1ZOYC

Crystal structure of mitochondrial respiratory complex ii from porcine heart at 2.4 angstroms
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAD-binding protein
publication title Crystal Structure of Mitochondrial Respiratory Membrane Protein Complex II
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 50
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2005-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1zoyC01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 1zoyC02
1OW8A 2WDVC 2WDRC 1YQ3C 4YTND 3P4SC 3P4QD 3VR9C 4YTPC 4YSYD 1OW7A 3P4RC 4YT0C 3AE8C 3AEAD 1NEND 2WS3D 3B71A 3AE5D 5C2TC 1QLBC 3AECC 3AEFC 4YSXC 2BS2C 4YXDD 5C3JC 3AE4C 2WDQC 2H89C 3AE7C 2FBWD 2WP9C 1NEKD 2B76C 1PV3A 1ZOYC 3VRBD 1ZP0D 3AEBC 3VRAD 2WDVD 2WQYD 2WDRD 1YQ3D 3P4SD 3VR9D 4YTPD 4KX6D 3P4RD 3AEDC 3AE8D 4YTMC 2BS4C 5C2TD 3AECD 3S9OA 2H88D 3AEFD 4YSXD 2ACZC 5C3JD 3AE4D 1L0VC 1KF6C 2H89D 2WDQD 4YSZC 3AE7D 3AE6C 3AEGC 1OW6A 2WP9D 3AE1C 3CIRC 2B76D 2BS3C 1E7PC 3SFEC 3AE3D 3AE5C 3VR8C 2WU5C 1ZOYD 3AEBD 3AE2C 1K05A 3AE9C 1KTMA 3ABVC 1KFYC 4YT0D 2WU2C 3SFDC 3AEDD 3AEEC 4YTMD 3P4PC 1YQ4C 2ACZD 3VRBC 3VRAC 1L0VD 1KF6D 4YSZD 4YTNC 2WQYC 3P4QC 3AE6D 3AEGD 4YSYC 3AE1D 3CIRD 2G3AA 3AEAC 1NENC 2WS3C 4KX6C 3SFED 3VR8D 2WU5D 4YXDC 2H88C 3AE2D 3AE9D 1KFYD 3ABVD 2FBWC 2WU2D 1NEKC 3SFDD 3AEED 3P4PD 1K04A 3AE3C 1YQ4D 1ZP0C
chains in the Genus database with same CATH superfamily
5APUA 4EOTA 4H0LB 1RE4A 1GW3A 5E79E 3GLMA 1T8ZA 5CJ4A 4N78D 3AE5D 5AW6B 3V6IA 1VQ4P 1M57D 1ZLLA 3H1IE 4YXDD 1PGJA 4PJ0E 1S5LX 4YXWH 1EC5A 1QL1A 4H13D 1VQMP 1X8YA 3TF5A 5CCHC 5APYA 2I1KA 2PRRA 4EYYQ 1KV4A 3TK1A 2HODB 5AVZB 4EIJA 2ZYGA 1N2DC 5GTHH 3P4SD 1G1JA 2UWJE 4YPCA 1NU1E 5AVTB 2IFMA 1LTJC 5C3JD 3AE4D 4H44D 4GT1A 3AE7D 2BCCJ 3CCLP 2FYUK 2W90A 1GL2C 3E7KA 1G2CB 4L74A 2M5AB 1KFYC 2R5DA 2OGUA 1SQQE 1M1JB 3VRBC 3CWBD 5TISH 4EI2A 3A3YB 3P4QC 3AEGD 2OTKE 3W67A 3TNUA 2GM4A 1DD4A 1YJNP 1NH4A 1AVYA 3VR8D 1L0LK 1N73C 1IO4A 1EDIA 3QWOC 1SP4A 3AEED 3CXHI 5AW8B 2C0XA 1ZR2A 2QSIA 1KN7A 1ZP0C 3H1LD 3L70J 2H7HA 1SQVJ 4DDGA 2P58A 1OW7A 1NEND 4DDIA 4HKZH 1A02F 3FXEA 4YSXC 1SQXD 2YNYA 3TYYA 3I56P 1BE3G 2WDQC 4DCKA 3RK3E 3UIAA 1JB0J 1KMIZ 2O3JA 1U57A 1GZLA 1FZCA 3V2NA 2JP3A 3V2PA 2HG5D 1U7JA 1SLQA 1JUNA 1KYOE 4DZOA 3L74G 4JBZA 1LTSC 1LT9B 4BWNA 3Q1MA 4QMAA 4N3YB 5CCHD 3EFGA 3P32A 3TGUE 3U1CA 2O01N 5TJHA 3L4FA 3CD6P 1VQNP 3C9IA 3BCCJ 2IDBA 2HFED 2J59M 2N9YB 1URQB 3L73D 3EQ2A 4IFMA 3CXHD 1S9KD 1EZVE 1CI6B 3H1JE 3C8VA 2OYOA 2B87A 1H88A 1HJBA 1GL2D 3G71P 2QRXA 1DH3A 3V4QA 1KB9I 5AW4B 1NTZE 4FJVA 3MD0A 2N9BA 1KFYD 2P1JA 2FYUD 4HYTB 3VMYA 3BATA 1BDCA 1BGYE 1NTMD 2FFDC 3CI9A 3RK2C 3AE3C 2P7JA 1SFCA 1AV1A 5KLVE 2HLOA 1KFNA 3P4QD 3CWBJ 2JKVA 3P4RC 3VP9A 2V7QJ 3CLQA 1IJDB 2HPCA 1YI2P 3MUDA 1AA0A 4PV1D 2KLVA 4WWIA 3VTPC 4JYCA 5CCGC 1JY3O 3VP8A 1PPJG 3SWYA 1L0LD 1NAYA 2E74C 1ZP0D 2RN0A 2E5TA 5AW7B 1SQBJ 4N6JA 2KXPB 1BCCD 2R3SA 3H1LJ 1VF5C 2M0BA 4B86A 2YKPA 2KYVA 1VQ5P 4WVZA 4YSXD 4KJMA 1QL2A 2ACZC 3CC7P 1SQXJ 4DJGA 2WDQD 5KAIE 4D6TD 1PP9D 2WSCJ 4GIFA 3AE9C 1RF1A 3H1HG 2AEFA 1X0TA 1KB9D 1W2EA 4U3FE 4I7ZB 5AW3B 1J2JB 3M0DA 5BU5A 1NGMB 1EQ7A 5AVYB 3TNUB 4YTNC 3SSUA 2Y9YA 2WS3C 1FZFA 2H88C 3Q5PA 5KKZC 3CPWO 2Z4EA 1NEKC 2IX7C 4RJTA 2ZAEB 2OARA 3H1IG 1NHLA 4YTPC 2QJYC 1FU1A 3MP7B 5C2TC 5L8RJ 3D6YA 2WPQA 2H89C 1NOHA 3HRNA 1FZCB 1ZW0A 3RK2D 2K9JA 4PD4I 1NTMJ 1EDKA 2WQYD 1HGVA 1NU1G 1Q7YQ 1OMIA 2W6AA 3P4RD 1CZQA 3HUSA 1JY2O 3L35A 1NJIQ 3LIEA 5CCGD 2IFNA 4ZKPA 2M3BA 1HTLC 1DIPA 1VQ7P 1E7PC 1HWTC 2E5YA 2B88A 1BE3E 2E74D 1VQ9P 1L0LJ 1OXZA 3B8EB 5CCHA 4YT0D 1AVOA 1KFMA 1LWUB 1VF5D 3VMZA 1BCCJ 1RY3A 1PL5A 4XE5B 5EFWB 5APXA 2ACZD 2B87B 3Q5SA 3L74E 3I55P 4D6TJ 1PP9J 1GD2E 