3SFEC

Crystal structure of porcine mitochondrial respiratory complex ii bound with oxaloacetate and thiabendazole
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
139
structure length
139
Chain Sequence
GTTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Thiabendazole inhibits ubiquinone reduction activity of mitochondrial respiratory complex II via a water molecule mediated binding feature.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 47
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2011-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3sfeC01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3sfeC02
3AE6D 3VRBD 2WQYD 3CIRC 2WU5D 2BS4C 1KF6D 1NEKC 1PV3A 1ZP0D 2WS3D 3AE7D 1K04A 3S9OA 1KFYD 3ABVC 3AEGC 1YQ3D 5C3JC 3P4QC 3AE5D 2H88D 4YXDD 2H89C 1L0VD 2G3AA 3P4RC 1NENC 1YQ4D 3AEDD 3CIRD 3AE3D 1NEKD 4YSYC 4YSXC 3AE2C 3P4SC 3P4PC 3AEBD 3B71A 2WP9D 2ACZC 2WDVC 1QLBC 4YSZD 2H89D 3AE8D 1ZOYC 3AEEC 4YTNC 3P4RD 2WDQC 3AECD 1NEND 2B76D 1KTMA 2WDRC 4YTMC 3SFDC 4YSYD 3VR9C 4YSXD 4KX6C 1OW6A 3P4PD 3P4SD 3VR8C 1OW7A 2ACZD 2WDVD 3VRAC 3AE6C 1ZOYD 2BS2C 3VRBC 3AEAC 3ABVD 3AEGD 2WDQD 1OW8A 5C3JD 3P4QD 4YTMD 2BS3C 3SFDD 2WS3C 3AE1C 4KX6D 1KFYC 3SFEC 2FBWC 3VR8D 2H88C 4YXDC 4YTPC 3AE9C 1K05A 3AE2D 3VRAD 3AEFC 4YT0C 3AEAD 1YQ4C 3AEDC 2WU2C 3AE3C 3AE4C 5C2TC 4YTND 3AEED 2WQYC 1E7PC 3AE1D 2WU5C 3SFED 3AEBC 1KF6C 2WP9C 2WDRD 1ZP0C 5C2TD 2FBWD 4YTPD 4YSZC 3AE9D 3VR9D 3AE7C 3AE8C 1YQ3C 3AECC 3AEFD 4YT0D 2B76C 3AE5C 2WU2D 3AE4D 1L0VC
chains in the Genus database with same CATH superfamily
