3AEDD

Crystal structure of porcine heart mitochondrial complex ii bound with 2-iodo-n-phenyl-benzamide
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
102
structure length
102
Chain Sequence
b'SSKAASLHWTGERVVSVLLLGLLPAAYLNPCSAMDYSLAAALTLHGHWGIGQVVTDYVRGDALQKAAKAGLLALSAFTFAGLCYFNYHDVGICKAVAMLWKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with 2-Iodo-N-phenyl-benzamide
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 38
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2010-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3aedD00
3AE4D 1E7PC 3AE7C 4YTND 3AE1D 2WDRD 4YT0D 3AE2D 1ZP0C 4YXDD 3CIRD 1NEKD 3ABVD 3AECC 1L0VD 4KX6C 3SFDD 3AE7D 2H89C 4YTPD 4YTMC 3AEBD 5C3JD 1YQ3D 2WU2D 2FBWC 3P4QD 3AE8C 4KX6D 2ACZC 1NEND 4YSYD 3AE4C 4YTNC 2BS4C 3AE1C 4YT0C 3AE2C 4YXDC 1YQ4D 1NEKC 3ABVC 1L0VC 3SFDC 4YTPC 3AEBC 4YSXD 5C3JC 1YQ3C 2WU2C 3AE6D 2WDVD 3P4QC 3AE3D 2WP9D 1ZOYD 1QLBC 1NENC 3AE5D 3SFED 4YSYC 3P4RD 2BS3C 3P4PD 1KFYC 1YQ4C 2B76D 2BS2C 3VRBD 4YSXC 3AEGD 1KFYD 1KF6D 2WDVC 3AE6C 5C2TD 3AE3C 3AE9D 2WP9C 1ZOYC 3AE5C 3SFEC 2WS3D 3P4RC 2WU5D 3VR9D 3P4SD 3P4PC 3VRAD 3AEED 2B76C 3VRBC 2WDQD 3AEGC 3AEAD 3AEFD 4YSZD 1KF6C 5C2TC 2H88D 3VR8D 3AE9C 2WS3C 2WU5C 3VR9C 3P4SC 3VRAC 2WQYD 3AEDD 3AEEC 1ZP0D 2WDQC 3AEAC 3AEFC 4YSZC 3AECD 2H88C 3VR8C 2H89D 4YTMD 2WDRC 2FBWD 3AE8D 3CIRC 2WQYC 2ACZD 3AEDC
chains in the Genus database with same CATH superfamily
3AE4D 1E7PC 3AE7C 4YTND 3AE1D 2WDRD 4YT0D 3AE2D 1ZP0C 4YXDD 3CIRD 1NEKD 3ABVD 3AECC 1L0VD 4KX6C 3SFDD 3AE7D 2H89C 4YTPD 4YTMC 3AEBD 5C3JD 1YQ3D 4DDIA 4DHJA 2WU2D 2FBWC 3P4QD 3AE8C 4KX6D 2ACZC 1NEND 4YSYD 3AE4C 4YTNC 2BS4C 3AE1C 4YT0C 3AE2C 4YXDC 1YQ4D 1NEKC 3ABVC 1L0VC 3SFDC 4YTPC 3AEBC 4YSXD 5C3JC 1YQ3C 2WU2C 3AE6D 2WDVD 3P4QC 3AE3D 2WP9D 1ZOYD 1QLBC 1NENC 3AE5D 3SFED 4YSYC 3P4RD 2BS3C 3P4PD 1KFYC 1YQ4C 4DHIB 2B76D 2BS2C 3VRBD 4YSXC 1TFFA 3AEGD 1KFYD 1KF6D 2WDVC 3AE6C 5C2TD 3AE3C 3AE9D 2WP9C 1ZOYC 3AE5C 3SFEC 2WS3D 3P4RC 2WU5D 3VR9D 3P4SD 3P4PC 3VRAD 3AEED 2B76C 3VRBC 2WDQD 3AEGC 3AEAD 4I6LA 3AEFD 4YSZD 1KF6C 5C2TC 2H88D 3VR8D 3AE9C 4DDGA 3VONA 2WS3C 2WU5C 3VR9C 3P4SC 3VRAC 2WQYD 3AEDD 3AEEC 1ZP0D 2WDQC 3AEAC 4LDTA 3AEFC 4YSZC 3AECD 2H88C 3VR8C 2H89D 4FJVA 4YTMD 4DHZA 2WDRC 2FBWD 3AE8D 3CIRC 2WQYC 2ACZD 3AEDC 2ZFYA
chains in the Genus database with same CATH topology