1PGOA 1VQ8P 1L0ND 1G1IA 3AE9D 2IBZI 2IYPA 1J1EC 2FBWC 1GL2A 1K04A 1SFCB 3RBZA 5C39A 2YMYA 4UB6H 1YITP 2YO3A 1YQ3C 3CX5H 3A7OA 4PD4D 4YTND 1OIPA 1KILC 2HPCB 3P8CD 4OVNF 2WS3D 2ZYDA 1X9VA 1M90Q 2Z5IA 4L76A 3U1AA 1NEKD 2O1JA 4AUWA 3PJSK 1YJ9P 1JEKA 1MKMA 3M9QA 1FOSF 4YTPD 2KZIA 5C2TD 3OA7A 3F5HA 5E79H 2KUBA 3TGUG 2H89D 1EDJA 1J1DB 4W7ZA 2OYIB 4JF7A 1LP1A 4H44B 3FWLA 2HR3A 1IFMA 1RF1B 4PJ0H 2K88A 2KOGA 1ZRTE 2W83C 4C7RA 5KAFH 3H32A 5KTBA 2YKOA 1YHQP 4IFFA 3SFDC 2IBZD 3MZWB 3H1JG 3OW2O 2V4HA 3D6ZA 1NTZG 2KNCA 2WMMA 1QX8A 2GUSA 1PZQA 3CCEP 1KQGB 1VQLP 1TFFA 2WSEJ 1SQBK 1JCDA 2P10A 2IYOA 5KLVG 1SVFA 3HE4A 5APVA 1T2KD 1GW4A 3H1HE 1K9MQ 3H1KG 2W8ZA 1SQXK 4GODA 1SQPG 1K8AQ 3B71A 2P67A 1OVRA 4IL6E 2ZVNB 3GMAA 3HTKA 1L0NJ 3IF4A 3B5ND 3L72D 2FBWD 2WP9C 2XKMA 1R5LA 2A06G 2K9JB 5BVZA 3VOPA 3CMAP 2LKMA 1YQ3D 3HUSB 2POHA 5AW9B 1GMJA 3P7KA 1JMMA 1FBMA 3GHGC 1KZUB 1IC2A 2BASA 2KB7P 4Z1MH 2NZ2A 2Y0DA 2XU6A 5CCGA 3SFEC 3Q2YA 4U3FG 5AVWB 2KK7A 1FZAA 1JCCA 3BCCD 1KTMA 1L4AC 2Q9IA 2BCCG 2SPZA 4XFJA 2FYNC 3WUVA 1CW5A 1N7SA 1U7MA 3QH9A 2K3RA 5B5EE 1KYOH 3VMXA 2NRGA 1LT1A 3MGNA 1NTMK 4K3AA 1GL2B 4TLFA 3PP5A 3SFDD 3M06A 1H0TA 1N86A 4I6LA 1PGPA 2WSEH 4GDOA 3CX5I 4WB4A 2WDVC 2WDRC 2J58A 1M56D 4IFDK 3PHLA 1IFNA 4LGDE 1Z56A 2AXCA 3L70G 4PV1B 1SQVG 2IZ0A 2B76C 5GTIE 2RMZA 5DJUB 1SQBD 4OH8B 4W80A 1QVGO 2FXOA 1NTKD 1Q90D 2JJLA 4KX6D 3O8ZA 5CMZA 3HE5A 3L71D 2C9LY 3WMM0 2YIUB 1SQQK 2A45G 2LXBA 4Y99C 1LP1B 1PPJD 1P84E 2WP9D 1BSNA 3CIRC 1FOSE 3L72J 4Y28J 2KS1A 1UIIA 3H32B 4PD4H 2C9NY 3JCUE 1K05A 2KZJA 1RE3C 1JMBA 2Y0EA 4WY4A 2KNCB 1RF0C 4IL6X 3L36A 2MKVA 1AFOA 2G3AA 1W5CE 3CX5D 3SFED 1LT9C 5KAIH 2BEZF 3LW5J 1QEXA 3HE4B 1L4AD 5M1BA 1LWUA 2E75C 5AVXB 3L74J 2Y9ZA 1WMKA 2NPSA 2KLUA 2JEEA 4JPZB 3RK3C 1URQC 1S3JA 3A2AA 3HTKB 3N7NA 4IOIH 2XNDH 1KORA 3TDKA 1QGKB 3SWFA 2C0WA 3G3ZA 1BDDA 3B5NA 3VRBD 2FFDB 3H1ID 3O6QA 3RK2B 2WDVD 2WDRD 2Y0CA 3H1KE 3FGAD 3L75E 1SQPE 1HH0A 2AEJA 4XA4A 5B66H 1L0VC 1E79H 3H1LG 2B76D 2BS3C 2W6JH 3M9BA 2QJPB 5APTA 2QM7A 2WPSA 2WU5C 3PLNA 2E42A 3AE2C 2E74B 1SQXG 2A06E 1H89A 2Q5UA 1NTKJ 3P4PC 2ZT9C 1H8AA 1N7SB 2WVRA 3S1KA 1S72P 4GKGA 3L71J 4U7JA 1L0NK 3SWKA 3VRAC 1KYOI 2QJKB 1JY3N 4YSYC 3CIRD 2OYIA 1SQQD 2K9YA 3T97A 2Q7CA 2N1TC 4DHZA 5CJ0A 2YKQA 1VQPP 2H43A 1H0TB 1IK7A 4UB8E 1HUCA 2W6BA 2BCCE 1VQOP 3LW5H 3A0HE 4I7ZC 5AVRB 1NKNA 3NXSA 3A0BE 3AEFC 3FX0A 1EZVI 4JQ0D 3TSIA 1Q2NA 4DT0A 3L73G 5AW2B 4GOEA 1PV3A 3KZIE 2E75D 1S2EA 3CCQP 3BVHA 1FS0E 2ZYAA 2Z5HA 2KSEA 1YYCA 3HE5B 1M8OB 3RK3D 2XDJA 3V2RA 1K73Q 2FYUG 1URQD 2QJYB 2WSFH 2WZ7A 3CCJP 1NYHA 2QE7H 2KS1B 3AE6C 2J5UA 1ZMEC 1KYOD 3L70E 3HD7C 3AE3D 3V5BA 1SQVE 1XTCC 1FZCC 3ABVC 4WY4B 2E43A 3H1IJ 3GF3A 2AXTH 4NPEA 1JY3P 4CPGA 2ZVOB 1L0LG 1VL2A 2WWWA 3TGUD 1L0VD 2Q6QA 2OTLP 3GHGA 2WU5D 1USEA 3RL0C 3AE2D 1EZVD 4N78E 1NU1J 4D6TG 1PP9G 3P4PD 2ZT9D 5BU8B 2NPSB 1L4AA 1JY2N 1NTZD 1X79B 1PIXA 4AYCA 1LNQA 4YSYD 4C7NA 1LTJA 1BGYD 2N1TD 1SQQJ 1EDLA 2WPRA 1YBKA 1XTGB 5KLVD 1YTZI 2K1AA 3B5NB 3O6QB 3NFQA 2JR8A 1T3UA 3B4SA 1FJPA 3Q5RA 1S5LE 4YTMC 1KC8Q 1FZGA 3EFFK 1RH5B 2H88D 1TU3F 3AEFD 2JO1A 1KF6C 3MUDC 2VRSA 3CL3D 2PFXA 4H13B 2E76C 1N73A 4IL6H 4W7YA 1NVOA 2OYHC 3AE5C 3FXDA 1E5WA 3CWBE 2WU2C 3F89A 1MUUA 2Q1KA 2QIWA 3R2PA 1S1CX 1KD1Q 1JTHA 3JC22 2KIKA 3T97B 1HJ0A 3AE6D 3I5CA 4RO0A 2D2CC 5APSA 4U3FD 1T3JA 1GTWA 1SQBE 2IPPA 1JM0A 3HD7D 1IFPA 3H1LE 4RESB 2ZFCA 2B9BA 1D7MA 1J1DC 1JY2P 3ABVD 1FZEA 1RQUA 4H44C 3NTNA 1GDTA 2WITA 4BRYA 1SQXE 3BRVB 1AQTA 1RE3A 5AW0B 3TGUJ 3H6PA 3AE8C 1RF0A 5H2FE 3KHUA 3W68A 1QLBC 3KPEA 5CHXA 4OGQC 3RL0D 5B5EH 5KLIC 2MJZA 2ZXXA 4HH2A 1NTKK 3H1JJ 3P8MC 3L75G 3AEBC 4R4MA 3R4YA 1L0NG 1NTZJ 1LTAC 3M0AA 1JNMA 4DHIB 4BXLA 3CC4P 1BGYJ 1JOCA 3IN6A 4YSZC 2BEQD 3AE1C 