1ZOYC

Crystal structure of mitochondrial respiratory complex ii from porcine heart at 2.4 angstroms
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Mitochondrial Respiratory Membrane Protein Complex II
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords FAD-binding protein
total genus 50
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2005-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1zoyC01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 1zoyC02
4YXDD 3AECC 2H89C 3AEDC 1L0VC 3AEGC 1KTMA 4YT0D 4YTMC 2WDQD 4YTMD 2WDRC 3P4SD 1YQ3D 2WS3D 4KX6C 3B71A 1ZP0C 1ZP0D 3AEAD 3AEAC 3AEDD 3VRBC 5C3JD 3P4RC 4YSXD 1YQ4D 1QLBC 3P4PD 4YT0C 3VR9D 3AE7C 1KF6D 2WP9C 3AE9D 4YSYC 3AE9C 4YSYD 1K04A 2WQYC 2BS4C 3AE4D 4YSZC 3AE6D 3AEED 2FBWC 1NEKD 3AECD 3AE8C 2WU5C 2ACZC 4YTPD 4YTPC 2H88C 1PV3A 2WU5D 3VRAC 4YTND 5C2TD 5C2TC 3SFDD 3AE2D 3AE3D 3SFDC 3VR9C 3VR8C 3S9OA 3ABVD 3CIRD 3P4SC 2FBWD 3AEFC 3AEFD 2H89D 1L0VD 1YQ3C 2B76D 1OW7A 3P4RD 3AE5C 1YQ4C 3AE5D 3P4PC 1OW8A 3VR8D 3VRBD 3AE1D 2WDVD 3AEBD 3AEGD 3AE4C 2WS3C 4KX6D 2BS3C 3P4QC 3AE8D 1OW6A 1NENC 1E7PC 1NEND 2ACZD 2WDRD 2BS2C 2B76C 1KFYD 4YSZD 3AE6C 4YXDC 2WU2D 3AE3C 3AE2C 2WU2C 1K05A 3AE1C 2H88D 1KF6C 3AE7D 3VRAD 3AEBC 2WDVC 5C3JC 3ABVC 3CIRC 3SFEC 1ZOYD 4YSXC 1ZOYC 2WQYD 3SFED 3AEEC 3P4QD 1NEKC 2WDQC 2WP9D 2G3AA 1KFYC 4YTNC
chains in the Genus database with same CATH superfamily
2JKVA 3L75G 1H89A 2NPSC 4WY4B 4OVNF 1NTKE 1SQVK 1YHQP 4L75A 3CXHI 3W68A 2WDQD 1HWTC 5KKZB 3WUUA 3NXSA 3AEAC 4DCKA 5DJUB 5M1BA 1X9VA 1MZ9A 3ZDMA 1G2CB 3AE7C 1SQBE 4YSYC 1SQPG 4GIFA 1BGYG 2QSIA 4UB6H 2FYUJ 4PV1B 3VMXA 3CC4P 1DD3A 1VQKP 2M0BA 1N8RQ 2BCCD 1NTKJ 1HH0A 1SQXJ 2BASA 3CWBD 3HRNA 2ZYGA 4OWFA 1R5SA 3AE5D 3C8VA 1JMBA 1YJWP 4C7RA 3AEBD 4GKGA 1NVOA 4LLHA 2NPSA 3LW5J 4U3FE 3L72G 5KTBA 3A5TA 1SQBJ 2XDJA 2YNYA 2H8PD 1PGOA 5BU8B 3QH9A 1LWUB 1K05A 1SQPE 2YKOA 1PPJE 2K1AA 1DD4A 1ZMEC 2ITAA 1L0NK 2KOGA 3I55P 5CCHD 3RGUA 2WSFH 3IFMA 1FBMA 1KFYC 3CPWO 1KB9I 4K3AA 4RJTA 4OGQC 4Y99B 1NAYA 2QJPB 2WPSA 2IYPA 1BGYD 1CSBA 1JEKA 4IOIH 1CI6B 5KLVJ 4D6TJ 2E5TA 2HPCB 2O01N 3F89A 4KX6C 1ZP0C 1ZP0D 3CWBE 3QWOC 1SQVJ 1EZVE 3E1RA 3P4PD 3GW6A 3CLQA 1URQC 4DHZA 1W2EA 3CCMP 3AE4D 2O1JA 3CD6P 2ZAEB 2FYZA 1PGPA 1N73B 3H1LJ 5APVA 4D6TD 2ZVOB 4DJGA 2JJLA 3L70J 1JTHA 2FY8A 4XE5B 3CIRD 2QJYC 2WPRA 1PPJG 5TISE 3TDKA 1RF1C 3WU2E 1SLQA 3AEFD 2FYUK 1N7SA 1YQ3C 2B76D 1BGYJ 2P67A 3EWKA 3VRBD 3RK3E 3AEGD 2B89A 3SWYA 1Q86Q 3Q1MA 3HE5A 3D6ZA 1JCDA 1NTKK 5B66E 2WPVB 2K9JB 4TT3H 4R4MA 2WDVC 1LWUA 1SQBK 3E7KA 5E79E 3G3ZA 1FDIA 1PP9J 2PP6A 2DW3A 1SQXD 1OFCX 2JR8A 1M7LA 2W8ZA 1WRGA 3TNUB 3M91A 1NWQA 3L4FA 1ZN5A 2P7JA 3P4RC 4ZNCA 1JY2N 1S9KD 1NHLA 2NRGA 2CPBA 4LC1A 1SQQG 2KLUA 1NTMD 2KB7P 5AVZB 3LW5H 3C1LA 2BEQD 2QJYB 3H1JJ 3Q2YA 3A7OA 1HBWA 4PJ0H 1ZRTD 3RK2C 2LKMA 3F5HA 1RQVA 2D2CD 2YXRB 1FZCC 1L0VD 2Y0EA 1SQPD 2GM4A 2O01H 1SFCA 4IFMA 1D7MA 5GTIE 1E5WA 5AW1B 3U1CA 3G71P 3GLMA 1NENC 1M8OB 3M06A 3L74J 4LDTA 5AVQB 2C9NY 1EDJA 4ZKPA 3AE7D 3VRAD 1NTKG 3CWBG 3L37A 1BCCJ 1RHZB 1ZOYC 1N7LA 2N9BA 1SQVE 1KQSO 2YMKA 3G4SP 1H88A 3B8EB 5AVSB 1NTME 5KJ7A 3MTUE 3U59A 4GODA 3M0DC 2BEZF 1VF5D 1R8EA 4U7JA 3L73G 3CCRP 4UB8E 2A06D 1L0NJ 2M3BA 1P84E 1KQFB 4PD4H 1SQBG 5KAFE 4MN4C 3GG2A 2WWWA 1YIJP 2YIUB 2Z4EA 3JCUE 2M8RA 2K3RA 3LIEA 3S4RA 2OYHC 3PTZA 5H2FH 3CX5D 3VRAC 2AXTE 1HGZA 3SFDD 2KSJA 2RMZA 1NH4A 5K5GB 1J1DC 3HE4A 2J59M 3CCSP 1YQ4C 1GL2A 2FYUG 2K9YA 4PV1C 1OMIA 1WMKA 1PP9E 1BDDA 1L4AC 3EFFK 2ACZD 1RF0A 3CXHD 1KFYD 1L0LJ 3R4YA 2WU2D 3MD0A 1IZNB 3MGNA 2V7QH 5KLVG 3TK1A 2JP3A 3JCUH 1SQQK 2BCCE 3Q5RA 5APUA 1GTWA 3HD7C 3L71D 3V2QA 1URQB 1HTLC 3BATA 1KTMA 1GK6A 1LJ2A 2W6AA 3MZWB 1RH5B 1QLED 3AEDD 3BCCE 1RY3A 4PD4I 