1X0TA 4WWIA 3CIRC 1AV1A 4WB4A 3TNUB 3RGUA 3VN0A 1JY2O 1NU1J 5CJ4A 5CBNA 3CLQA 3PP5A 4JYBA 1PL5A 2WSCJ 2G3AA 1SQXG 3H1HJ 1EZVE 4BRYA 1URQC 1L4AC 1KB9E 3OA7A 3HTKB 4W7ZA 3H32A 2D2CB 4AQRD 1L0LK 2ZFCA 4YTNC 2Y0CA 3GG2A 1KQGB 1FDIA 4YSYD 1AJYA 1NTME 4KX6C 2ITAA 1NO4A 2H8PD 4N78E 3RBZA 4AUWA 2XNDH 3L75E 4PJ0H 2FYUJ 4H0LD 5CCGD 2XU6A 2E76C 2K37A 1LTTC 2KLUA 3CL3D 3P32A 1RF1C 1NTMD 3NFQA 4A7PA 4N78D 1A02J 2WSFJ 3L75D 2OYOA 3RK2C 1NTZK 1U7JA 3VRAD 3HTKA 5CMZA 4EIJA 3H1KD 3D6YA 2FFDB 3KXDA 2WDRD 3KZIE 1FS0E 2WITA 3TDKA 1EQ7A 3AECC 2Q3EA 4OH8B 1X79B 1NHLA 1HVVA 1OFCX 1MFTA 4OGQD 1N73C 3A3YB 2KUBA 3L70E 1UIIA 3SWKA 4K3AA 3OW2O 4YSXC 2A06E 1VPCA 2AEMA 5APWA 1JY2P 2BASA 1H88A 4D6TJ 1FZCC 3L70D 3S1KA 3T97B 2FFDA 3HUSB 2ZFYA 4KT0J 1QLBC 3RL0C 3H1LD 2OYIC 3EQ2A 1Y47A 1OWAA 1ZV8A 2QE7H 1Q81Q 2BEZF 5APTA 5KLVD 3KHUA 3A0BH 1OVVA 3L4FA 3B5ND 3P4QD 1FZGA 2AEJA 3H1JE 5AVRB 1KFYC 1QEXA 1BE3G 4PD4H 4M3LA 5CCGA 3RK3C 2QSIA 3AEAD 3AEDC 1BDCA 2PP6A 5C2TC 3T97A 1BSNA 2BCCE 1ZP0C 1BGYG 4JPZB 3VR9D 4RO0A 4DCKA 1S72P 1SQPJ 2CPSA 3A5TA 1KZUB 1NTKK 3M9BA 4ZKPA 1LTJB 2ZJSE 1J1EB 2YNYA 2QIWA 3AE6D 1SQXE 1PV3A 2M3BA 3S9OA 4JF7A 1S5LE 2MKVA 2B9BA 2W6BA 4WY4D 2ZXXA 1D7MA 4DHJA 2FYNB 1Q2NA 5AVTB 2QJKB 4XFJA 5AW2B 2WPSA 5KAIE 1NU1D 5KKZB 2KB7P 5KJ7C 1PIXA 1CI6B 1RQVA 1ZXGA 2H89D 1ZOYC 1RF0A 3H1HD 3TYYA 2YO3A 3JCUH 1VQ8P 2FXMA 2OGUA 2NPSC 1LTJA 3OJAB 1YYCA 3G71P 3P4PD 1K73Q 2XKMA 3L74G 1LTIC 2OTLP 1K9MQ 1H8AA 1SQXK 2FYUE 2KSJA 3EFFK 2WDQD 1KILE 2YMKA 1FOSF 2WPRA 3P8CE 1URQD 2NRGA 3L73J 1ZRTE 2FYUD 2PRRA 1KILD 1X22A 3M06A 2QVAA 4YTND 3AEBC 3CCVP 1ZRTD 2FBWD 4C46A 1PP9J 2N1TB 4PV1C 2M0BA 1KQFB 1Q90D 2JKVA 1NVOA 2E76D 2BS4C 1N7SD 2HFED 2WSEH 1L0LJ 5CBOA 5C3JC 2A45I 1AFOA 3V2NA 5L8RJ 4RKUJ 2KP8A 1LJ2A 1PPJE 1KFNA 2E74D 4LDTA 1FZBA 3PJSK 3Q3DA 4AYCA 4ZMDA 4YSYC 4WY4A 3A0HH 3HE4A 1AA0A 1JY3O 4D6TE 1URQB 1ZW0A 4IL6X 4GOFA 1L4AB 2QA4P 1YJ9P 1PPJD 2N1TA 4RESB 3MD0A 3P4RD 4H0LC 3AECD 2B88A 1NTZJ 4D6TD 3CXHI 2YIUC 1TU3F 2QJPC 3VRAC 