5KLVJ 4I1LA 4ZNCA 2QVAA 3L73E 1R8EA 3H1KJ 3CXHE 3IR9A 1S9KE 2YXQB 2FFDA 1KILD 5GTIH 2O1KA 4YTMD 2QEXP 4H0LC 1BE3D 1YQ4C 1YJWP 2FYUE 1KF6D 3GHGB 1MFTA 1NTME 2E76D 3PH0A 5KJ7C 2ZXEB 1P84H 1N7LA 1FE6A 2WU2D 5KAFE 3L74D 4M3LA 1FC2C 1DEEG 1L4AB 3JCUH 3C1LA 1PFIA 2QG4A 3CCVP 3VYIA 4C7NB 1OW8A 2FYNB 1LTJB 2JWDA 2JDIH 2YMKA 1YIJP 1L0LE 2D2CD 3WU2E 1GK4A 2IBZG 2ZFYA 4U3FJ 1OVVA 2HYNA 1BCCE 1LTBC 2N1TA 1KQFB 1QLED 2XZRA 3L37A 4WBAA 1ZOYC 1Q86Q 3CCUP 5AVSB 4D6TE 1PP9E 4MN4C 1M1JC 3ITKA 1VDFA 5DJTB 3AE8D 1OWAA 4AQRD 4OGQD 1KB9E 2QA4P 1NU1K 2H8PD 4LC1A 1IK9A 1N73B 1ZV8A 3NMDA 2FKWB 2R32A 4PV1C 3AEBD 1ZR4A 1IFDA 1NO4A 3L72G 1MV8A 4L73A 1JTHB 3KQGA 1ZRTD 3Q3DA 1GU4A 2KP8A 2DW3A 4YSZD 1A02J 2K37A 3H25A 3AE1D 2KSJA 4Y99B 4ZKUA 2YIUC 1LTTC 3V2QA 4HB1A 1W2BO 2ITAA 4BRYB 3RGUA 3HD7A 3OJAB 5GTHE 4R4LA 2WTYA 1OZHA 4H0LD 1YQ4D 3E1RA 3K5BA 1BE3J 3OAKA 3BCCG 3H1HD 1DD3A 3VN0A 2PP6A 5APQA 5KJ7D 1Y8AA 3G4SP 4EDFA 3CC2P 2E75B 1M1KQ 5TISE 4UB8H 2IZ1A 3RK3B 2XNXA 3MIWA 3A0HH 3CWBG 3A0BH 2WSFJ 1NAFA 1UIXA 2WPVB 1ZOYD 2WT7A 1RQVA 3VMAA 2GUVA 4KHXA 4DHJA 1AJYA 2FYZA 3KZIH 1RE4C 1GK6A 3WUUA 1L0NE 1OVUA 1KILA 3BRTB 1SQBG 2CK3H 2XV5A 4ZMDA 2WQYC 1LJ2A 1FDMA 3KDPB 3AEAC 1NTKG 1S4XA 3BASA 4TT3H 1BSHA 2RKLA 3L71G 1NU1D 3G9RA 2M3EA 4HJGH 1AQ5A 1P84I 1NTZK 4PD4E 3A5TA 2OYHA 3P8CE 2QJPC 4NPDA 2YXRB 1VF5B 1X22A 3RL0g 2FXMA 2ZT9B 1FAVA 2CPSA 3VR9C 5KLVK 4YT0C 1FJKA 1N7SC 3AECC 1MFZA 2BS2C 3M9HA 3USSA 2QJKC 3JSVC 1IZNB 2N1TB 1SQPK 1VPCA 2A45H 1HGZA 2R44A 1LTIC 1PGQA 2Q3EA 1GU5A 2BS4C 1N8RQ 3S9OA 1T6AA 1M7LA 3H1HJ 5KKZB 1OFCX 1OW6A 2IBZE 3U59A 5AW5B 5CBNA 3CCMP 3CCRP 3EWKA 4I2LC 5AVUB 1P84D 3D71A 2R5BA 2CPBA 1NTMG 1Q82Q 5APWA 1Y9BA 3CCSP 1S5LH 5B66E 3V4WA 3L73J 4GOFA 2G8YA 2FXPA 3GF7A 4O9BA 3KXDA 1FDOA 4DOJA 3HD7B 2OTJP 2OQQA 1VQ6P 2W27A 2FYUJ 2L5GB 3N4XA 2V7QH 1KQLA 2O01J 1OX3A 4WY4C 3KYQA 3L72E 3GW6A 4K35A 1DEBA 1BCCG 5AW1B 3AEAD 3M91A 1L2PA 2Q3IA 1NKZB 3MHVA 2WSSH 2I8DA 5AVVB 1KILE 3RL0B 3H1JD 4NPFX 5KJ7A 3GG2A 1Y47A 3IFMA 1SQQG 3VRAD 2HODA 1LWUC 1SQVK 3VR9D 1ZXGA 2L91A 3AEDC 1N7SD 2NPSC 1T2KC 2JWAA 3AECD 4KT0J 2WSCH 2I1JA 3BCCE 2M8RA 2R3CA 5H2FH 3D70A 1J1EB 3H1KD 4RKUJ 2WT7B 3L75D 1SQPD 1JO5A 2FY8A 1G2CA 2M5AA 3B5NC 1SFCC 1WRGA 1KILB 3WUTA 4LDTA 1M1JA 5AVQB 5CBOA 3FWNA 2A06D 1DX7A 1LTGC 3ZDMA 1YTZT 4YXDC 3MTUE 2E76B 2OYHB 4H13C 4ASVA 1R5SA 3CXHH 1USDA 2AXTE 4C46A 4I6MC 3CMEP 3P4SC 5K5GB 2PAJA 1FDIA 1CSBA 2D2CB 2OYIC 5C3JC 2O01H 2BCCD 2P2UA 3AE4C 1NTKE 4LLHA 1Q81Q 3AE7C 1RF1C 1IFJA 2A45I 3L71E 1LGHB 1EXIA 4L75A 2GA1A 4WY4D 3LIDA 3M0DC 1IFIA 1PPJE 1SS1A 1EZVG 4A7PA 3RBXA 3PTZA 4JYBA 3E1IA 1HF9A 2AEMA 3WU2H 1HBWA 4OGQB 3AEGC 1LT9A 3S4RA 2LR2A 5KLIB 4ASWA 3VR8C 2KI7B 1BGYG 4OWFA 4UB6E 1QVFO 3CX5E 3AEDD 2NPSD 3AEEC 3L70D 3II6A 1SQVD 1URQA 2YO2A 1NWQA 2RH0A 1RHZB 1WT6A 1NENC 4KX6C 2LXCB 1CI6A 1VQKP 1KQSO 3PRJA 1KB9H 3L75J 1MZ9A 2B89A 1ZN5A 1SQPJ 1SFCD 2QM8A 1HVVA 1EXJA 2PGDA 3G6EP 2ZJSE 3IAOA 3VONA 3HUSC 1FZBA
chains in the Genus database with same CATH topology
2ZT9B 1WMKA 4H0LB 4GDOA 1OW8A 2WDVC 2WDRC 1YQ3C 1PIXA 3GLMA 4YTND 3P4SC 3P4QD 3VR9C 4YTPC 2QJYC 1OW7A 2YMKA 4I7ZC 3P4RC 4YSYD 4YT0C 2D2CD 3AE8C 3AEAD 2V7QJ 1NEND 3B71A 2WS3D 3AE5D 5C2TC 5L8RJ 1QLBC 3AECC 4PV1D 1FDIA 1DD3A 3AEFC 2D2CB 4YSXC 3D6YA 4OGQC 2BS2C 4YXDD 1KORA 3GMAA 5C3JC 1S5LX 2QJKC 3AE4C 4PV1B 2WDQC 2H89C 4H13D 1KILE 5KLIC 3RK3E 3AE7C 2FBWD 2WP9C 1JB0J 1KMIZ 1NEKD 1U57A 1KQFB 2B76C 1PV3A 2E74C 2E75D 1MKMA 1EXIA 1ZOYC 2JP3A 1ZP0D 3AEBC 3VRBD 3VRAD 4R4MA 3R4YA 2E75B 3O6QA 2WDVD 2WQYD 3Q5RA 1YQ3D 2WDRD 1Q90D 3P4SD 1OMIA 3VR9D 4YTPD 4KX6D 3P4RD 3AEDC 1VF5C 3FGAD 3RL0g 3AE8D 2BS4C 4YTMC 5C2TD 1GMJA 3AECD 3S9OA 2H88D 1TU3F 4KT0J 3AEFD 4YSXD 4OGQD 2ACZC 5C3JD 1HF9A 2JO1A 