5CMZA 1Y8AA 2AXCA 2Y9YA 1VQ9P 4RKUJ 1GL2C 1H0TA 3A3YB 3WUTA 1KORA 5BVZA 1GD2E 3RK2B 3TGUG 1SQXE 1ZLLA 1T8ZA 3T97B 4L76A 1NU1G 1LGHB 2OTKE 4RO0A 2R5BA 4FJVA 2IBZI 3VMZA 1KFNA 1URQD 2I1KA 1AJYA 2Z5HA 1NYHA 2NPSB 3HTKA 3H32B 3L71J 2N1TB 1BCCE 4U3FJ 1LTGC 2GUSA 2HPCA 1Q90D 1A02F 1JM0A 4H13B 1OW8A 2HLOA 4H44D 2E76D 2Q3IA 3AE1D 2WDVD 2IPPA 1S3JA 3D6YA 1S2EA 3P4QC 1KILB 1BE3E 1CW5A 1OW6A 1QVGO 2ZT9C 3BVHA 1GZLA 1T6AA 2O1KA 3OA7A 4PV1D 2E75C 3ABVC 3SFEC 3H1JG 3P8MC 3P4QD 2E76B 2P1JA 1T2KC 2IZ1A 2OYIB 5CCHA 2I8DA 3I5CA 2FFDC 1MKMA 1Y9BA 4H44B 5EFWB 1JOCA 5AW6B 2JO1A 2WDRC 1FZCA 4RESB 5APXA 3B71A 2I1JA 4DDIA 4CPGA 2B88A 3RK3C 3B5ND 4M3LA 1SQXK 5KLVE 5E79H 1SVFA 3CCJP 2WP9C 2WPQA 4HB1A 2ZXXA 3AE6D 2E5YA 1JMMA 2WU5C 4YTPD 2SPZA 2PRRA 5C2TD 5C2TC 2N1TC 3PHLA 1EXIA 4Z1MH 5B66H 1CZQA 3PJSK 3CCUP 3M0AA 1EDKA 2WT7B 1ZW0A 1USEA 1YYCA 2QJPC 3H1HJ 1EZVI 1OW7A 5B5EH 5CCGA 1QL2A 1IFJA 3PLNA 1IFPA 2QRXA 2FXOA 2YXQB 3VMYA 1ZV8A 2E75B 3E1IA 3H1IG 1NEND 1L0LG 3AE6C 3TGUD 2WU2C 3CXHH 4I7ZB 5AW8B 1HJBA 1KB9E 2Y0CA 2H43A 1SQPJ 3JSVC 4GT1A 2WT7A 1A02J 1S5LX 1M90Q 3KDPB 5KLIC 2E75D 3HUSB 3H1HE 1VDFA 2RKLA 1PFIA 1TFFA 1SQPK 5AW0B 4YTMD 4BRYA 4O9BA 4JYBA 1S5LE 3P32A 2WITA 1NU1E 2LXCB 2W90A 1E79H 1HJ0A 3P8CE 5CCGC 3KZIH 1K8AQ 3AEED 5KLVK 4WY4A 1PGQA 1PV3A 2WVRA 1URQA 3L74G 3AE2D 1M56D 3GF7A 2B87B 3VR8C 1KILD 1U7MA 1LP1B 4EIJA 1KB9D 1UIXA 2K88A 1VF5B 2NZ2A 3CL3D 1FZFA 2IFNA 4NPDA 1SS1A 1LT9B 5APTA 3D71A 3VR8D 5AVRB 2WS3C 1P84I 2JDIH 5CJ4A 2A45H 1IC2A 3CX5E 4B86A 5AVWB 4AUWA 1ZRTE 2OYIC 2WQYD 1QL1A 3H1JD 1YJ9P 3NFQA 3L74E 1L4AB 2HODB 4WWIA 2POHA 1DIPA 4L74A 1MFZA 3MP7B 1P84D 1USDA 4BRYB 1GW3A 1EDLA 1FZCB 1NTMG 4YT0D 1SQQD 3KXDA 1G2CA 2R5DA 3CC7P 1MV8A 3CX5H 3L73E 5C3JD 3USSA 1YQ4D 2V7QJ 4H0LC 1S1CX 2UWJE 3VR9D 4EOTA 3I56P 2HFED 4NPEA 3MHVA 2QVAA 2LR2A 1LTJA 3T97A 2ACZC 1IFDA 2WSSH 2OYIA 2QM8A 2Y0DA 5KAIH 4IFDK 1KN7A 1EXJA 5AW3B 1KILC 4HH2A 1EDIA 3ABVD 1RE3A 1UIIA 1KQGB 1PIXA 1RE4C 4GOFA 2K9JA 2AEJA 1FJPA 3U1AA 3KZIE 2Z5IA 4EYYQ 3H1LE 1RF1A 3L70E 2Q6QA 3JC22 1SQQE 4DOJA 2HYNA 4YSZD 1S5LH 1FU1A 4NPFX 2YO3A 3V2RA 2YIUC 1J2JB 4WY4C 2XKMA 2M5AA 3PH0A 1TU3F 1QEXA 2FYUE 3FWLA 2E43A 3EQ2A 3RK3B 3A0HH 2P2UA 4YXDD 3V2PA 1L2PA 4HJGH 2IBZD 3TSIA 1QVFO 2Y9ZA 3H1ID 1MUUA 1DEBA 2FYNC 1HVVA 3VONA 4K35A 1KB9H 4U3FD 2WMMA 1YBKA 3CXHE 1J1EC 3RL0g 2XV5A 1L0NE 4ASVA 3BRTB 5AVTB 1LTIC 1WT6A 4WY4D 4YSZC 1GW4A 3D70A 3AE8C 4YTPC 5B5EE 2WU5D 3L71E 2IFMA 1DH3A 1JY2O 1N7SB 1FDOA 3A2AA 3SFDC 3VR9C 2ZYAA 4TLFA 1JCCA 2L5GB 2H89D 4I6MC 3P4RD 3HE5B 1NTMK 2D2CB 2KIKA 2WZ7A 1OXZA 2BS3C 1OX3A 1FZEA 4Y28J 3O6QA 2B76C 3HUSC 1BSNA 1YI2P 2FXPA 3CIRC 1Q2NA 4EDFA 1L0LD 2O3JA 2WP9D 5L8RJ 1RF0C 2WTYA 5KJ7C 1NTZD 1X8YA 1M1JB 1FZAA 3FXDA 4JYCA 3TGUE 2IBZG 2OGUA 1PL5A 5AW4B 2OTLP 1L0LK 2PAJA 3M9QA 2OYHA 1NU1K 5CBNA 1XTCC 3CMEP 3B5NB 3BASA 5APSA 2KSEA 5KKZC 5KLIB 1VF5C 2W6JH 3GHGA 1LTAC 3L35A 4W80A 3HD7A 3FXEA 2KK7A 2OYOA 1OVUA 5AW5B 2WQYC 4YSYD 1VQ5P 1JTHB 5TJHA 1X22A 3GMAA 3V2NA 4YPCA 3VN0A 1LNQA 4ASWA 3S9OA 1S4XA 3TGUJ 1LT1A 1Q7YQ 4PD4D 2W27A 3L72D 5AW9B 2FFDB 1RF1B 3KQGA 3H1KD 4AQRD 5BU5A 3V4QA 3RL0B 2R44A 1AA0A 2ZJSE 2MKVA 1SQXG 3HD7D 1IK9A 3AE3C 1GU4A 4LGDE 1G1JA 4IL6H 1W5CE 1LTSC 1NEKC 2QEXP 5CCHC 3SSUA 2R32A 2Q7CA 3BRVB 3L36A 3AEDC 1KILA 3O8ZA 2P58A 3B5NA 3SWFA 1J1EB 1KFMA 1QX8A 2J58A 3N7NA 2R3CA 4H0LD 4YTMC 3KHUA 1QGKB 2WSFJ 2KXPB 2WS3D 1N86A 4U3FG 3AEAD 3IAOA 2AEFA 1L4AD 4I2LC 4DHJA 2E74D 3CX5I 2XNDH 2NPSD 1NU1J 2J5UA 3A0BH 1BCCG 3L70D 1N73C 1VQ6P 1NO4A 3H1LD 5GTHE 4DHIB 1HUCA 2AXTH 3L75E 5H2FE 3BCCD 1VL2A 1L0ND 4OGQD 3P4PC 1KD1Q 2FFDA 4ZMDA 5KAFH 3WUVA 4KX6D 1JUNA 1YTZI 3GHGB 4PD4E 1SFCB 1BE3D 1GMJA 1AV1A 1IFNA 3K5BA 1P84H 4BWNA 3FWNA 2IBZE 3Q3DA 2QG4A 