3VRBD

Mitochondrial rhodoquinol-fumarate reductase from the parasitic nematode ascaris suum with the specific inhibitor flutolanil and substrate fumarate
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
129
structure length
129
Chain Sequence
TSAAVTGAAPPQFDPIAAEKGFKPLHSHGTLFKIERYFAAAMVPLIPAAYFIHGREMDLCLALALTLHVHWGVWGVVNDYGRPFVLGDTLAAAVRVGAYIFTACLLAGLLYFNEHDVGLTRAFEMVWEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Flavoprotein subunit of complex II
publication title Crystal structure of mitochondrial quinol-fumarate reductase from the parasitic nematode Ascaris suum
pubmed doi rcsb
total genus 37
structure length 129
sequence length 129
chains with identical sequence H
ec nomenclature
pdb deposition date 2012-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF05328 CybS CybS, succinate dehydrogenase cytochrome B small subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3vrbD00
1KFYD 1YQ4C 3AE2C 1YQ3D 3SFDC 2ACZC 2FBWC 4YTPD 1KFYC 3AE1D 1YQ3C 2H88D 4YSZD 3CIRD 3AE9D 1ZOYD 3AEBD 3VR8C 2H88C 3CIRC 2BS4C 4YTND 3P4SD 3SFDD 3AEED 3AE6D 2ACZD 1ZP0D 3AE5C 4YTNC 3P4SC 2H89D 2B76C 3ABVD 2BS3C 1NEKD 3AE6C 3AEEC 3AEFC 1ZP0C 3AE7D 2H89C 3VR8D 3ABVC 3AEGD 1NEKC 1NENC 3AE7C 2BS2C 3AECC 3AEGC 3P4PD 2WU5C 3AE5D 2B76D 3AE4C 2WS3C 3AEFD 3P4PC 2WDRD 3VRBD 3P4QD 3P4RC 1NEND 5C2TC 2WQYD 2WDRC 3VR9D 3VRBC 3AECD 2WDVC 1L0VD 2WU5D 3P4QC 2WP9D 4YT0C 4YSYD 5C3JC 4YSXD 2WQYC 3AE4D 2WS3D 4YXDD 3VR9C 1KF6C 1E7PC 1L0VC 2WU2D 2WP9C 4KX6D 4YSYC 4YSXC 4YXDC 3P4RD 2WU2C 3AE8C 5C2TD 4KX6C 3AE3D 4YTMD 3VRAD 2WDVD 3SFED 4YTPC 4YT0D 5C3JD 2WDQD 3AE3C 1KF6D 3AE1C 3AEAD 3VRAC 4YTMC 4YSZC 3AEDD 3SFEC 3AE9C 1ZOYC 1YQ4D 3AE2D 3AEBC 2WDQC 3AEAC 2FBWD 1QLBC 3AE8D 3AEDC
chains in the Genus database with same CATH superfamily
1KFYD 1YQ4C 3AE2C 3VONA 1YQ3D 3SFDC 4LDTA 2ACZC 2FBWC 4YTPD 2ZFYA 1KFYC 3AE1D 1YQ3C 2H88D 4YSZD 3CIRD 3AE9D 1ZOYD 3AEBD 3VR8C 2H88C 3CIRC 2BS4C 4YTND 3P4SD 3SFDD 3AEED 3AE6D 2ACZD 1ZP0D 3AE5C 4YTNC 3P4SC 2H89D 2B76C 3ABVD 2BS3C 1NEKD 3AE6C 3AEEC 3AEFC 1ZP0C 3AE7D 4FJVA 2H89C 4DDIA 3VR8D 3ABVC 3AEGD 1NEKC 1NENC 3AE7C 2BS2C 3AECC 3AEGC 3P4PD 2WU5C 3AE5D 2B76D 3AE4C 2WS3C 3AEFD 4DHJA 3P4PC 2WDRD 3VRBD 4DHIB 3P4QD 3P4RC 1NEND 5C2TC 2WQYD 2WDRC 4DDGA 3VR9D 3VRBC 3AECD 2WDVC 4DHZA 1L0VD 2WU5D 3P4QC 2WP9D 4YT0C 4YSYD 5C3JC 4YSXD 2WQYC 3AE4D 2WS3D 4YXDD 3VR9C 1KF6C 1E7PC 1L0VC 2WU2D 2WP9C 4KX6D 4YSYC 4YSXC 4YXDC 3P4RD 2WU2C 3AE8C 5C2TD 4KX6C 3AE3D 4YTMD 3VRAD 2WDVD 3SFED 4YTPC 4I6LA 4YT0D 5C3JD 1TFFA 3AE3C 2WDQD 1KF6D 3AE1C 3AEAD 3VRAC 4YTMC 4YSZC 3AEDD 3SFEC 3AE9C 1ZOYC 1YQ4D 3AE2D 3AEBC 2WDQC 3AEAC 2FBWD 1QLBC 3AE8D 3AEDC