3AE4D 3Q1MA 3IN6A 1L0VC 1KF6C 2H89D 2WDQD 4H44D 4YSZC 1NYHA 4Z1MH 4OGQB 3AE7D 3AE6C 2NZ2A 1OW6A 2BEQD 2J5UA 3AE1C 3AEGC 4H13B 1DIPA 2WP9D 1ZMEC 3CIRC 3D70A 2WSCJ 2B76D 2BS3C 4Y28J 2E76C 4H44B 2WSFJ 1UIXA 4RKUJ 3SFEC 3Q2YA 1E7PC 3AE3D 2E74D 3AE5C 3VR8C 2WPVB 2WU5C 1ZOYD 4PV1C 1ZRTE 3AEBD 1R8EA 3AE2C 3EWKA 1K05A 3AE9C 1RQVA 2E74B 1KTMA 3ABVC 1KFYC 4YT0D 2WU2C 1AJYA 3GF3A 3SFDC 3AEDD 1VF5D 3AEEC 3D71A 4YTMD 3P4PC 4XFJA 4I7ZB 2ZT9C 2IDBA 4H0LC 1PL5A 2QIWA 2FYNC 1S1CX 1VL2A 1Y9BA 1YQ4C 4IL6X 4U7JA 3Q3DA 2ACZD 3D6ZA 3VRBC 3VRAC 2MKVA 1L0VD 1KF6D 1NGMB 4YSZD 4YTNC 3Q5SA 2WQYC 3T97B 3P4QC 1HJ0A 3H25A 3AEGD 3AE1D 3C8VA 3AE6D 2G8YA 3CIRD 4YSYC 2D2CC 2G3AA 3AEAC 1NENC 2WS3C 4KX6C 1DD4A 2E76D 2FXPA 2K9YA 2YIUC 3GF7A 3SFED 4TT3H 1KQGB 3VR8D 1FDOA 2WSEJ 2WU5D 4YXDC 2H88C 3G9RA 2E76B 3AE2D 3Q5PA 3AE9D 2P10A 2BEZF 3LW5J 5KKZC 4H13C 1KFYD 3ABVD 1RQUA 2FBWC 5M1BA 2WU2D 4H44C 1NEKC 1EXJA 3SFDD 2QJPC 4R4LA 3AEED 2OQQA 3P4PD 1K04A 2ZT9D 1IK7A 4H0LD 3IAOA 1VF5B 2E75C 3AE3C 2QSIA 1YQ4D 1ZP0C 2O01J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OW8 A;  2WDV C;  2WDR C;  1YQ3 C;  4YTN D;  3P4S C;  3P4Q D;  3VR9 C;  4YTP C;  4YSY D;  1OW7 A;  3P4R C;  4YT0 C;  3AE8 C;  3AEA D;  1NEN D;  2WS3 D;  3B71 A;  3AE5 D;  5C2T C;  1QLB C;  3AEC C;  3AEF C;  4YSX C;  2BS2 C;  4YXD D;  5C3J C;  3AE4 C;  2WDQ C;  2H89 C;  3AE7 C;  2FBW D;  2WP9 C;  1NEK D;  2B76 C;  1PV3 A;  1ZOY C;  3VRB D;  1ZP0 D;  3AEB C;  3VRA D;  2WDV D;  2WQY D;  2WDR D;  1YQ3 D;  3P4S D;  3VR9 D;  4YTP D;  4KX6 D;  3P4R D;  3AED C;  3AE8 D;  4YTM C;  2BS4 C;  5C2T D;  3AEC D;  3S9O A;  2H88 D;  3AEF D;  4YSX D;  2ACZ C;  5C3J D;  3AE4 D;  1L0V C;  1KF6 C;  2H89 D;  2WDQ D;  4YSZ C;  3AE7 D;  3AE6 C;  3AEG C;  1OW6 A;  2WP9 D;  3AE1 C;  3CIR C;  2B76 D;  2BS3 C;  1E7P C;  3SFE C;  3AE3 D;  3AE5 C;  3VR8 C;  2WU5 C;  1ZOY D;  3AEB D;  3AE2 C;  1K05 A;  3AE9 C;  1KTM A;  3ABV C;  1KFY C;  4YT0 D;  2WU2 C;  3SFD C;  3AED D;  3AEE C;  4YTM D;  3P4P C;  1YQ4 C;  2ACZ D;  3VRB C;  3VRA C;  1L0V D;  1KF6 D;  4YSZ D;  4YTN C;  2WQY C;  3P4Q C;  3AE6 D;  3AEG D;  4YSY C;  3AE1 D;  3CIR D;  2G3A A;  3AEA C;  1NEN C;  2WS3 C;  4KX6 C;  3SFE D;  3VR8 D;  2WU5 D;  4YXD C;  2H88 C;  3AE2 D;  3AE9 D;  1KFY D;  3ABV D;  2FBW C;  2WU2 D;  1NEK C;  3SFD D;  3AEE D;  3P4P D;  1K04 A;  3AE3 C;  1YQ4 D;  1ZP0 C; 
#chains in the Genus database with same CATH topology
 5APU A;  4EOT A;  4H0L B;  1RE4 A;  1GW3 A;  5E79 E;  3GLM A;  1T8Z A;  5CJ4 A;  4N78 D;  3AE5 D;  5AW6 B;  3V6I A;  1VQ4 P;  1M57 D;  1ZLL A;  3H1I E;  4YXD D;  1PGJ A;  4PJ0 E;  1S5L X;  4YXW H;  1EC5 A;  1QL1 A;  4H13 D;  1VQM P;  1X8Y A;  3TF5 A;  5CCH C;  5APY A;  2I1K A;  2PRR A;  4EYY Q;  1KV4 A;  3TK1 A;  2HOD B;  5AVZ B;  4EIJ A;  2ZYG A;  1N2D C;  5GTH H;  3P4S D;  1G1J A;  2UWJ E;  4YPC A;  1NU1 E;  5AVT B;  2IFM A;  1LTJ C;  5C3J D;  3AE4 D;  4H44 D;  4GT1 A;  3AE7 D;  2BCC J;  3CCL P;  2FYU K;  2W90 A;  1GL2 C;  3E7K A;  1G2C B;  4L74 A;  2M5A B;  1KFY C;  2R5D A;  2OGU A;  1SQQ E;  1M1J B;  3VRB C;  3CWB D;  5TIS H;  4EI2 A;  3A3Y B;  3P4Q C;  3AEG D;  2OTK E;  3W67 A;  3TNU A;  2GM4 A;  1DD4 A;  1YJN P;  1NH4 A;  1AVY A;  3VR8 D;  1L0L K;  1N73 C;  1IO4 A;  1EDI A;  3QWO C;  1SP4 A;  3AEE D;  3CXH I;  5AW8 B;  2C0X A;  1ZR2 A;  2QSI A;  1KN7 A;  1ZP0 C;  3H1L D;  3L70 J;  2H7H A;  1SQV J;  4DDG A;  2P58 A;  1OW7 A;  1NEN D;  4DDI A;  4HKZ H;  1A02 F;  3FXE A;  4YSX C;  1SQX D;  2YNY A;  3TYY A;  3I56 P;  1BE3 G;  2WDQ C;  4DCK A;  3RK3 E;  3UIA A;  1JB0 J;  1KMI Z;  2O3J A;  1U57 A;  1GZL A;  1FZC A;  3V2N A;  2JP3 A;  3V2P A;  2HG5 D;  1U7J A;  1SLQ A;  1JUN A;  1KYO E;  4DZO A;  3L74 