5C3JC 4UB8H 2E42A 3SFED 1M1JC 3S1KA 2ZFYA 1AVOA 3H32A 1BCCD 3L70G 1AQTA 4GOEA 1KMIZ 2KS1B 4GDOA 3GF3A 5APYA 4EI2A 3LIDA 1VQ7P 1LTBC 2H89C 1JNMA 2L91A 2Q3EA 4QMAA 5CHXA 2KLVA 4R4LA 4A7PA 1YQ3D 4IFFA 3H1KG 2HR3A 3VP8A 1AFOA 1EC5A 3H25A 2N9YB 1BSHA 5AVYB 1R5LA 3EFGA 3VMAA 5GTIH 3AE9D 1L0LE 1N7SD 3L72E 2BS4C 1K04A 4I7ZC 2M5AB 3VOPA 2A06G 1J1DB 2YMYA 2N1TD 3H1HD 1NTMJ 3KYQA 1SQVD 2KNCA 2QE7H 4C46A 2YO2A 3P4SC 1FZGA 3AEFC 2IZ0A 4PJ0E 1SQQJ 5KLVD 2ZXEB 3H1HG 3RBZA 1SFCC 1S9KE 3RK3D 4L73A 1ZR4A 1N7SC 1IFMA 4XFJA 3AE4C 2IX7C 1KYOD 3TNUA 2QJKC 3TF5A 1FS0E 4HYTB 3V5BA 1IJDB 1FE6A 3II6A 4AYCA 3L75D 1AVYA 3B4SA 2N1TA 2E76C 3AE1C 1HGVA 4YXWH 4YSXC 3M9HA 1T3UA 2QM7A 1KV4A 1G1IA 4YTNC 1JY3P 4D6TE 3G6EP 1YITP 2OARA 3RK2D 1OVVA 5AVXB 1NOHA 3OW2O 1GK4A 2MJZA 3CCLP 1EQ7A 1FJKA 1X79B 3CWBJ 3H1IJ 1NKZB 1RQUA 1JY3O 1NTKD 2ZYDA 4YSXD 1H8AA 1L4AA 5AVVB 1BE3J 1K9MQ 3HE4B 2G8YA 1KF6D 3CI9A 1LWUC 1NAFA 4OH8B 2KNCB 3UIAA 2YKPA 1FOSF 2KS1A 3AE3D 1IK7A 1OWAA 3WU2H 5TISH 3CC2P 3W67A 3L74D 5CCGD 1BDCA 1LTTC 3NTNA 4KHXA 2H7HA 4H13D 3G9RA 3RL0D 1NU1D 1NJIQ 1GDTA 1N2DC 3P8CD 1H0TB 5GTHH 1X0TA 1OIPA 3V6IA 4I1LA 3A0BE 4H13C 2BS2C 4N78E 1FC2C 3CMAP 3PP5A 4WB4A 3HTKB 1ZOYD 1LP1A 1PP9G 3TYYA 1XTGB 2WDQC 2ZFCA 1RE4A 2W6BA 1IFIA 1PPJD 1JO5A 2A45I 3RBXA 2WSCH 2WSCJ 2O01J 3HD7B 4XA4A 2AEMA 5APWA 1ZXGA 1Y47A 2E74C 2CPSA 1VQ4P 1LTJC 3OAKA 4DZOA 3SWKA 2A06E 2FKWB 1RE3C 2XU6A 4YT0C 2KZIA 1CI6A 1PP9D 3FGAD 2B87A 4JPZB 3Q5SA 4DT0A 2V4HA 2FBWC 3H6PA 1NEKD 2P10A 1AQ5A 3IF4A 4IL6E 1W2BO 2FXMA 3VTPC 1VQOP 4WBAA 2OTJP 3R2PA 1KILE 1PGJA 1OZHA 3L75J 1LT9C 4W7YA 3ITKA 2JWAA 2CK3H 3V4WA 2ZT9D 2FYNB 2PGDA 1Z56A 3AE5C 4UB6E 1HF9A 3FX0A 1U57A 1KYOI 4JQ0D 4KT0J 3H1KJ 2HG5D 1JB0J 2RH0A 1E7PC 3MUDC 4YXDC 5APQA 1OVRA 2HODA 3NMDA 3H1IE 1NKNA 2OQQA 3AEBC 4JBZA 1FOSE 2ZT9B 3BCCJ 3IR9A 1BE3G 2W83C 2KZJA 4HKZH 3AECC 2C9LY 2E74B 1NTZJ 1FAVA 3AEGC 1KYOE 4JF7A 3MIWA 1U7JA 1FDMA 3P4SD 3H1LG 3H1KE 3HUSA 2Q1KA 4H44C 2YKQA 2RN0A 1JY2P 3L72J 1EZVD 1QLBC 5DJTB 1S72P 2R3SA 3AE9C 5AVUB 3AECD 4ZKUA 4YTND 1EZVG 1VQLP 3M0DA 1SFCD 1DX7A 2BCCG 2M3EA 2QJKB 1JY3N 1GL2D 1NTZE 3IN6A 1SQBD 2IYOA 2FBWD 4DDGA 1KZUB 3C9IA 1T2KD 1MFTA 2A45G 2KYVA 2GA1A 1DEEG 3B5NC 1T3JA 1SP4A 2WSEH 3L73D 3OJAB 2K37A 1M1KQ 1BGYE 2B9BA 3MUDA 3L73J 2WDRD 1VPCA 4N6JA 3VYIA 4IL6X 5AW2B 1VQPP 1L0NG 2LXBA 5CBOA 2BCCJ 2H88D 1VQMP 1KF6C 2JWDA 2WSEJ 1PZQA 2KUBA 3VP9A 2OYHB 2FYUD 4BXLA 2G3AA 3L71G 3CCVP 1ZR2A 2JEEA 3N4XA 5C39A 1N73A 1LTJB 1L0VC 4KJMA 4OGQB 4Y99C 4H0LB 4D6TG 5KJ7D 1VQ8P 4N3YB 4N78D 2C0XA 1IO4A 3VRBC 2IDBA 4W7ZA 3GHGC 2C0WA 3RL0C 3A0HE 2PFXA 3CCEP 1NTZG 2Q5UA 2KI7B 1M1JA 3M9BA 4I6LA 2H88C 4C7NB 3CCQP 1GU5A 3WMM0 1K73Q 3H1JE 2ZVNB 1Q81Q 2XNXA 5AW7B 2D2CC 1YTZT 2XZRA 3KPEA 1FZBA 3P7KA 3O6QB 1KQLA 3Q5PA 1NGMB 3AE8D 1VQNP 1LT9A 2Q9IA 1NTZK 4WVZA 1Q82Q 1M57D 3AE2C 4C7NA 5KAIE 1GL2B 5CJ0A 2KP8A 1KC8Q 2QA4P 2GUVA 3AEEC 2VRSA 1YJNP 3PRJA 1KYOH 3BCCG 1SQVG 2QIWA
chains in the Genus database with same CATH topology
4GDOA 3GF3A 4YXDD 4OGQC 3AECC 1FDIA 5KLIC 2E74B 2E75D 2H89C 3AEDC 1DIPA 1L0VC 1PL5A 3AEGC 1KTMA 1MKMA 2WSCJ 2O01J 4H0LD 1Y9BA 2BEZF 1VF5D 4H44B 4YT0D 4YTMC 2WDQD 2FYNC 4YTMD 4R4LA 1R8EA 2JO1A 4OGQB 4U7JA 2WDRC 4H0LB 2WSFJ 3P4SD 2E74C 1YQ3D 2WS3D 4KX6C 3B71A 1RQUA 1ZP0C 1ZP0D 3AEAD 3AEAC 3RL0g 3AEDD 4H44C 3VRBC 2IDBA 1KQFB 5KKZC 5M1BA 3IAOA 5C3JD 3P4RC 4YSXD 1YQ4D 3H25A 1QLBC 2V7QJ 4H0LC 3P4PD 1VF5C 4YT0C 2G8YA 1S1CX 3VR9D 3AE7C 1KF6D 2WP9C 3FGAD 1HJ0A 3AE9D 4YSYC 2E74D 3AE9C 3Q5SA 1K04A 2WQYC 4I7ZC 4RKUJ 2BS4C 3AE4D 4YSYD 4YSZC 1KORA 3AE6D 3AEED 2FBWC 1NEKD 2P10A 2QSIA 3D70A 3AECD 3AE8C 2BEQD 2WU5C 2ACZC 4YTPD 4YTPC 2H88C 1PV3A 2WU5D 3T97B 4PV1B 3VRAC 4YTND 3Q2YA 3GMAA 5C2TD 1KFYC 5C2TC 