3VRB C;  4YSZ D;  1VF5 D;  2WU5 C;  2JP3 A;  3G9R A;  3RL0 g;  3VRA C;  3AEG C;  1NEK D;  2IDB A;  2WQY D;  1S5L X;  2D2C C;  3AEE D;  3AE4 D;  4OGQ D;  2ACZ D;  2BS3 C;  3P4S C;  3AED C;  2WDR C;  5C2T C;  2FXP A;  2WU2 C;  3IN6 A;  2G3A A;  1PIX A;  2H88 C;  3P4P C;  2ZT9 B;  4H44 D;  4YTP C;  2BS2 C;  5C3J D;  3P4Q C;  3ABV D;  1NGM B;  4Z1M H;  2V7Q J;  2E76 B;  2B76 D;  3GF3 A;  1EXI A;  4YSX D;  4PV1 C;  3EWK A;  3AE9 C;  4H0L C;  4I7Z B;  3Q5S A;  4H13 B;  3AEA D;  3AE1 D;  4TT3 H;  1KFY C;  4YSZ C;  1IK7 A;  3AE7 C;  3R4Y A;  1YQ4 D;  1VF5 C;  3C8V A;  3Q3D A;  3H25 A;  1NEK C;  3AE5 D;  2WQY C;  2QSI A;  2MKV A;  3AEF C;  1FDO A;  3GLM A;  2QJK C;  4OGQ C;  1KTM A;  2E75 B;  2ACZ C;  2WP9 D;  3RK3 E;  2H89 D;  2WDV D;  4YSY C;  1S1C X;  4IL6 X;  4KX6 D;  1WMK A;  4H44 C;  4YXD D;  1Y9B A;  3D71 A;  4YT0 D;  1PV3 A;  3ABV C;  5L8R J;  2E75 D;  5C3J C;  3O6Q A;  1AJY A;  1OMI A;  3GMA A;  2BS4 C;  2WSC J;  3AE3 D;  2WDQ D;  4YSX C;  2OQQ A;  3P4R D;  2E74 B;  2YIU C;  3D6Z A;  3AE1 C;  3AEA C;  1KQG B;  3D70 A;  1L0V D;  1E7P C;  1TU3 F;  1YQ4 C;  1ZOY C;  1VL2 A;  1DD4 A;  3AEB D;  2ZT9 D;  1ZP0 D;  3GF7 A;  2D2C B;  3AE5 C;  2QJP C;  1FDI A;  3VRB D;  2E76 D;  2WP9 C;  2QIW A;  1EXJ A;  1YQ3 D;  4U7J A;  1NEN D;  2H89 C;  2NZ2 A;  3AEE C;  3VRA D;  3AE4 C;  2WDV C;  3AEG D;  3IAO A;  1OW8 A;  4H13 D;  1KOR A;  1QLB C;  2D2C D;  3AE2 D;  2G8Y A;  1K05 A;  2FBW D;  1HJ0 A;  1R8E A;  4KX6 C;  3VR9 D;  2O01 J;  2WSE J;  1KQF B;  4YXD C;  3SFE D;  3S9O A;  3SFD D;  4YTM D;  1MKM A;  3Q5P A;  2BEZ F;  3AE3 C;  2WDQ C;  1K04 A;  2JO1 A;  4PV1 B;  3P4R C;  4H0L B;  2YMK A;  3Q1M A;  2WS3 D;  1Q90 D;  2B76 C;  1L0V C;  1JB0 J;  1VF5 B;  1RQV A;  2FYN C;  3AEB C;  1ZP0 C;  2ZT9 C;  3CIR D;  4PV1 D;  1OW7 A;  5KKZ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...