chains in the Genus database with same CATH topology
1KFYD 1YQ4C 3AE2C 1YQ3D 3SFDC 2ACZC 2FBWC 4YTPD 1KFYC 3AE1D 1YQ3C 2H88D 4YSZD 3CIRD 3AE9D 1ZOYD 3AEBD 3VR8C 2H88C 3CIRC 2BS4C 4YTND 3P4SD 3SFDD 3AEED 3AE6D 2ACZD 1ZP0D 3AE5C 4YTNC 3P4SC 2H89D 2B76C 3ABVD 2BS3C 1NEKD 3AE6C 3AEEC 3AEFC 1ZP0C 3AE7D 2H89C 3VR8D 3ABVC 3AEGD 1NEKC 1NENC 3AE7C 2BS2C 3AECC 3AEGC 3P4PD 2WU5C 3AE5D 2B76D 3AE4C 2WS3C 3AEFD 3P4PC 2WDRD 3VRBD 3P4QD 3P4RC 1NEND 5C2TC 2WQYD 2WDRC 3VR9D 3VRBC 3AECD 2WDVC 1L0VD 2WU5D 3P4QC 2WP9D 4YT0C 4YSYD 5C3JC 4YSXD 2WQYC 3AE4D 2WS3D 4YXDD 3VR9C 1KF6C 1E7PC 1L0VC 2WU2D 2WP9C 4KX6D 4YSYC 4YSXC 4YXDC 3P4RD 2WU2C 3AE8C 5C2TD 4KX6C 3AE3D 4YTMD 3VRAD 2WDVD 3SFED 4YTPC 4YT0D 5C3JD 2WDQD 3AE3C 1KF6D 3AE1C 3AEAD 3VRAC 4YTMC 4YSZC 3AEDD 3SFEC 3AE9C 1ZOYC 1YQ4D 3AE2D 3AEBC 2WDQC 3AEAC 2FBWD 1QLBC 3AE8D 3AEDC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KFY D;  1YQ4 C;  3AE2 C;  1YQ3 D;  3SFD C;  2ACZ C;  2FBW C;  4YTP D;  1KFY C;  3AE1 D;  1YQ3 C;  2H88 D;  4YSZ D;  3CIR D;  3AE9 D;  1ZOY D;  3AEB D;  3VR8 C;  2H88 C;  3CIR C;  2BS4 C;  4YTN D;  3P4S D;  3SFD D;  3AEE D;  3AE6 D;  2ACZ D;  1ZP0 D;  3AE5 C;  4YTN C;  3P4S C;  2H89 D;  2B76 C;  3ABV D;  2BS3 C;  1NEK D;  3AE6 C;  3AEE C;  3AEF C;  1ZP0 C;  3AE7 D;  2H89 C;  3VR8 D;  3ABV C;  3AEG D;  1NEK C;  1NEN C;  3AE7 C;  2BS2 C;  3AEC C;  3AEG C;  3P4P D;  2WU5 C;  3AE5 D;  2B76 D;  3AE4 C;  2WS3 C;  3AEF D;  3P4P C;  2WDR D;  3VRB D;  3P4Q D;  3P4R C;  1NEN D;  5C2T C;  2WQY D;  2WDR C;  3VR9 D;  3VRB C;  3AEC D;  2WDV C;  1L0V D;  2WU5 D;  3P4Q C;  2WP9 D;  4YT0 C;  4YSY D;  5C3J C;  4YSX D;  2WQY C;  3AE4 D;  2WS3 D;  4YXD D;  3VR9 C;  1KF6 C;  1E7P C;  1L0V C;  2WU2 D;  2WP9 C;  4KX6 D;  4YSY C;  4YSX C;  4YXD C;  3P4R D;  2WU2 C;  3AE8 C;  5C2T D;  4KX6 C;  3AE3 D;  4YTM D;  3VRA D;  2WDV D;  3SFE D;  4YTP C;  4YT0 D;  5C3J D;  2WDQ D;  3AE3 C;  1KF6 D;  3AE1 C;  3AEA D;  3VRA C;  4YTM C;  4YSZ C;  3AED D;  3SFE C;  3AE9 C;  1ZOY C;  1YQ4 D;  3AE2 D;  3AEB C;  2WDQ C;  3AEA C;  2FBW D;  1QLB C;  3AE8 D;  3AED C; 
#chains in the Genus database with same CATH topology