1DD3A 2J5UA 1EXIA 4Z1MH 3AE2D 3AE3D 1FDOA 1IK7A 3SFDC 3GF7A 1EXJA 3SFDD 1KILE 3VR9C 3VR8C 3S9OA 1AJYA 3ABVD 3CIRD 2QJYC 3P4SC 1KQGB 1NYHA 1UIXA 3IN6A 1PIXA 1VF5B 2FBWD 2NZ2A 2D2CC 1RQVA 2D2CD 3AEFC 2QJPC 3AEFD 2H89D 4H13D 1L0VD 1YQ3C 2ZT9D 3G9RA 2B76D 1OW7A 3P4RD 3AE5C 1Q90D 1VL2A 1YQ4C 1HF9A 4OGQD 3C8VA 3AE5D 3P4PC 4H13B 1OW8A 3D71A 1U57A 2K9YA 3EWKA 3VR8D 4H44D 3VRBD 2E76D 2D2CB 4PV1C 3AE1D 2WDVD 3AEBD 1OMIA 3RK3E 4KT0J 1WMKA 4XFJA 3Q5PA 3AE4C 1NGMB 3D6YA 3AEGD 1JB0J 2WS3C 3LW5J 4KX6D 2E75B 2BS3C 3P4QC 3GLMA 3AE8D 1OW6A 1NENC 1E7PC 2QJKC 1KMIZ 1NEND 1GMJA 4H13C 3Q1MA 4Y28J 2ACZD 2BS2C 3D6ZA 2ZT9C 3O6QA 4IL6X 1KFYD 2B76C 2H88D 4YSZD 5C3JC 2MKVA 3AE6C 3R4YA 2WPVB 4YXDC 4YTNC 2WU2D 3AE3C 2FXPA 3AE2C 4TT3H 2WU2C 4R4MA 4I7ZB 1K05A 2E76C 2E75C 3AE1C 4PV1D 2OQQA 1KF6C 1ZRTE 3AEBC 2YIUC 3Q3DA 2WSEJ 2WDVC 3AE7D 2JP3A 3ABVC 3CIRC 3SFEC 1ZOYD 4YSXC 1DD4A 1ZOYC 2WDRD 2WQYD 1ZMEC 3SFED 2ZT9B 3AEEC 3P4QD 1NEKC 2WDQC 1TU3F 2WP9D 2G3AA 3Q5RA 2YMKA 3VRAD 5L8RJ 1S5LX 2E76B 2QIWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YXD D;  3AEC C;  2H89 C;  3AED C;  1L0V C;  3AEG C;  1KTM A;  4YT0 D;  4YTM C;  2WDQ D;  4YTM D;  2WDR C;  3P4S D;  1YQ3 D;  2WS3 D;  4KX6 C;  3B71 A;  1ZP0 C;  1ZP0 D;  3AEA D;  3AEA C;  3AED D;  3VRB C;  5C3J D;  3P4R C;  4YSX D;  1YQ4 D;  1QLB C;  3P4P D;  4YT0 C;  3VR9 D;  3AE7 C;  1KF6 D;  2WP9 C;  3AE9 D;  4YSY C;  3AE9 C;  4YSY D;  1K04 A;  2WQY C;  2BS4 C;  3AE4 D;  4YSZ C;  3AE6 D;  3AEE D;  2FBW C;  1NEK D;  3AEC D;  3AE8 C;  2WU5 C;  2ACZ C;  4YTP D;  4YTP C;  2H88 C;  1PV3 A;  2WU5 D;  3VRA C;  4YTN D;  5C2T D;  5C2T C;  3SFD D;  3AE2 D;  3AE3 D;  3SFD C;  3VR9 C;  3VR8 C;  3S9O A;  3ABV D;  3CIR D;  3P4S C;  2FBW D;  3AEF C;  3AEF D;  2H89 D;  1L0V D;  1YQ3 C;  2B76 D;  1OW7 A;  3P4R D;  3AE5 C;  1YQ4 C;  3AE5 D;  3P4P C;  1OW8 A;  3VR8 D;  3VRB D;  3AE1 D;  2WDV D;  3AEB D;  3AEG D;  3AE4 C;  2WS3 C;  4KX6 D;  2BS3 C;  3P4Q C;  3AE8 D;  1OW6 A;  1NEN C;  1E7P C;  1NEN D;  2ACZ D;  2WDR D;  2BS2 C;  2B76 C;  1KFY D;  4YSZ D;  3AE6 C;  4YXD C;  2WU2 D;  3AE3 C;  3AE2 C;  2WU2 C;  1K05 A;  3AE1 C;  2H88 D;  1KF6 C;  3AE7 D;  3VRA D;  3AEB C;  2WDV C;  5C3J C;  3ABV C;  3CIR C;  3SFE C;  1ZOY D;  4YSX C;  1ZOY C;  2WQY D;  3SFE D;  3AEE C;  3P4Q D;  1NEK C;  2WDQ C;  2WP9 D;  2G3A A;  1KFY C;  4YTN C; 
#chains in the Genus database with same CATH topology
 2JKV A;  3L75 G;  1H89 A;  2NPS C;  4WY4 B;  4OVN F;  1NTK E;  1SQV K;  1YHQ P;  4L75 A;  3CXH I;  3W68 A;  2WDQ D;  1HWT C;  5KKZ B;  3WUU A;  3NXS A;  3AEA C;  4DCK A;  5DJU B;  5M1B A;  1X9V A;  1MZ9 A;  3ZDM A;  1G2C B;  3AE7 C;  1SQB E;  4YSY C;  1SQP G;  4GIF A;  1BGY G;  2QSI A;  4UB6 H;  2FYU J;  4PV1 B;  3VMX A;  3CC4 P;  1DD3 A;  1VQK P;  2M0B A;  1N8R Q;  2BCC D;  1NTK J;  1HH0 A;  1SQX J;  2BAS A;  3CWB D;  3HRN A;  2ZYG A;  4OWF A;  1R5S A;  3AE5 D;  3C8V A;  1JMB A;  1YJW P;  4C7R A;  3AEB D;  4GKG A;  1NVO A;  4LLH A;  2NPS A;  3LW5 J;  4U3F E;  3L72 G;  5KTB A;  3A5T A;  1SQB J;  2XDJ A;  2YNY A;  2H8P D;  1PGO A;  5BU8 B;  3QH9 A;  1LWU B;  1K05 A;  1SQP E;  2YKO A;  1PPJ E;  2K1A A;  1DD4 A;  1ZME C;  2ITA A;  1L0N K;  2KOG A;  3I55 P;  5CCH D;  3RGU A;  2WSF H;  3IFM A;  1FBM A;  1KFY C;  3CPW O;  1KB9 I;  4K3A A;  4RJT A;  4OGQ C;  4Y99 B;  1NAY A;  2QJP B;  2WPS A;  2IYP A;  1BGY D;  1CSB A;  1JEK A;  4IOI H;  1CI6 B;  5KLV J;  4D6T J;  2E5T A;  2HPC B;  2O01 N;  3F89 A;  4KX6 C;  1ZP0 C;  1ZP0 D;  3CWB E;  3QWO C;  1SQV J;  1EZV E;  3E1R A;  3P4P D;  3GW6 A;  3CLQ A;  1URQ C;  4DHZ A;  1W2E A;  3CCM P;  3AE4 D;  2O1J A;  3CD6 P;  2ZAE B;  2FYZ A;  1PGP A;  1N73 B;  3H1L J;  5APV A;  4D6T