1BE3E 2W90A 3VRBC 4BWNA 2Q7CA 1M57D 1VQ7P 4IL6H 4NPEA 3CX5I 2A45G 1NGMB 2E76B 1VL2A 2R5DA 1SQVJ 1FZFA 1JTHB 1X8YA 2OYHB 1YQ4C 1BGYE 3RK2B 3GF7A 1URQA 2POHA 2ZXEB 1L4AA 4ASVA 3RL0D 3FX0A 1SQVG 1KILA 2WP9C 2FY8A 3SWYA 2KK7A 3Q5SA 4OGQC 1KD1Q 2B76C 3PHLA 2WU2D 4TT3H 2AXTE 1WMKA 2RN0A 1K04A 1KFYD 3ABVC 1SQPD 3AEGC 1N8RQ 3GF3A 1R8EA 1N7SA 1HGZA 2KI7B 1JTHA 1RF1A 1YI2P 1N73B 1PZQA 3AEDD 3Q5PA 1VDFA 1VQKP 3WU2E 1JNMA 2K3RA 1JMMA 3V6IA 5EFWB 3MZWB 1MUUA 3CI9A 2XDJA 3LIDA 4I6LA 1KFMA 2KZIA 5BVZA 2KZJA 3B5NC 3L72J 3VONA 1IK9A 3WUTA 3QH9A 3RL0B 1K8AQ 2OYIB 2QG4A 3KZIH 1JY3P 1OW7A 2R3CA 5B66E 3AEAC 1HBWA 1OVUA 2HG5D 1BDDA 1W2EA 1S1CX 2G8YA 2BS3C 3KQGA 3LW5J 1N86A 2WS3C 2Q3IA 3HRNA 5DJUB 1GZLA 4GIFA 5TISH 1NTKJ 4Y99B 1QL1A 2HLOA 1SFCB 5KJ7D 1LNQA 1USDA 3IAOA 2E5YA 2VRSA 3RK3B 4DDIA 2O1JA 2W6AA 3IFMA 4I6MC 5CCHC 3L73D 3H1JJ 2NPSD 1OMIA 1FZCA 4YSZC 4L74A 1PP9E 5AVWB 4KJMA 4YT0D 2QEXP 2OYIA 4WY4C 3CCSP 4EI2A 3H1IJ 4JYCA 1EDKA 4YPCA 3H6PA 3B8EB 1KF6D 2BCCJ 1PP9D 1GU4A 4NPDA 2R44A 3AE7D 2WVRA 3MP7B 1L0LE 1SVFA 3H1IG 2H89C 1L0VD 2KS1B 3NXSA 3E1IA 3A7OA 3BCCJ 3P4PC 2L91A 1L0LD 2I8DA 3AEBD 1SQXJ 1YBKA 1LTAC 3HE5B 3D6ZA 4PV1D 1YJWP 2WDQC 2ZT9D 2WWWA 3BCCG 3MUDA 1DD4A 1NTZE 4W80A 1KQLA 1JY2N 1YIJP 3L71G 3I55P 1KILC 3GHGC 1E79H 1KYOI 4WBAA 5C3JD 1BSHA 1EZVD 4UB8E 1NTZD 2C9LY 3V5BA 1KB9D 2FBWC 2KS1A 1VQOP 1SQVE 5AW0B 3VMZA 2KNCA 3D70A 2WSCH 3HE5A 3FWLA 5KJ7A 1N7SC 2WPVB 1SQVD 4YTPD 3AE8C 3CXHE 1CSBA 2YKQA 3E7KA 3M0DA 3IR9A 1BCCG 1LWUC 2NPSA 5APVA 4I7ZC 2E74C 3VRBD 2R32A 5AVSB 2Y0DA 4UB6E 1FBMA 3CX5E 1G2CB 2JWDA 1OX3A 3FGAD 3P4RC 1AVYA 1T3UA 3CCJP 1YQ4D 1SQVK 5GTHE 1FDOA 3CX5D 3UIAA 1NYHA 3VMYA 2KSEA 2WP9D 1A02F 1LT1A 1IFJA 5APSA 4PD4I 2KXPB 2B76D 1LT9C 3L72E 3TF5A 1YITP 1JOCA 3W67A 4CPGA 4H0LB 3U1AA 1KORA 3CCRP 3M9QA 1AQ5A 2C9NY 1AVOA 2Y9ZA 3ABVD 3AEGD 3L72D 1G2CA 2YIUB 4HKZH 3SFDD 2QJPB 2YKOA 2A06D 2H88C 1NTKE 4K35A 1JM0A 2WU2C 1BE3J 3C1LA 4B86A 1NOHA 1ZLLA 1SQQG 1NTKD 1IO4A 1RE3A 1S3JA 5KLIC 4DOJA 3HD7C 3B4SA 4Y28J 2O1KA 2FXOA 1BGYJ 1CZQA 4OGQB 2AXCA 4H44D 3H1IE 1LTBC 1ZMEC 3H1JD 2LR2A 2WS3D 2ZYGA 3MUDC 4GKGA 1WRGA 3H1ID 3Q5RA 2BCCD 2Q5UA 4MN4C 3BCCE 5CCHD 1DIPA 2YKPA 3P8MC 4YSZD 2K1AA 2O01H 4EYYQ 4EDFA 2LKMA 3BCCD 1IFMA 4O9BA 1GK4A 1T2KD 1IFNA 3P4SD 2IZ0A 1TFFA 1MKMA 1SQXD 3B5NB 2HPCB 4QMAA 2P10A 3MIWA 1KQSO 3TGUJ 1DEEG 2AXTH 5AW7B 3L74J 4BXLA 3M0DC 2Z4EA 1JEKA 4I2LC 3G4SP 1K05A 3TGUG 4YT0C 1GW3A 1OIPA 1YHQP 5GTIE 1FAVA 2JO1A 2HR3A 2Y0EA 2E42A 3AE1D 2W8ZA 2Y9YA 1KF6C 1BCCE 2WPQA 1DH3A 3AE7C 1NJIQ 2OQQA 1LTSC 1M7LA 1PGPA 1S9KE 2YMYA 3B5NA 2HPCA 1L0VC 2J5UA 1KYOE 3N4XA 3CWBG 2B89A 4WY4B 4GT1A 2JEEA 3HE4B 1X9VA 1VF5D 2IDBA 4DHIB 3P8CD 3VYIA 3Q2YA 1S9KD 1YQ3D 2J58A 1EXJA 3AE5D 1KYOD 5B66H 2OTKE 2ZT9C 2ZVOB 2WSEJ 1R5LA 2C0XA 2N9YB 5AW9B 1KMIZ 5B5EH 2QRXA 3SSUA 4YXWH 4IOIH 1JCCA 3AE8D 3AEEC 2M5AB 1W5CE 2RMZA 3IF4A 5CCHA 2M8RA 1FZEA 3O6QA 5KAFH 4GDOA 4H13C 3VMXA 3K5BA 1P84I 3NTNA 3V2QA 3OAKA 2ACZD 2K88A 2SPZA 1HH0A 1U57A 1GL2D 2IYPA 2IZ1A 1RE3C 3PTZA 2H43A 1KILB 3A0BE 2WT7B 2WSSH 4YTPC 1JY3N 1PGJA 4Z1MH 4PD4E 1IZNB 1QL2A 3SFED 2N9BA 3CCEP 4XE5B 4C7NA 2P2UA 2M5AA 5AVXB 3AE9D 3F5HA 2QM8A 2JWAA 1N7SB 1BE3D 1RF1B 4PD4D 1RY3A 1NH4A 3TSIA 1Y9BA 5APUA 1VQ6P 1YJNP 1GU5A 5K5GB 3VTPC 1Q7YQ 1ZR2A 2BEQD 1LWUB 2DW3A 4I7ZB 2E74B 2JDIH 5APQA 1KB9H 3GHGA 2HYNA 2WT7A 2H88D 1N7LA 3VP8A 3W68A 2E75C 3N7NA 1BGYD 2XNXA 2ZVNB 1W2BO 1SQQK 4UB8H 2ZYAA 2LXCB 1MFZA 3BRTB 1NTMG 2QJYC 1FDMA 4DZOA 3L75G 1KV4A 1QLED 4HB1A 1SP4A 2IFMA 3WMM0 3HD7D 3SFDC 3D71A 1R5SA 5TJHA 2WZ7A 3M0AA 5E79E 3CMAP 1SLQA 1LT9B 3H1KG 1UIXA 1T6AA 3KPEA 