 1KFY D;  1YQ4 C;  3AE2 C;  3VON A;  1YQ3 D;  3SFD C;  4LDT A;  2ACZ C;  2FBW C;  4YTP D;  2ZFY A;  1KFY C;  3AE1 D;  1YQ3 C;  2H88 D;  4YSZ D;  3CIR D;  3AE9 D;  1ZOY D;  3AEB D;  3VR8 C;  2H88 C;  3CIR C;  2BS4 C;  4YTN D;  3P4S D;  3SFD D;  3AEE D;  3AE6 D;  2ACZ D;  1ZP0 D;  3AE5 C;  4YTN C;  3P4S C;  2H89 D;  2B76 C;  3ABV D;  2BS3 C;  1NEK D;  3AE6 C;  3AEE C;  3AEF C;  1ZP0 C;  3AE7 D;  4FJV A;  2H89 C;  4DDI A;  3VR8 D;  3ABV C;  3AEG D;  1NEK C;  1NEN C;  3AE7 C;  2BS2 C;  3AEC C;  3AEG C;  3P4P D;  2WU5 C;  3AE5 D;  2B76 D;  3AE4 C;  2WS3 C;  3AEF D;  4DHJ A;  3P4P C;  2WDR D;  3VRB D;  4DHI B;  3P4Q D;  3P4R C;  1NEN D;  5C2T C;  2WQY D;  2WDR C;  4DDG A;  3VR9 D;  3VRB C;  3AEC D;  2WDV C;  4DHZ A;  1L0V D;  2WU5 D;  3P4Q C;  2WP9 D;  4YT0 C;  4YSY D;  5C3J C;  4YSX D;  2WQY C;  3AE4 D;  2WS3 D;  4YXD D;  3VR9 C;  1KF6 C;  1E7P C;  1L0V C;  2WU2 D;  2WP9 C;  4KX6 D;  4YSY C;  4YSX C;  4YXD C;  3P4R D;  2WU2 C;  3AE8 C;  5C2T D;  4KX6 C;  3AE3 D;  4YTM D;  3VRA D;  2WDV D;  3SFE D;  4YTP C;  4I6L A;  4YT0 D;  5C3J D;  1TFF A;  3AE3 C;  2WDQ D;  1KF6 D;  3AE1 C;  3AEA D;  3VRA C;  4YTM C;  4YSZ C;  3AED D;  3SFE C;  3AE9 C;  1ZOY C;  1YQ4 D;  3AE2 D;  3AEB C;  2WDQ C;  3AEA C;  2FBW D;  1QLB C;  3AE8 D;  3AED C; 
#chains in the Genus database with same CATH homology
 1KFY D;  1YQ4 C;  3AE2 C;  1YQ3 D;  3SFD C;  2ACZ C;  2FBW C;  4YTP D;  1KFY C;  3AE1 D;  1YQ3 C;  2H88 D;  4YSZ D;  3CIR D;  3AE9 D;  1ZOY D;  3AEB D;  3VR8 C;  2H88 C;  3CIR C;  2BS4 C;  4YTN D;  3P4S D;  3SFD D;  3AEE D;  3AE6 D;  2ACZ D;  1ZP0 D;  3AE5 C;  4YTN C;  3P4S C;  2H89 D;  2B76 C;  3ABV D;  2BS3 C;  1NEK D;  3AE6 C;  3AEE C;  3AEF C;  1ZP0 C;  3AE7 D;  2H89 C;  3VR8 D;  3ABV C;  3AEG D;  1NEK C;  1NEN C;  3AE7 C;  2BS2 C;  3AEC C;  3AEG C;  3P4P D;  2WU5 C;  3AE5 D;  2B76 D;  3AE4 C;  2WS3 C;  3AEF D;  3P4P C;  2WDR D;  3VRB D;  3P4Q D;  3P4R C;  1NEN D;  5C2T C;  2WQY D;  2WDR C;  3VR9 D;  3VRB C;  3AEC D;  2WDV C;  1L0V D;  2WU5 D;  3P4Q C;  2WP9 D;  4YT0 C;  4YSY D;  5C3J C;  4YSX D;  2WQY C;  3AE4 D;  2WS3 D;  4YXD D;  3VR9 C;  1KF6 C;  1E7P C;  1L0V C;  2WU2 D;  2WP9 C;  4KX6 D;  4YSY C;  4YSX C;  4YXD C;  3P4R D;  2WU2 C;  3AE8 C;  5C2T D;  4KX6 C;  3AE3 D;  4YTM D;  3VRA D;  2WDV D;  3SFE D;  4YTP C;  4YT0 D;  5C3J D;  2WDQ D;  3AE3 C;  1KF6 D;  3AE1 C;  3AEA D;  3VRA C;  4YTM C;  4YSZ C;  3AED D;  3SFE C;  3AE9 C;  1ZOY C;  1YQ4 D;  3AE2 D;  3AEB C;  2WDQ C;  3AEA C;  2FBW D;  1QLB C;  3AE8 D;  3AED C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...