D;  2ZVO B;  4DJG A;  2JJL A;  3L70 J;  1JTH A;  2FY8 A;  4XE5 B;  3CIR D;  2QJY C;  2WPR A;  1PPJ G;  5TIS E;  3TDK A;  1RF1 C;  3WU2 E;  1SLQ A;  3AEF D;  2FYU K;  1N7S A;  1YQ3 C;  2B76 D;  1BGY J;  2P67 A;  3EWK A;  3VRB D;  3RK3 E;  3AEG D;  2B89 A;  3SWY A;  1Q86 Q;  3Q1M A;  3HE5 A;  3D6Z A;  1JCD A;  1NTK K;  5B66 E;  2WPV B;  2K9J B;  4TT3 H;  4R4M A;  2WDV C;  1LWU A;  1SQB K;  3E7K A;  5E79 E;  3G3Z A;  1FDI A;  1PP9 J;  2PP6 A;  2DW3 A;  1SQX D;  1OFC X;  2JR8 A;  1M7L A;  2W8Z A;  1WRG A;  3TNU B;  3M91 A;  1NWQ A;  3L4F A;  1ZN5 A;  2P7J A;  3P4R C;  4ZNC A;  1JY2 N;  1S9K D;  1NHL A;  2NRG A;  2CPB A;  4LC1 A;  1SQQ G;  2KLU A;  1NTM D;  2KB7 P;  5AVZ B;  3LW5 H;  3C1L A;  2BEQ D;  2QJY B;  3H1J J;  3Q2Y A;  3A7O A;  1HBW A;  4PJ0 H;  1ZRT D;  3RK2 C;  2LKM A;  3F5H A;  1RQV A;  2D2C D;  2YXR B;  1FZC C;  1L0V D;  2Y0E A;  1SQP D;  2GM4 A;  2O01 H;  1SFC A;  4IFM A;  1D7M A;  5GTI E;  1E5W A;  5AW1 B;  3U1C A;  3G71 P;  3GLM A;  1NEN C;  1M8O B;  3M06 A;  3L74 J;  4LDT A;  5AVQ B;  2C9N Y;  1EDJ A;  4ZKP A;  3AE7 D;  3VRA D;  1NTK G;  3CWB G;  3L37 A;  1BCC J;  1RHZ B;  1ZOY C;  1N7L A;  2N9B A;  1SQV E;  1KQS O;  2YMK A;  3G4S P;  1H88 A;  3B8E B;  5AVS B;  1NTM E;  5KJ7 A;  3MTU E;  3U59 A;  4GOD A;  3M0D C;  2BEZ F;  1VF5 D;  1R8E A;  4U7J A;  3L73 G;  3CCR P;  4UB8 E;  2A06 D;  1L0N J;  2M3B A;  1P84 E;  1KQF B;  4PD4 H;  1SQB G;  5KAF E;  4MN4 C;  3GG2 A;  2WWW A;  1YIJ P;  2YIU B;  2Z4E A;  3JCU E;  2M8R A;  2K3R A;  3LIE A;  3S4R A;  2OYH C;  3PTZ A;  5H2F H;  3CX5 D;  3VRA C;  2AXT E;  1HGZ A;  3SFD D;  2KSJ A;  2RMZ A;  1NH4 A;  5K5G B;  1J1D C;  3HE4 A;  2J59 M;  3CCS P;  1YQ4 C;  1GL2 A;  2FYU G;  2K9Y A;  4PV1 C;  1OMI A;  1WMK A;  1PP9 E;  1BDD A;  1L4A C;  3EFF K;  2ACZ D;  1RF0 A;  3CXH D;  1KFY D;  1L0L J;  3R4Y A;  2WU2 D;  3MD0 A;  1IZN B;  3MGN A;  2V7Q H;  5KLV G;  3TK1 A;  2JP3 A;  3JCU H;  1SQQ K;  2BCC E;  3Q5R A;  5APU A;  1GTW A;  3HD7 C;  3L71 D;  3V2Q A;  1URQ B;  1HTL C;  3BAT A;  1KTM A;  1GK6 A;  1LJ2 A;  2W6A A;  3MZW B;  1RH5 B;  1QLE D;  3AED D;  3BCC E;  1RY3 A;  4PD4 I;  5CMZ A;  1Y8A A;  2AXC A;  2Y9Y A;  1VQ9 P;  4RKU J;  1GL2 C;  1H0T A;  3A3Y B;  3WUT A;  1KOR A;  5BVZ A;  1GD2 E;  3RK2 B;  3TGU G;  1SQX E;  1ZLL A;  1T8Z A;  3T97 B;  4L76 A;  1NU1 G;  1LGH B;  2OTK E;  4RO0 A;  2R5B A;  4FJV A;  2IBZ I;  3VMZ A;  1KFN A;  1URQ D;  2I1K A;  1AJY A;  2Z5H A;  1NYH A;  2NPS B;  3HTK A;  3H32 B;  3L71 J;  2N1T B;  1BCC E;  4U3F J;  1LTG C;  2GUS A;  2HPC A;  1Q90 D;  1A02 F;  1JM0 A;  4H13 B;  1OW8 A;  2HLO A;  4H44 D;  2E76 D;  2Q3I A;  3AE1 D;  2WDV D;  2IPP A;  1S3J A;  3D6Y A;  1S2E A;  3P4Q C;  1KIL B;  1BE3 E;  1CW5 A;  1OW6 A;  1QVG O;  2ZT9 C;  3BVH A;  1GZL A;  1T6A A;  2O1K A;  3OA7 A;  4PV1 D;  2E75 C;  3ABV C;  3SFE C;  3H1J G;  3P8M C;  3P4Q D;  2E76 B;  2P1J A;  1T2K C;  2IZ1 A;  2OYI B;  5CCH A;  2I8D A;  3I5C A;  2FFD C;  1MKM A;  1Y9B A;  4H44 B;  5EFW B;  1JOC A;  5AW6 B;  2JO1 A;  2WDR C;  1FZC A;  4RES B;  5APX A;  3B71 A;  2I1J A;  4DDI A;  4CPG A;  2B88 A;  3RK3 C;  3B5N D;  4M3L A;  1SQX K;  5KLV E;  5E79 H;  1SVF A;  3CCJ P;  2WP9 C;  2WPQ A;  4HB1 A;  2ZXX A;  3AE6 D;  2E5Y A;  1JMM A;  2WU5 C;  4YTP D;  2SPZ A;  2PRR A;  5C2T D;  5C2T C;  2N1T C;  3PHL A;  1EXI A;  4Z1M H;  5B66 H;  1CZQ A;  3PJS K;  3CCU P;  3M0A A;  1EDK A;  2WT7 B;  1ZW0 A;  1USE A;  1YYC A;  2QJP C;  3H1H J;  1EZV I;  1OW7 A;  5B5E H;  5CCG A;  1QL2 A;  1IFJ A;  3PLN A;  1IFP A;  2QRX A;  2FXO A;  2YXQ B;  3VMY A;  1ZV8 A;  2E75 B;  3E1I A;  3H1I G;  1NEN D;  1L0L G;  3AE6 C;  3TGU D;  2WU2 C;  3CXH H;  4I7Z B;  5AW8 B;  1HJB A;  1KB9 