G;  4JBZ A;  1LTS C;  1LT9 B;  4BWN A;  3Q1M A;  4QMA A;  4N3Y B;  5CCH D;  3EFG A;  3P32 A;  3TGU E;  3U1C A;  2O01 N;  5TJH A;  3L4F A;  3CD6 P;  1VQN P;  3C9I A;  3BCC J;  2IDB A;  2HFE D;  2J59 M;  2N9Y B;  1URQ B;  3L73 D;  3EQ2 A;  4IFM A;  3CXH D;  1S9K D;  1EZV E;  1CI6 B;  3H1J E;  3C8V A;  2OYO A;  2B87 A;  1H88 A;  1HJB A;  1GL2 D;  3G71 P;  2QRX A;  1DH3 A;  3V4Q A;  1KB9 I;  5AW4 B;  1NTZ E;  4FJV A;  3MD0 A;  2N9B A;  1KFY D;  2P1J A;  2FYU D;  4HYT B;  3VMY A;  3BAT A;  1BDC A;  1BGY E;  1NTM D;  2FFD C;  3CI9 A;  3RK2 C;  3AE3 C;  2P7J A;  1SFC A;  1AV1 A;  5KLV E;  2HLO A;  1KFN A;  3P4Q D;  3CWB J;  2JKV A;  3P4R C;  3VP9 A;  2V7Q J;  3CLQ A;  1IJD B;  2HPC A;  1YI2 P;  3MUD A;  1AA0 A;  4PV1 D;  2KLV A;  4WWI A;  3VTP C;  4JYC A;  5CCG C;  1JY3 O;  3VP8 A;  1PPJ G;  3SWY A;  1L0L D;  1NAY A;  2E74 C;  1ZP0 D;  2RN0 A;  2E5T A;  5AW7 B;  1SQB J;  4N6J A;  2KXP B;  1BCC D;  2R3S A;  3H1L J;  1VF5 C;  2M0B A;  4B86 A;  2YKP A;  2KYV A;  1VQ5 P;  4WVZ A;  4YSX D;  4KJM A;  1QL2 A;  2ACZ C;  3CC7 P;  1SQX J;  4DJG A;  2WDQ D;  5KAI E;  4D6T D;  1PP9 D;  2WSC J;  4GIF A;  3AE9 C;  1RF1 A;  3H1H G;  2AEF A;  1X0T A;  1KB9 D;  1W2E A;  4U3F E;  4I7Z B;  5AW3 B;  1J2J B;  3M0D A;  5BU5 A;  1NGM B;  1EQ7 A;  5AVY B;  3TNU B;  4YTN C;  3SSU A;  2Y9Y A;  2WS3 C;  1FZF A;  2H88 C;  3Q5P A;  5KKZ C;  3CPW O;  2Z4E A;  1NEK C;  2IX7 C;  4RJT A;  2ZAE B;  2OAR A;  3H1I G;  1NHL A;  4YTP C;  2QJY C;  1FU1 A;  3MP7 B;  5C2T C;  5L8R J;  3D6Y A;  2WPQ A;  2H89 C;  1NOH A;  3HRN A;  1FZC B;  1ZW0 A;  3RK2 D;  2K9J A;  4PD4 I;  1NTM J;  1EDK A;  2WQY D;  1HGV A;  1NU1 G;  1Q7Y Q;  1OMI A;  2W6A A;  3P4R D;  1CZQ A;  3HUS A;  1JY2 O;  3L35 A;  1NJI Q;  3LIE A;  5CCG D;  2IFN A;  4ZKP A;  2M3B A;  1HTL C;  1DIP A;  1VQ7 P;  1E7P C;  1HWT C;  2E5Y A;  2B88 A;  1BE3 E;  2E74 D;  1VQ9 P;  1L0L J;  1OXZ A;  3B8E B;  5CCH A;  4YT0 D;  1AVO A;  1KFM A;  1LWU B;  1VF5 D;  3VMZ A;  1BCC J;  1RY3 A;  1PL5 A;  4XE5 B;  5EFW B;  5APX A;  2ACZ D;  2B87 B;  3Q5S A;  3L74 E;  3I55 P;  4D6T J;  1PP9 J;  1GD2 E;  1PGO A;  1VQ8 P;  1L0N D;  1G1I A;  3AE9 D;  2IBZ I;  2IYP A;  1J1E C;  2FBW C;  1GL2 A;  1K04 A;  1SFC B;  3RBZ A;  5C39 A;  2YMY A;  4UB6 H;  1YIT P;  2YO3 A;  1YQ3 C;  3CX5 H;  3A7O A;  4PD4 D;  4YTN D;  1OIP A;  1KIL C;  2HPC B;  3P8C D;  4OVN F;  2WS3 D;  2ZYD A;  1X9V A;  1M90 Q;  2Z5I A;  4L76 A;  3U1A A;  1NEK D;  2O1J A;  4AUW A;  3PJS K;  1YJ9 P;  1JEK A;  1MKM A;  3M9Q A;  1FOS F;  4YTP D;  2KZI A;  5C2T D;  3OA7 A;  3F5H A;  5E79 H;  2KUB A;  3TGU G;  2H89 D;  1EDJ A;  1J1D B;  4W7Z A;  2OYI B;  4JF7 A;  1LP1 A;  4H44 B;  3FWL A;  2HR3 A;  1IFM A;  1RF1 B;  4PJ0 H;  2K88 A;  2KOG A;  1ZRT E;  2W83 C;  4C7R A;  5KAF H;  3H32 A;  5KTB A;  2YKO A;  1YHQ P;  4IFF A;  3SFD C;  2IBZ D;  3MZW B;  3H1J G;  3OW2 O;  2V4H A;  3D6Z A;  1NTZ G;  2KNC A;  2WMM A;  1QX8 A;  2GUS A;  1PZQ A;  3CCE P;  1KQG B;  1VQL P;  1TFF A;  2WSE J;  1SQB K;  1JCD A;  2P10 A;  2IYO A;  5KLV G;  1SVF A;  3HE4 A;  5APV A;  1T2K D;  1GW4 A;  3H1H E;  1K9M Q;  3H1K G;  2W8Z A;  1SQX K;  4GOD A;  1SQP G;  1K8A Q;  3B71 A;  2P67 A;  1OVR A;  4IL6 E;  2ZVN B;  3GMA A;  3HTK A;  1L0N J;  3IF4 A;  3B5N D;  3L72 D;  2FBW D;  2WP9 C;  2XKM A;  1R5L A;  2A06 G;  2K9J B;  5BVZ A;  3VOP A;  3CMA P;  2LKM A;  1YQ3 D;  3HUS B;  2POH A;  5AW9 B;  1GMJ A;  3P7K A;  1JMM A;  1FBM A;  3GHG C;  1KZU B;  1IC2 A;  2BAS A;  2KB7 P;  4Z1M H;  2NZ2 A;  2Y0D A;  2XU6 A;  5CCG A;  3SFE C;  3Q2Y A;  4U3F G;  5AVW B;  2KK7 A;  1FZA A;  1JCC A;  3BCC D;  1KTM A;  1L4A C;  2Q9I A;  2BCC G;  2SPZ A;  4XFJ A;  2FYN C;  3WUV A;  1CW5 A;  1N7S