3CCUP 1L0NJ 1LWUA 1FZAA 2Z5IA 1RHZB 3TGUE 3L74E 3GLMA 1FZCB 1GL2A 1L0NG 5AW1B 3TGUD 1LP1A 4ASWA 2RH0A 1JO5A 3L74D 4H44C 4OWFA 4GOEA 1JMBA 1NKNA 2P58A 3L37A 2R5BA 1PGOA 2ZAEB 3AEFD 1MV8A 1LTGC 1M1JC 1LT9A 3AE4D 5H2FE 2K9JA 1T3JA 5KLIB 3CCMP 3H1LG 5AVUB 3TK1A 1VQPP 5DJTB 5KLVG 1IC2A 3SWFA 1NEKD 2P1JA 3LW5H 1T2KC 3CCLP 3O8ZA 3P4SC 3II6A 1FE6A 5APYA 3I56P 1U7MA 4HJGH 2M3EA 2D2CD 2V7QH 3BASA 1FJPA 3BATA 2JP3A 1OW6A 2QM7A 2ZYDA 3CD6P 1YTZI 5AW4B 3G9RA 3G3ZA 3HD7A 2KNCB 2BS2C 3CC7P 2B87B 1J1DC 2Z5HA 3L71J 3AE1C 4LLHA 3VR8D 2XZRA 1SQBJ 2XV5A 1IFPA 1IK7A 2NZ2A 2C0WA 4IL6E 3AE3C 2NPSB 2GUVA 2YXRB 3QWOC 5BU8B 4U3FJ 3AEED 5APXA 3E1RA 1S2EA 1SQBG 1XTGB 1VF5C 2I1JA 3C9IA 3U1CA 1YQ3C 4H13D 1P84E 1VQMP 3KDPB 4U3FG 3AE5C 1NU1G 1S5LH 4DJGA 4EOTA 2E5TA 2OARA 4R4MA 3H1HG 2B87A 1EC5A 1P84D 1BCCJ 3PLNA 5KAIH 4L73A 4I1LA 3BVHA 1QX8A 5AVQB 1XTCC 3TNUA 3AE2C 4PV1B 2ZT9B 3Q1MA 2ACZC 1DEBA 3CXHD 1WT6A 2OYHC 1GL2C 4NPFX 5GTIH 1NEND 1JB0J 3H1KE 1NWQA 2FYUG 2KYVA 1GTWA 2GA1A 1T8ZA 2WDVD 2LXBA 2WSFH 4H13B 1L0NE 1KYOH 4YTMD 1FU1A 2E75D 4IFMA 1Q86Q 2MJZA 1HF9A 3SFEC 1NTMK 4YXDC 5C39A 3AE9C 2IPPA 1HUCA 2CK3H 3H25A 1NAFA 1L0ND 1HGVA 1GMJA 2JJLA 5TISE 1ZR4A 1E7PC 5AW3B 1Q82Q 2WMMA 2IFNA 1M90Q 5CHXA 3H1LE 5BU5A 3JC22 1SS1A 1SQQJ 2E43A 1N2DC 5AW8B 3U59A 2WQYD 1Z56A 1PPJG 1L0NK 1RH5B 3G6EP 4FJVA 5KLVE 2L5GB 1EDJA 1IFIA 4D6TG 3FXEA 1CW5A 3CMEP 2E75B 4ZKUA 3B71A 1MZ9A 4Y99C 2YXQB 1SFCC 1ZN5A 2QJYB 3EFGA 2O01J 2W6JH 3R4YA 2IX7C 3HUSA 3NMDA 3M91A 5KLVK 4LC1A 1USEA 3L71E 1G1IA 3CC4P 1SQBE 3AEFC 1OZHA 2OTJP 3CC2P 3AE4C 3ZDMA 1OXZA 1SQPG 1H0TB 3L71D 4U3FE 1NU1E 5AVYB 1DX7A 1VQLP 3IN6A 1JUNA 2R3SA 1SQBD 1GD2E 4H44B 4PJ0E 3H1HE 1IJDB 2N1TD 3EWKA 4U3FD 1DD3A 4KHXA 4R4LA 2WU5D 3CCQP 1NEKC 1L2PA 1M1JB 3ITKA 5E79H 2P67A 2PFXA 3CWBJ 4N6JA 