E;  2Y0C A;  2H43 A;  1SQP J;  3JSV C;  4GT1 A;  2WT7 A;  1A02 J;  1S5L X;  1M90 Q;  3KDP B;  5KLI C;  2E75 D;  3HUS B;  3H1H E;  1VDF A;  2RKL A;  1PFI A;  1TFF A;  1SQP K;  5AW0 B;  4YTM D;  4BRY A;  4O9B A;  4JYB A;  1S5L E;  3P32 A;  2WIT A;  1NU1 E;  2LXC B;  2W90 A;  1E79 H;  1HJ0 A;  3P8C E;  5CCG C;  3KZI H;  1K8A Q;  3AEE D;  5KLV K;  4WY4 A;  1PGQ A;  1PV3 A;  2WVR A;  1URQ A;  3L74 G;  3AE2 D;  1M56 D;  3GF7 A;  2B87 B;  3VR8 C;  1KIL D;  1U7M A;  1LP1 B;  4EIJ A;  1KB9 D;  1UIX A;  2K88 A;  1VF5 B;  2NZ2 A;  3CL3 D;  1FZF A;  2IFN A;  4NPD A;  1SS1 A;  1LT9 B;  5APT A;  3D71 A;  3VR8 D;  5AVR B;  2WS3 C;  1P84 I;  2JDI H;  5CJ4 A;  2A45 H;  1IC2 A;  3CX5 E;  4B86 A;  5AVW B;  4AUW A;  1ZRT E;  2OYI C;  2WQY D;  1QL1 A;  3H1J D;  1YJ9 P;  3NFQ A;  3L74 E;  1L4A B;  2HOD B;  4WWI A;  2POH A;  1DIP A;  4L74 A;  1MFZ A;  3MP7 B;  1P84 D;  1USD A;  4BRY B;  1GW3 A;  1EDL A;  1FZC B;  1NTM G;  4YT0 D;  1SQQ D;  3KXD A;  1G2C A;  2R5D A;  3CC7 P;  1MV8 A;  3CX5 H;  3L73 E;  5C3J D;  3USS A;  1YQ4 D;  2V7Q J;  4H0L C;  1S1C X;  2UWJ E;  3VR9 D;  4EOT A;  3I56 P;  2HFE D;  4NPE A;  3MHV A;  2QVA A;  2LR2 A;  1LTJ A;  3T97 A;  2ACZ C;  1IFD A;  2WSS H;  2OYI A;  2QM8 A;  2Y0D A;  5KAI H;  4IFD K;  1KN7 A;  1EXJ A;  5AW3 B;  1KIL C;  4HH2 A;  1EDI A;  3ABV D;  1RE3 A;  1UII A;  1KQG B;  1PIX A;  1RE4 C;  4GOF A;  2K9J A;  2AEJ A;  1FJP A;  3U1A A;  3KZI E;  2Z5I A;  4EYY Q;  3H1L E;  1RF1 A;  3L70 E;  2Q6Q A;  3JC2 2;  1SQQ E;  4DOJ A;  2HYN A;  4YSZ D;  1S5L H;  1FU1 A;  4NPF X;  2YO3 A;  3V2R A;  2YIU C;  1J2J B;  4WY4 C;  2XKM A;  2M5A A;  3PH0 A;  1TU3 F;  1QEX A;  2FYU E;  3FWL A;  2E43 A;  3EQ2 A;  3RK3 B;  3A0H H;  2P2U A;  4YXD D;  3V2P A;  1L2P A;  4HJG H;  2IBZ D;  3TSI A;  1QVF O;  2Y9Z A;  3H1I D;  1MUU A;  1DEB A;  2FYN C;  1HVV A;  3VON A;  4K35 A;  1KB9 H;  4U3F D;  2WMM A;  1YBK A;  3CXH E;  1J1E C;  3RL0 g;  2XV5 A;  1L0N E;  4ASV A;  3BRT B;  5AVT B;  1LTI C;  1WT6 A;  4WY4 D;  4YSZ C;  1GW4 A;  3D70 A;  3AE8 C;  4YTP C;  5B5E E;  2WU5 D;  3L71 E;  2IFM A;  1DH3 A;  1JY2 O;  1N7S B;  1FDO A;  3A2A A;  3SFD C;  3VR9 C;  2ZYA A;  4TLF A;  1JCC A;  2L5G B;  2H89 D;  4I6M C;  3P4R D;  3HE5 B;  1NTM K;  2D2C B;  2KIK A;  2WZ7 A;  1OXZ A;  2BS3 C;  1OX3 A;  1FZE A;  4Y28 J;  3O6Q A;  2B76 C;  3HUS C;  1BSN A;  1YI2 P;  2FXP A;  3CIR C;  1Q2N A;  4EDF A;  1L0L D;  2O3J A;  2WP9 D;  5L8R J;  1RF0 C;  2WTY A;  5KJ7 C;  1NTZ D;  1X8Y A;  1M1J B;  1FZA A;  3FXD A;  4JYC A;  3TGU E;  2IBZ G;  2OGU A;  1PL5 A;  5AW4 B;  2OTL P;  1L0L K;  2PAJ A;  3M9Q A;  2OYH A;  1NU1 K;  5CBN A;  1XTC C;  3CME P;  3B5N B;  3BAS A;  5APS A;  2KSE A;  5KKZ C;  5KLI B;  1VF5 C;  2W6J H;  3GHG A;  1LTA C;  3L35 A;  4W80 A;  3HD7 A;  3FXE A;  2KK7 A;  2OYO A;  1OVU A;  5AW5 B;  2WQY C;  4YSY D;  1VQ5 P;  1JTH B;  5TJH A;  1X22 A;  3GMA A;  3V2N A;  4YPC A;  3VN0 A;  1LNQ A;  4ASW A;  3S9O A;  1S4X A;  3TGU J;  1LT1 A;  1Q7Y Q;  4PD4 D;  2W27 A;  3L72 D;  5AW9 B;  2FFD B;  1RF1 B;  3KQG A;  3H1K D;  4AQR D;  5BU5 A;  3V4Q A;  3RL0 B;  2R44 A;  1AA0 A;  2ZJS E;  2MKV A;  1SQX G;  3HD7 D;  1IK9 A;  3AE3 C;  1GU4 A;  4LGD E;  1G1J A;  4IL6 H;  1W5C E;  1LTS C;  1NEK C;  2QEX P;  5CCH C;  3SSU A;  2R32 A;  2Q7C A;  3BRV B;  3L36 A;  3AED C;  1KIL A;  3O8Z A;  2P58 A;  3B5N A;  3SWF A;  1J1E B;  1KFM A;  1QX8 A;  2J58 A;  3N7N A;  2R3C A;  4H0L D;  4YTM C;  3KHU A;  1QGK B;  2WSF J;  2KXP B;  2WS3 D;  1N86 A;  4U3F G;  3AEA D;  3IAO A;  2AEF A;  1L4A D;  4I2L C;  4DHJ A;  2E74 D;  3CX5 I;  2XND H;  2NPS D;  1NU1 J;  2J5U A;  3A0B H;  1BCC G;  3L70 D;  1N73 C;  1VQ6 P;  1NO4 A;  3H1L D;  5GTH E;  4DHI