A;  1U7M A;  3QH9 A;  2K3R A;  5B5E E;  1KYO H;  3VMX A;  2NRG A;  1LT1 A;  3MGN A;  1NTM K;  4K3A A;  1GL2 B;  4TLF A;  3PP5 A;  3SFD D;  3M06 A;  1H0T A;  1N86 A;  4I6L A;  1PGP A;  2WSE H;  4GDO A;  3CX5 I;  4WB4 A;  2WDV C;  2WDR C;  2J58 A;  1M56 D;  4IFD K;  3PHL A;  1IFN A;  4LGD E;  1Z56 A;  2AXC A;  3L70 G;  4PV1 B;  1SQV G;  2IZ0 A;  2B76 C;  5GTI E;  2RMZ A;  5DJU B;  1SQB D;  4OH8 B;  4W80 A;  1QVG O;  2FXO A;  1NTK D;  1Q90 D;  2JJL A;  4KX6 D;  3O8Z A;  5CMZ A;  3HE5 A;  3L71 D;  2C9L Y;  3WMM 0;  2YIU B;  1SQQ K;  2A45 G;  2LXB A;  4Y99 C;  1LP1 B;  1PPJ D;  1P84 E;  2WP9 D;  1BSN A;  3CIR C;  1FOS E;  3L72 J;  4Y28 J;  2KS1 A;  1UII A;  3H32 B;  4PD4 H;  2C9N Y;  3JCU E;  1K05 A;  2KZJ A;  1RE3 C;  1JMB A;  2Y0E A;  4WY4 A;  2KNC B;  1RF0 C;  4IL6 X;  3L36 A;  2MKV A;  1AFO A;  2G3A A;  1W5C E;  3CX5 D;  3SFE D;  1LT9 C;  5KAI H;  2BEZ F;  3LW5 J;  1QEX A;  3HE4 B;  1L4A D;  5M1B A;  1LWU A;  2E75 C;  5AVX B;  3L74 J;  2Y9Z A;  1WMK A;  2NPS A;  2KLU A;  2JEE A;  4JPZ B;  3RK3 C;  1URQ C;  1S3J A;  3A2A A;  3HTK B;  3N7N A;  4IOI H;  2XND H;  1KOR A;  3TDK A;  1QGK B;  3SWF A;  2C0W A;  3G3Z A;  1BDD A;  3B5N A;  3VRB D;  2FFD B;  3H1I D;  3O6Q A;  3RK2 B;  2WDV D;  2WDR D;  2Y0C A;  3H1K E;  3FGA D;  3L75 E;  1SQP E;  1HH0 A;  2AEJ A;  4XA4 A;  5B66 H;  1L0V C;  1E79 H;  3H1L G;  2B76 D;  2BS3 C;  2W6J H;  3M9B A;  2QJP B;  5APT A;  2QM7 A;  2WPS A;  2WU5 C;  3PLN A;  2E42 A;  3AE2 C;  2E74 B;  1SQX G;  2A06 E;  1H89 A;  2Q5U A;  1NTK J;  3P4P C;  2ZT9 C;  1H8A A;  1N7S B;  2WVR A;  3S1K A;  1S72 P;  4GKG A;  3L71 J;  4U7J A;  1L0N K;  3SWK A;  3VRA C;  1KYO I;  2QJK B;  1JY3 N;  4YSY C;  3CIR D;  2OYI A;  1SQQ D;  2K9Y A;  3T97 A;  2Q7C A;  2N1T C;  4DHZ A;  5CJ0 A;  2YKQ A;  1VQP P;  2H43 A;  1H0T B;  1IK7 A;  4UB8 E;  1HUC A;  2W6B A;  2BCC E;  1VQO P;  3LW5 H;  3A0H E;  4I7Z C;  5AVR B;  1NKN A;  3NXS A;  3A0B E;  3AEF C;  3FX0 A;  1EZV I;  4JQ0 D;  3TSI A;  1Q2N A;  4DT0 A;  3L73 G;  5AW2 B;  4GOE A;  1PV3 A;  3KZI E;  2E75 D;  1S2E A;  3CCQ P;  3BVH A;  1FS0 E;  2ZYA A;  2Z5H A;  2KSE A;  1YYC A;  3HE5 B;  1M8O B;  3RK3 D;  2XDJ A;  3V2R A;  1K73 Q;  2FYU G;  1URQ D;  2QJY B;  2WSF H;  2WZ7 A;  3CCJ P;  1NYH A;  2QE7 H;  2KS1 B;  3AE6 C;  2J5U A;  1ZME C;  1KYO D;  3L70 E;  3HD7 C;  3AE3 D;  3V5B A;  1SQV E;  1XTC C;  1FZC C;  3ABV C;  4WY4 B;  2E43 A;  3H1I J;  3GF3 A;  2AXT H;  4NPE A;  1JY3 P;  4CPG A;  2ZVO B;  1L0L G;  1VL2 A;  2WWW A;  3TGU D;  1L0V D;  2Q6Q A;  2OTL P;  3GHG A;  2WU5 D;  1USE A;  3RL0 C;  3AE2 D;  1EZV D;  4N78 E;  1NU1 J;  4D6T G;  1PP9 G;  3P4P D;  2ZT9 D;  5BU8 B;  2NPS B;  1L4A A;  1JY2 N;  1NTZ D;  1X79 B;  1PIX A;  4AYC A;  1LNQ A;  4YSY D;  4C7N A;  1LTJ A;  1BGY D;  2N1T D;  1SQQ J;  1EDL A;  2WPR A;  1YBK A;  1XTG B;  5KLV D;  1YTZ I;  2K1A A;  3B5N B;  3O6Q B;  3NFQ A;  2JR8 A;  1T3U A;  3B4S A;  1FJP A;  3Q5R A;  1S5L E;  4YTM C;  1KC8 Q;  1FZG A;  3EFF K;  1RH5 B;  2H88 D;  1TU3 F;  3AEF D;  2JO1 A;  1KF6 C;  3MUD C;  2VRS A;  3CL3 D;  2PFX A;  4H13 B;  2E76 C;  1N73 A;  4IL6 H;  4W7Y A;  1NVO A;  2OYH C;  3AE5 C;  3FXD A;  1E5W A;  3CWB E;  2WU2 C;  3F89 A;  1MUU A;  2Q1K A;  2QIW A;  3R2P A;  1S1C X;  1KD1 Q;  1JTH A;  3JC2 2;  2KIK A;  3T97 B;  1HJ0 A;  3AE6 D;  3I5C A;  4RO0 A;  2D2C C;  5APS A;  4U3F D;  1T3J A;  1GTW A;  1SQB E;  2IPP A;  1JM0 A;  3HD7 D;  1IFP A;  3H1L E;  4RES B;  2ZFC A;  2B9B A;  1D7M A;  1J1D C;  1JY2 P;  3ABV D;  1FZE A;  1RQU A;  4H44 C;  3NTN A;  1GDT A;  2WIT A;  4BRY A;  1SQX E;  3BRV B;  1AQT A;  1RE3 A;  5AW0 B;  3TGU J;  3H6P A;  3AE8 C;  1RF0 A;  5H2F E;  3KHU A;  3W68 A;  1QLB C;  3KPE A;  