3AE4D 1E7PC 3AE7C 4YTND 3AE1D 2WDRD 4YT0D 3AE2D 1ZP0C 4YXDD 3CIRD 1NEKD 3ABVD 3AECC 1L0VD 4KX6C 3SFDD 3AE7D 2H89C 4YTPD 4YTMC 3AEBD 5C3JD 1YQ3D 2WU2D 2FBWC 3P4QD 3AE8C 4KX6D 2ACZC 1NEND 4YSYD 3AE4C 4YTNC 2BS4C 3AE1C 4YT0C 3AE2C 4YXDC 1YQ4D 1NEKC 3ABVC 1L0VC 3SFDC 4YTPC 3AEBC 4YSXD 5C3JC 1YQ3C 2WU2C 3AE6D 2WDVD 3P4QC 3AE3D 2WP9D 1ZOYD 1QLBC 1NENC 3AE5D 3SFED 4YSYC 3P4RD 2BS3C 3P4PD 1KFYC 1YQ4C 2B76D 2BS2C 3VRBD 4YSXC 3AEGD 1KFYD 1KF6D 2WDVC 3AE6C 5C2TD 3AE3C 3AE9D 2WP9C 1ZOYC 3AE5C 3SFEC 2WS3D 3P4RC 2WU5D 3VR9D 3P4SD 3P4PC 3VRAD 3AEED 2B76C 3VRBC 2WDQD 3AEGC 3AEAD 3AEFD 4YSZD 1KF6C 5C2TC 2H88D 3VR8D 3AE9C 2WS3C 2WU5C 3VR9C 3P4SC 3VRAC 2WQYD 3AEDD 3AEEC 1ZP0D 2WDQC 3AEAC 3AEFC 4YSZC 3AECD 2H88C 3VR8C 2H89D 4YTMD 2WDRC 2FBWD 3AE8D 3CIRC 2WQYC 2ACZD 3AEDC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AE4 D;  1E7P C;  3AE7 C;  4YTN D;  3AE1 D;  2WDR D;  4YT0 D;  3AE2 D;  1ZP0 C;  4YXD D;  3CIR D;  1NEK D;  3ABV D;  3AEC C;  1L0V D;  4KX6 C;  3SFD D;  3AE7 D;  2H89 C;  4YTP D;  4YTM C;  3AEB D;  5C3J D;  1YQ3 D;  2WU2 D;  2FBW C;  3P4Q D;  3AE8 C;  4KX6 D;  2ACZ C;  1NEN D;  4YSY D;  3AE4 C;  4YTN C;  2BS4 C;  3AE1 C;  4YT0 C;  3AE2 C;  4YXD C;  1YQ4 D;  1NEK C;  3ABV C;  1L0V C;  3SFD C;  4YTP C;  3AEB C;  4YSX D;  5C3J C;  1YQ3 C;  2WU2 C;  3AE6 D;  2WDV D;  3P4Q C;  3AE3 D;  2WP9 D;  1ZOY D;  1QLB C;  1NEN C;  3AE5 D;  3SFE D;  4YSY C;  3P4R D;  2BS3 C;  3P4P D;  1KFY C;  1YQ4 C;  2B76 D;  2BS2 C;  3VRB D;  4YSX C;  3AEG D;  1KFY D;  1KF6 D;  2WDV C;  3AE6 C;  5C2T D;  3AE3 C;  3AE9 D;  2WP9 C;  1ZOY C;  3AE5 C;  3SFE C;  2WS3 D;  3P4R C;  2WU5 D;  3VR9 D;  3P4S D;  3P4P C;  3VRA D;  3AEE D;  2B76 C;  3VRB C;  2WDQ D;  3AEG C;  3AEA D;  3AEF D;  4YSZ D;  1KF6 C;  5C2T C;  2H88 D;  3VR8 D;  3AE9 C;  2WS3 C;  2WU5 C;  3VR9 C;  3P4S C;  3VRA C;  2WQY D;  3AED D;  3AEE C;  1ZP0 D;  2WDQ C;  3AEA C;  3AEF C;  4YSZ C;  3AEC D;  2H88 C;  3VR8 C;  2H89 D;  4YTM D;  2WDR C;  2FBW D;  3AE8 D;  3CIR C;  2WQY C;  2ACZ D;  3AED C; 
#chains in the Genus database with same CATH topology