B;  1HUC A;  2AXT H;  3L75 E;  5H2F E;  3BCC D;  1VL2 A;  1L0N D;  4OGQ D;  3P4P C;  1KD1 Q;  2FFD A;  4ZMD A;  5KAF H;  3WUV A;  4KX6 D;  1JUN A;  1YTZ I;  3GHG B;  4PD4 E;  1SFC B;  1BE3 D;  1GMJ A;  1AV1 A;  1IFN A;  3K5B A;  1P84 H;  4BWN A;  3FWN A;  2IBZ E;  3Q3D A;  2QG4 A;  5C3J C;  4UB8 H;  2E42 A;  3SFE D;  1M1J C;  3S1K A;  2ZFY A;  1AVO A;  3H32 A;  1BCC D;  3L70 G;  1AQT A;  4GOE A;  1KMI Z;  2KS1 B;  4GDO A;  3GF3 A;  5APY A;  4EI2 A;  3LID A;  1VQ7 P;  1LTB C;  2H89 C;  1JNM A;  2L91 A;  2Q3E A;  4QMA A;  5CHX A;  2KLV A;  4R4L A;  4A7P A;  1YQ3 D;  4IFF A;  3H1K G;  2HR3 A;  3VP8 A;  1AFO A;  1EC5 A;  3H25 A;  2N9Y B;  1BSH A;  5AVY B;  1R5L A;  3EFG A;  3VMA A;  5GTI H;  3AE9 D;  1L0L E;  1N7S D;  3L72 E;  2BS4 C;  1K04 A;  4I7Z C;  2M5A B;  3VOP A;  2A06 G;  1J1D B;  2YMY A;  2N1T D;  3H1H D;  1NTM J;  3KYQ A;  1SQV D;  2KNC A;  2QE7 H;  4C46 A;  2YO2 A;  3P4S C;  1FZG A;  3AEF C;  2IZ0 A;  4PJ0 E;  1SQQ J;  5KLV D;  2ZXE B;  3H1H G;  3RBZ A;  1SFC C;  1S9K E;  3RK3 D;  4L73 A;  1ZR4 A;  1N7S C;  1IFM A;  4XFJ A;  3AE4 C;  2IX7 C;  1KYO D;  3TNU A;  2QJK C;  3TF5 A;  1FS0 E;  4HYT B;  3V5B A;  1IJD B;  1FE6 A;  3II6 A;  4AYC A;  3L75 D;  1AVY A;  3B4S A;  2N1T A;  2E76 C;  3AE1 C;  1HGV A;  4YXW H;  4YSX C;  3M9H A;  1T3U A;  2QM7 A;  1KV4 A;  1G1I A;  4YTN C;  1JY3 P;  4D6T E;  3G6E P;  1YIT P;  2OAR A;  3RK2 D;  1OVV A;  5AVX B;  1NOH A;  3OW2 O;  1GK4 A;  2MJZ A;  3CCL P;  1EQ7 A;  1FJK A;  1X79 B;  3CWB J;  3H1I J;  1NKZ B;  1RQU A;  1JY3 O;  1NTK D;  2ZYD A;  4YSX D;  1H8A A;  1L4A A;  5AVV B;  1BE3 J;  1K9M Q;  3HE4 B;  2G8Y A;  1KF6 D;  3CI9 A;  1LWU C;  1NAF A;  4OH8 B;  2KNC B;  3UIA A;  2YKP A;  1FOS F;  2KS1 A;  3AE3 D;  1IK7 A;  1OWA A;  3WU2 H;  5TIS H;  3CC2 P;  3W67 A;  3L74 D;  5CCG D;  1BDC A;  1LTT C;  3NTN A;  4KHX A;  2H7H A;  4H13 D;  3G9R A;  3RL0 D;  1NU1 D;  1NJI Q;  1GDT A;  1N2D C;  3P8C D;  1H0T B;  5GTH H;  1X0T A;  1OIP A;  3V6I A;  4I1L A;  3A0B E;  4H13 C;  2BS2 C;  4N78 E;  1FC2 C;  3CMA P;  3PP5 A;  4WB4 A;  3HTK B;  1ZOY D;  1LP1 A;  1PP9 G;  3TYY A;  1XTG B;  2WDQ C;  2ZFC A;  1RE4 A;  2W6B A;  1IFI A;  1PPJ D;  1JO5 A;  2A45 I;  3RBX A;  2WSC H;  2WSC J;  2O01 J;  3HD7 B;  4XA4 A;  2AEM A;  5APW A;  1ZXG A;  1Y47 A;  2E74 C;  2CPS A;  1VQ4 P;  1LTJ C;  3OAK A;  4DZO A;  3SWK A;  2A06 E;  2FKW B;  1RE3 C;  2XU6 A;  4YT0 C;  2KZI A;  1CI6 A;  1PP9 D;  3FGA D;  2B87 A;  4JPZ B;  3Q5S A;  4DT0 A;  2V4H A;  2FBW C;  3H6P A;  1NEK D;  2P10 A;  1AQ5 A;  3IF4 A;  4IL6 E;  1W2B O;  2FXM A;  3VTP C;  1VQO P;  4WBA A;  2OTJ P;  3R2P A;  1KIL E;  1PGJ A;  1OZH A;  3L75 J;  1LT9 C;  4W7Y A;  3ITK A;  2JWA A;  2CK3 H;  3V4W A;  2ZT9 D;  2FYN B;  2PGD A;  1Z56 A;  3AE5 C;  4UB6 E;  1HF9 A;  3FX0 A;  1U57 A;  1KYO I;  4JQ0 D;  4KT0 J;  3H1K J;  2HG5 D;  1JB0 J;  2RH0 A;  1E7P C;  3MUD C;  4YXD C;  5APQ A;  1OVR A;  2HOD A;  3NMD A;  3H1I E;  1NKN A;  2OQQ A;  3AEB C;  4JBZ A;  1FOS E;  2ZT9 B;  3BCC J;  3IR9 A;  1BE3 G;  2W83 C;  2KZJ A;  4HKZ H;  3AEC C;  2C9L Y;  2E74 B;  1NTZ J;  1FAV A;  3AEG C;  1KYO E;  4JF7 A;  3MIW A;  1U7J A;  1FDM A;  3P4S D;  3H1L G;  3H1K E;  3HUS A;  2Q1K A;  4H44 C;  2YKQ A;  2RN0 A;  1JY2 P;  3L72 J;  1EZV D;  1QLB C;  5DJT B;  1S72 P;  2R3S A;  3AE9 C;  5AVU B;  3AEC D;  4ZKU A;  4YTN D;  1EZV G;  1VQL P;  3M0D A;  1SFC D;  1DX7 A;  2BCC G;  2M3E A;  2QJK B;  1JY3 N;  1GL2 D;  1NTZ E;  3IN6 A;  1SQB D;  2IYO A;  2FBW D;  4DDG A;  1KZU B;  3C9I A;  1T2K D;  1MFT A;  2A45 G;  2KYV A;  2GA1 A;  1DEE G;  3B5N C;  1T3J A;  1SP4 A;  2WSE H;  3L73 D;  3OJA B;  2K37 A;  1M1K Q;  1BGY E;  2B9B A;  3MUD A;  3L73 J;  2WDR