5CHX A;  4OGQ C;  3RL0 D;  5B5E H;  5KLI C;  2MJZ A;  2ZXX A;  4HH2 A;  1NTK K;  3H1J J;  3P8M C;  3L75 G;  3AEB C;  4R4M A;  3R4Y A;  1L0N G;  1NTZ J;  1LTA C;  3M0A A;  1JNM A;  4DHI B;  4BXL A;  3CC4 P;  1BGY J;  1JOC A;  3IN6 A;  4YSZ C;  2BEQ D;  3AE1 C;  5KLV J;  4I1L A;  4ZNC A;  2QVA A;  3L73 E;  1R8E A;  3H1K J;  3CXH E;  3IR9 A;  1S9K E;  2YXQ B;  2FFD A;  1KIL D;  5GTI H;  2O1K A;  4YTM D;  2QEX P;  4H0L C;  1BE3 D;  1YQ4 C;  1YJW P;  2FYU E;  1KF6 D;  3GHG B;  1MFT A;  1NTM E;  2E76 D;  3PH0 A;  5KJ7 C;  2ZXE B;  1P84 H;  1N7L A;  1FE6 A;  2WU2 D;  5KAF E;  3L74 D;  4M3L A;  1FC2 C;  1DEE G;  1L4A B;  3JCU H;  3C1L A;  1PFI A;  2QG4 A;  3CCV P;  3VYI A;  4C7N B;  1OW8 A;  2FYN B;  1LTJ B;  2JWD A;  2JDI H;  2YMK A;  1YIJ P;  1L0L E;  2D2C D;  3WU2 E;  1GK4 A;  2IBZ G;  2ZFY A;  4U3F J;  1OVV A;  2HYN A;  1BCC E;  1LTB C;  2N1T A;  1KQF B;  1QLE D;  2XZR A;  3L37 A;  4WBA A;  1ZOY C;  1Q86 Q;  3CCU P;  5AVS B;  4D6T E;  1PP9 E;  4MN4 C;  1M1J C;  3ITK A;  1VDF A;  5DJT B;  3AE8 D;  1OWA A;  4AQR D;  4OGQ D;  1KB9 E;  2QA4 P;  1NU1 K;  2H8P D;  4LC1 A;  1IK9 A;  1N73 B;  1ZV8 A;  3NMD A;  2FKW B;  2R32 A;  4PV1 C;  3AEB D;  1ZR4 A;  1IFD A;  1NO4 A;  3L72 G;  1MV8 A;  4L73 A;  1JTH B;  3KQG A;  1ZRT D;  3Q3D A;  1GU4 A;  2KP8 A;  2DW3 A;  4YSZ D;  1A02 J;  2K37 A;  3H25 A;  3AE1 D;  2KSJ A;  4Y99 B;  4ZKU A;  2YIU C;  1LTT C;  3V2Q A;  4HB1 A;  1W2B O;  2ITA A;  4BRY B;  3RGU A;  3HD7 A;  3OJA B;  5GTH E;  4R4L A;  2WTY A;  1OZH A;  4H0L D;  1YQ4 D;  3E1R A;  3K5B A;  1BE3 J;  3OAK A;  3BCC G;  3H1H D;  1DD3 A;  3VN0 A;  2PP6 A;  5APQ A;  5KJ7 D;  1Y8A A;  3G4S P;  4EDF A;  3CC2 P;  2E75 B;  1M1K Q;  5TIS E;  4UB8 H;  2IZ1 A;  3RK3 B;  2XNX A;  3MIW A;  3A0H H;  3CWB G;  3A0B H;  2WSF J;  1NAF A;  1UIX A;  2WPV B;  1ZOY D;  2WT7 A;  1RQV A;  3VMA A;  2GUV A;  4KHX A;  4DHJ A;  1AJY A;  2FYZ A;  3KZI H;  1RE4 C;  1GK6 A;  3WUU A;  1L0N E;  1OVU A;  1KIL A;  3BRT B;  1SQB G;  2CK3 H;  2XV5 A;  4ZMD A;  2WQY C;  1LJ2 A;  1FDM A;  3KDP B;  3AEA C;  1NTK G;  1S4X A;  3BAS A;  4TT3 H;  1BSH A;  2RKL A;  3L71 G;  1NU1 D;  3G9R A;  2M3E A;  4HJG H;  1AQ5 A;  1P84 I;  1NTZ K;  4PD4 E;  3A5T A;  2OYH A;  3P8C E;  2QJP C;  4NPD A;  2YXR B;  1VF5 B;  1X22 A;  3RL0 g;  2FXM A;  2ZT9 B;  1FAV A;  2CPS A;  3VR9 C;  5KLV K;  4YT0 C;  1FJK A;  1N7S C;  3AEC C;  1MFZ A;  2BS2 C;  3M9H A;  3USS A;  2QJK C;  3JSV C;  1IZN B;  2N1T B;  1SQP K;  1VPC A;  2A45 H;  1HGZ A;  2R44 A;  1LTI C;  1PGQ A;  2Q3E A;  1GU5 A;  2BS4 C;  1N8R Q;  3S9O A;  1T6A A;  1M7L A;  3H1H J;  5KKZ B;  1OFC X;  1OW6 A;  2IBZ E;  3U59 A;  5AW5 B;  5CBN A;  3CCM P;  3CCR P;  3EWK A;  4I2L C;  5AVU B;  1P84 D;  3D71 A;  2R5B A;  2CPB A;  1NTM G;  1Q82 Q;  5APW A;  1Y9B A;  3CCS P;  1S5L H;  5B66 E;  3V4W A;  3L73 J;  4GOF A;  2G8Y A;  2FXP A;  3GF7 A;  4O9B A;  3KXD A;  1FDO A;  4DOJ A;  3HD7 B;  2OTJ P;  2OQQ A;  1VQ6 P;  2W27 A;  2FYU J;  2L5G B;  3N4X A;  2V7Q H;  1KQL A;  2O01 J;  1OX3 A;  4WY4 C;  3KYQ A;  3L72 E;  3GW6 A;  4K35 A;  1DEB A;  1BCC G;  5AW1 B;  3AEA D;  3M91 A;  1L2P A;  2Q3I A;  1NKZ B;  3MHV A;  2WSS H;  2I8D A;  5AVV B;  1KIL E;  3RL0 B;  3H1J D;  4NPF X;  5KJ7 A;  3GG2 A;  1Y47 A;  3IFM A;  1SQQ G;  3VRA D;  2HOD A;  1LWU C;  1SQV K;  3VR9 D;  1ZXG A;  2L91 A;  3AED C;  1N7S D;  2NPS C;  1T2K C;  2JWA A;  3AEC D;  4KT0 J;  2WSC H;  2I1J A;  3BCC E;  2M8R A;  2R3C A;  5H2F H;  3D70 A;  1J1E B;  3H1K D;  4RKU J;  2WT7 B;  3L75 D;  1SQP D;  1JO5 A;  2FY8 A;  1G2C A;  2M5A A;  3B5N C;  1SFC C;  1WRG A;  1KIL B;  3WUT A;  4LDT A;  1M1J A;  5AVQ B;  5CBO A;  3FWN A;  2A06 D;  1DX7 A;  1LTG C;  3ZDM A;  1YTZ T;  4YXD C;  3MTU E;  2E76 B;  2OYH B;  4H13 C;  4ASV A;  1R5S A;  3CXH H;  1USD A;  2AXT E;  4C46 A;  4I6M C;  3CME P;  3P4S C;  5K5G B;  2PAJ A;  1FDI A;  1CSB A;  2D2C B;  2OYI C;  5C3J C;  2O01 H;  2BCC D;  2P2U A;  3AE4 C;  1NTK E;  4LLH A;  1Q81 Q;  3AE7 C;  1RF1 C;  1IFJ A;  2A45 I;  3L71 E;  1LGH B;  1EXI A;  4L75 A;  2GA1 A;  4WY4 D;  3LID A;  3M0D C;  1IFI A;  1PPJ E;  1SS1 A;  1EZV G;  4A7P A;  3RBX A;  3PTZ A;  4JYB A;  3E1I A;  1HF9 A;  2AEM A;  3WU2 H;  1HBW A;  4OGQ B;  3AEG C;  1LT9 A;  3S4R A;  2LR2 A;  5KLI B;  4ASW A;  3VR8 C;  2KI7 B;  1BGY G;  4OWF A;  4UB6 E;  1QVF O;  3CX5 E;  3AED D;  2NPS D;  3AEE C;  3L70 D;  3II6 A;  1SQV D;  1URQ A;  2YO2 A;  1NWQ A;  2RH0 A;  1RHZ B;  1WT6 A;  1NEN C;  4KX6 C;  2LXC B;  1CI6 A;  1VQK P;  1KQS O;  3PRJ A;  1KB9 H;  3L75 J;  1MZ9 A;  2B89 A;  1ZN5 A;  1SQP J;  1SFC D;  2QM8 A;  1HVV A;  1EXJ A;  2PGD A;  3G6E P;  2ZJS E;  3IAO A;  3VON A;  3HUS C;  1FZB A; 
#chains in the Genus database with same CATH homology
 2ZT9 B;  1WMK A;  4H0L B;  4GDO A;  1OW8 A;  2WDV C;  2WDR C;  1YQ3 C;  1PIX A;  3GLM A;  4YTN D;  3P4S C;  3P4Q D;  3VR9 C;  4YTP C;  2QJY C;  1OW7 A;  2YMK A;  4I7Z C;  3P4R C;  4YSY D;  4YT0 C;  2D2C D;  3AE8 C;  3AEA D;  2V7Q J;  1NEN D;  3B71 A;  2WS3 D;  3AE5 D;  5C2T C;  5L8R J;  1QLB C;  3AEC C;  4PV1 D;  1FDI A;  1DD3 A;  3AEF C;  2D2C B;  4YSX C;  3D6Y A;  4OGQ C;  2BS2 C;  4YXD D;  1KOR A;  3GMA A;  5C3J C;  1S5L X;  2QJK C;  3AE4 C;  4PV1 B;  2WDQ C;  2H89 C;  4H13 D;  1KIL E;  5KLI C;  3RK3 E;  3AE7 C;  2FBW D;  2WP9 C;  1JB0 J;  1KMI Z;  1NEK D;  1U57 A;  1KQF B;  2B76 C;  1PV3 A;  2E74 C;  2E75 D;  1MKM A;  1EXI A;  1ZOY C;  2JP3 A;  1ZP0 D;  3AEB C;  3VRB D;  3VRA D;  4R4M A;  3R4Y A;  2E75 B;  3O6Q A;  2WDV D;  2WQY D;  3Q5R A;  1YQ3 D;  2WDR D;  1Q90 D;  3P4S D;  1OMI A;  3VR9 D;  4YTP D;  4KX6 D;  3P4R D;  3AED C;  1VF5 C;  3FGA D;  3RL0 g;  3AE8 D;  2BS4 C;  4YTM C;  5C2T D;  1GMJ A;  3AEC D;  3S9O A;  2H88 D;  1TU3 F;  4KT0 J;  3AEF D;  4YSX D;  4OGQ D;  2ACZ C;  5C3J D;  1HF9 A;  2JO1 A;  3AE4 D;  3Q1M A;  3IN6 A;  1L0V C;  1KF6 C;  2H89 D;  2WDQ D;  4H44 D;  4YSZ C;  1NYH A;  4Z1M H;  4OGQ B;  3AE7 D;  3AE6 C;  2NZ2 A;  1OW6 A;  2BEQ D;  2J5U A;  3AE1 C;  3AEG C;  4H13 B;  1DIP A;  2WP9 D;  1ZME C;  3CIR C;  3D70 A;  2WSC J;  2B76 D;  2BS3 C;  4Y28 J;  2E76 C;  4H44 B;  2WSF J;  1UIX A;  4RKU J;  3SFE C;  3Q2Y A;  1E7P C;  3AE3 D;  2E74 D;  3AE5 C;  3VR8 C;  2WPV B;  2WU5 C;  1ZOY D;  4PV1 C;  1ZRT E;  3AEB D;  1R8E A;  3AE2 C;  3EWK A;  1K05 A;  3AE9 C;  1RQV A;  2E74 B;  1KTM A;  3ABV C;  1KFY C;  4YT0 D;  2WU2 C;  1AJY A;  3GF3 A;  3SFD C;  3AED D;  1VF5 D;  3AEE C;  3D71 A;  4YTM D;  3P4P C;  4XFJ A;  4I7Z B;  2ZT9 C;  2IDB A;  4H0L C;  1PL5 A;  2QIW A;  2FYN C;  1S1C X;  1VL2 A;  1Y9B A;  1YQ4 C;  4IL6 X;  4U7J A;  3Q3D A;  2ACZ D;  3D6Z A;  3VRB C;  3VRA C;  2MKV A;  1L0V D;  1KF6 D;  1NGM B;  4YSZ D;  4YTN C;  3Q5S A;  2WQY C;  3T97 B;  3P4Q C;  1HJ0 A;  3H25 A;  3AEG D;  3AE1 D;  3C8V A;  3AE6 D;  2G8Y A;  3CIR D;  4YSY C;  2D2C C;  2G3A A;  3AEA C;  1NEN C;  2WS3 C;  4KX6 C;  1DD4 A;  2E76 D;  2FXP A;  2K9Y A;  2YIU C;  3GF7 A;  3SFE D;  4TT3 H;  1KQG B;  3VR8 D;  1FDO A;  2WSE J;  2WU5 D;  4YXD C;  2H88 C;  3G9R A;  2E76 B;  3AE2 D;  3Q5P A;  3AE9 D;  2P10 A;  2BEZ F;  3LW5 J;  5KKZ C;  4H13 C;  1KFY D;  3ABV D;  1RQU A;  2FBW C;  5M1B A;  2WU2 D;  4H44 C;  1NEK C;  1EXJ A;  3SFD D;  2QJP C;  4R4L A;  3AEE D;  2OQQ A;  3P4P D;  1K04 A;  2ZT9 D;  1IK7 A;  4H0L D;  3IAO A;  1VF5 B;  2E75 C;  3AE3 C;  2QSI A;  1YQ4 D;  1ZP0 C;  2O01 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...