 3AE4 D;  1E7P C;  3AE7 C;  4YTN D;  3AE1 D;  2WDR D;  4YT0 D;  3AE2 D;  1ZP0 C;  4YXD D;  3CIR D;  1NEK D;  3ABV D;  3AEC C;  1L0V D;  4KX6 C;  3SFD D;  3AE7 D;  2H89 C;  4YTP D;  4YTM C;  3AEB D;  5C3J D;  1YQ3 D;  4DDI A;  4DHJ A;  2WU2 D;  2FBW C;  3P4Q D;  3AE8 C;  4KX6 D;  2ACZ C;  1NEN D;  4YSY D;  3AE4 C;  4YTN C;  2BS4 C;  3AE1 C;  4YT0 C;  3AE2 C;  4YXD C;  1YQ4 D;  1NEK C;  3ABV C;  1L0V C;  3SFD C;  4YTP C;  3AEB C;  4YSX D;  5C3J C;  1YQ3 C;  2WU2 C;  3AE6 D;  2WDV D;  3P4Q C;  3AE3 D;  2WP9 D;  1ZOY D;  1QLB C;  1NEN C;  3AE5 D;  3SFE D;  4YSY C;  3P4R D;  2BS3 C;  3P4P D;  1KFY C;  1YQ4 C;  4DHI B;  2B76 D;  2BS2 C;  3VRB D;  4YSX C;  1TFF A;  3AEG D;  1KFY D;  1KF6 D;  2WDV C;  3AE6 C;  5C2T D;  3AE3 C;  3AE9 D;  2WP9 C;  1ZOY C;  3AE5 C;  3SFE C;  2WS3 D;  3P4R C;  2WU5 D;  3VR9 D;  3P4S D;  3P4P C;  3VRA D;  3AEE D;  2B76 C;  3VRB C;  2WDQ D;  3AEG C;  3AEA D;  4I6L A;  3AEF D;  4YSZ D;  1KF6 C;  5C2T C;  2H88 D;  3VR8 D;  3AE9 C;  4DDG A;  3VON A;  2WS3 C;  2WU5 C;  3VR9 C;  3P4S C;  3VRA C;  2WQY D;  3AED D;  3AEE C;  1ZP0 D;  2WDQ C;  3AEA C;  4LDT A;  3AEF C;  4YSZ C;  3AEC D;  2H88 C;  3VR8 C;  2H89 D;  4FJV A;  4YTM D;  4DHZ A;  2WDR C;  2FBW D;  3AE8 D;  3CIR C;  2WQY C;  2ACZ D;  3AED C;  2ZFY A; 
#chains in the Genus database with same CATH homology
 3AE4 D;  1E7P C;  3AE7 C;  4YTN D;  3AE1 D;  2WDR D;  4YT0 D;  3AE2 D;  1ZP0 C;  4YXD D;  3CIR D;  1NEK D;  3ABV D;  3AEC C;  1L0V D;  4KX6 C;  3SFD D;  3AE7 D;  2H89 C;  4YTP D;  4YTM C;  3AEB D;  5C3J D;  1YQ3 D;  2WU2 D;  2FBW C;  3P4Q D;  3AE8 C;  4KX6 D;  2ACZ C;  1NEN D;  4YSY D;  3AE4 C;  4YTN C;  2BS4 C;  3AE1 C;  4YT0 C;  3AE2 C;  4YXD C;  1YQ4 D;  1NEK C;  3ABV C;  1L0V C;  3SFD C;  4YTP C;  3AEB C;  4YSX D;  5C3J C;  1YQ3 C;  2WU2 C;  3AE6 D;  2WDV D;  3P4Q C;  3AE3 D;  2WP9 D;  1ZOY D;  1QLB C;  1NEN C;  3AE5 D;  3SFE D;  4YSY C;  3P4R D;  2BS3 C;  3P4P D;  1KFY C;  1YQ4 C;  2B76 D;  2BS2 C;  3VRB D;  4YSX C;  3AEG D;  1KFY D;  1KF6 D;  2WDV C;  3AE6 C;  5C2T D;  3AE3 C;  3AE9 D;  2WP9 C;  1ZOY C;  3AE5 C;  3SFE C;  2WS3 D;  3P4R C;  2WU5 D;  3VR9 D;  3P4S D;  3P4P C;  3VRA D;  3AEE D;  2B76 C;  3VRB C;  2WDQ D;  3AEG C;  3AEA D;  3AEF D;  4YSZ D;  1KF6 C;  5C2T C;  2H88 D;  3VR8 D;  3AE9 C;  2WS3 C;  2WU5 C;  3VR9 C;  3P4S C;  3VRA C;  2WQY D;  3AED D;  3AEE C;  1ZP0 D;  2WDQ C;  3AEA C;  3AEF C;  4YSZ C;  3AEC D;  2H88 C;  3VR8 C;  2H89 D;  4YTM D;  2WDR C;  2FBW D;  3AE8 D;  3CIR C;  2WQY C;  2ACZ D;  3AED C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...