D;  1VPC A;  4N6J A;  3VYI A;  4IL6 X;  5AW2 B;  1VQP P;  1L0N G;  2LXB A;  5CBO A;  2BCC J;  2H88 D;  1VQM P;  1KF6 C;  2JWD A;  2WSE J;  1PZQ A;  2KUB A;  3VP9 A;  2OYH B;  2FYU D;  4BXL A;  2G3A A;  3L71 G;  3CCV P;  1ZR2 A;  2JEE A;  3N4X A;  5C39 A;  1N73 A;  1LTJ B;  1L0V C;  4KJM A;  4OGQ B;  4Y99 C;  4H0L B;  4D6T G;  5KJ7 D;  1VQ8 P;  4N3Y B;  4N78 D;  2C0X A;  1IO4 A;  3VRB C;  2IDB A;  4W7Z A;  3GHG C;  2C0W A;  3RL0 C;  3A0H E;  2PFX A;  3CCE P;  1NTZ G;  2Q5U A;  2KI7 B;  1M1J A;  3M9B A;  4I6L A;  2H88 C;  4C7N B;  3CCQ P;  1GU5 A;  3WMM 0;  1K73 Q;  3H1J E;  2ZVN B;  1Q81 Q;  2XNX A;  5AW7 B;  2D2C C;  1YTZ T;  2XZR A;  3KPE A;  1FZB A;  3P7K A;  3O6Q B;  1KQL A;  3Q5P A;  1NGM B;  3AE8 D;  1VQN P;  1LT9 A;  2Q9I A;  1NTZ K;  4WVZ A;  1Q82 Q;  1M57 D;  3AE2 C;  4C7N A;  5KAI E;  1GL2 B;  5CJ0 A;  2KP8 A;  1KC8 Q;  2QA4 P;  2GUV A;  3AEE C;  2VRS A;  1YJN P;  3PRJ A;  1KYO H;  3BCC G;  1SQV G;  2QIW A; 
#chains in the Genus database with same CATH homology
 4GDO A;  3GF3 A;  4YXD D;  4OGQ C;  3AEC C;  1FDI A;  5KLI C;  2E74 B;  2E75 D;  2H89 C;  3AED C;  1DIP A;  1L0V C;  1PL5 A;  3AEG C;  1KTM A;  1MKM A;  2WSC J;  2O01 J;  4H0L D;  1Y9B A;  2BEZ F;  1VF5 D;  4H44 B;  4YT0 D;  4YTM C;  2WDQ D;  2FYN C;  4YTM D;  4R4L A;  1R8E A;  2JO1 A;  4OGQ B;  4U7J A;  2WDR C;  4H0L B;  2WSF J;  3P4S D;  2E74 C;  1YQ3 D;  2WS3 D;  4KX6 C;  3B71 A;  1RQU A;  1ZP0 C;  1ZP0 D;  3AEA D;  3AEA C;  3RL0 g;  3AED D;  4H44 C;  3VRB C;  2IDB A;  1KQF B;  5KKZ C;  5M1B A;  3IAO A;  5C3J D;  3P4R C;  4YSX D;  1YQ4 D;  3H25 A;  1QLB C;  2V7Q J;  4H0L C;  3P4P D;  1VF5 C;  4YT0 C;  2G8Y A;  1S1C X;  3VR9 D;  3AE7 C;  1KF6 D;  2WP9 C;  3FGA D;  1HJ0 A;  3AE9 D;  4YSY C;  2E74 D;  3AE9 C;  3Q5S A;  1K04 A;  2WQY C;  4I7Z C;  4RKU J;  2BS4 C;  3AE4 D;  4YSY D;  4YSZ C;  1KOR A;  3AE6 D;  3AEE D;  2FBW C;  1NEK D;  2P10 A;  2QSI A;  3D70 A;  3AEC D;  3AE8 C;  2BEQ D;  2WU5 C;  2ACZ C;  4YTP D;  4YTP C;  2H88 C;  1PV3 A;  2WU5 D;  3T97 B;  4PV1 B;  3VRA C;  4YTN D;  3Q2Y A;  3GMA A;  5C2T D;  1KFY C;  5C2T C;  1DD3 A;  2J5U A;  1EXI A;  4Z1M H;  3AE2 D;  3AE3 D;  1FDO A;  1IK7 A;  3SFD C;  3GF7 A;  1EXJ A;  3SFD D;  1KIL E;  3VR9 C;  3VR8 C;  3S9O A;  1AJY A;  3ABV D;  3CIR D;  2QJY C;  3P4S C;  1KQG B;  1NYH A;  1UIX A;  3IN6 A;  1PIX A;  1VF5 B;  2FBW D;  2NZ2 A;  2D2C C;  1RQV A;  2D2C D;  3AEF C;  2QJP C;  3AEF D;  2H89 D;  4H13 D;  1L0V D;  1YQ3 C;  2ZT9 D;  3G9R A;  2B76 D;  1OW7 A;  3P4R D;  3AE5 C;  1Q90 D;  1VL2 A;  1YQ4 C;  1HF9 A;  4OGQ D;  3C8V A;  3AE5 D;  3P4P C;  4H13 B;  1OW8 A;  3D71 A;  1U57 A;  2K9Y A;  3EWK A;  3VR8 D;  4H44 D;  3VRB D;  2E76 D;  2D2C B;  4PV1 C;  3AE1 D;  2WDV D;  3AEB D;  1OMI A;  3RK3 E;  4KT0 J;  1WMK A;  4XFJ A;  3Q5P A;  3AE4 C;  1NGM B;  3D6Y A;  3AEG D;  1JB0 J;  2WS3 C;  3LW5 J;  4KX6 D;  2E75 B;  2BS3 C;  3P4Q C;  3GLM A;  3AE8 D;  1OW6 A;  1NEN C;  1E7P C;  2QJK C;  1KMI Z;  1NEN D;  1GMJ A;  4H13 C;  3Q1M A;  4Y28 J;  2ACZ D;  2BS2 C;  3D6Z A;  2ZT9 C;  3O6Q A;  4IL6 X;  1KFY D;  2B76 C;  2H88 D;  4YSZ D;  5C3J C;  2MKV A;  3AE6 C;  3R4Y A;  2WPV B;  4YXD C;  4YTN C;  2WU2 D;  3AE3 C;  2FXP A;  3AE2 C;  4TT3 H;  2WU2 C;  4R4M A;  4I7Z B;  1K05 A;  2E76 C;  2E75 C;  3AE1 C;  4PV1 D;  2OQQ A;  1KF6 C;  1ZRT E;  3AEB C;  2YIU C;  3Q3D A;  2WSE J;  2WDV C;  3AE7 D;  2JP3 A;  3ABV C;  3CIR C;  3SFE C;  1ZOY D;  4YSX C;  1DD4 A;  1ZOY C;  2WDR D;  2WQY D;  1ZME C;  3SFE D;  2ZT9 B;  3AEE C;  3P4Q D;  1NEK C;  2WDQ C;  1TU3 F;  2WP9 D;  2G3A A;  3Q5R A;  2YMK A;  3VRA D;  5L8R J;  1S5L X;  2E76 B;  2QIW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...