3WU2H 2IBZI 3S4RA 2UWJE 4W7YA 1SQBK 3CIRD 2D2CC 3O6QB 3AE3D 3GW6A 2K9YA 1H0TA 1BCCD 4HYTB 1NU1K 4HH2A 4IFDK 2PGDA 1M8OB 1KTMA 3MTUE 1L4AD 2W27A 1RQUA 2Q1KA 1HJ0A 3VR8C 1EDIA 1E5WA 4JBZA 1YTZT 1M1JA 1CI6A 3L73G 4JQ0D 2Q9IA 5H2FH 1IFDA 3R2PA 4KX6D 2O01N 4C7NB 4L75A 1J1DB 3VMAA 3AE2D 2IBZG 3L36A 2FFDC 1EZVI 5AVVB 3M9HA 1PP9G 3I5CA 2FYUK 1KB9I 1EDLA 3RK2D 3JSVC 1M56D 1RE4A 3GHGB 3VP9A 1FJKA 2FYZA 3PRJA 1KC8Q 1VF5B 2I1KA 1L0LG 2V4HA 1SQQE 2W83C 5AW6B 1M1KQ 1JCDA 4LGDE 1OVRA 5CCGC 3A2AA 1LGHB 4YXDD 3V2PA 3L35A 2HODB 1SQQD 4U7JA 1PGQA 1NAYA 1NENC 3HUSC 3USSA 4IFFA 4DT0A 1EZVG 4XA4A 2WDVC 1NTZG 5AVZB 2H7HA 2P7JA 2GUSA 3PH0A 2YO2A 2WDRC 4YTMC 2A45H 1NTMJ 1VQ5P 4YSXD 2KOGA 1G1JA 5AW5B 1GL2B 3L75J 1P84H 1GK6A 1GDTA 1LP1B 2HODA 3RBXA 3H1KJ 1SQPE 5M1BA 1VQ4P 3BRVB 3RK3E 1QVFO 1VQNP 2JR8A 4ZNCA 1VQ9P 4DDGA 3CXHH 3MGNA 1RF0C 3JCUE 2K9JB 2WQYC 3MHVA 1SFCD 1S4XA 3C8VA 2AEFA 2KLVA 1LTJC 1QGKB 1J1EC 3RK3D 4UB6H 3VOPA 2OYHA 3F89A 1KN7A 1FOSE 3GMAA 3CX5H 5C2TD 1J2JB 3V4WA 1H89A 1ZP0D 5GTHH 1HJBA 2FYNC 4DHZA 1NKZB 2QJKC 1QVGO 3P4QC 3CWBE 3L70J 2Q6QA 2KIKA 5KKZC 1SQPK 2IYOA 3H1LJ 4OVNF 3V4QA 5KTBA 3WUVA 3L72G 4L76A 3L70G 3CWBD 2FKWB 3HD7B 5KLVJ 2A06G 3FXDA 5B5EE 1N73A 3L73E 3VR9C 2O3JA 1PFIA 2GM4A 1AQTA 1FC2C 3LIEA 2V7QJ 3RL0g 3AE6C 1ZOYD 4TLFA 1NTKG 1OW8A 5KAFE 3CPWO 3V2RA 3FWNA 1RE4C 2IBZE 5CJ0A 4C7RA 1HWTC 3A0HE 1GW4A 4GODA 4BRYB 3H1JG 3KYQA 2IBZD 2N1TC 2RKLA 3P7KA 3H32B 2WU5C 2CPBA 2PAJA 4WVZA 3WUUA 2WTYA 2J59M 1Y8AA 1HTLC 1S5LX 2BCCG 4RJTA 1SFCA 4N3YB 2FXPA 1EXIA
chains in the Genus database with same CATH topology
1DD3A 4I7ZC 2QIWA 2E74C 3AE6D 4OGQB 3VRBD 1Y9BA 4R4LA 1Q90D 4H44D 2WQYD 3CIRC 2WU5D 2E76D 1ZMEC 1KF6D 2BS4C 1NEKC 4R4MA 1PV3A 1ZP0D 1WMKA 1VF5D 2IDBA 2BEQD 2WS3D 3AE7D 3Q2YA 1K04A 4I7ZB 4OGQD 2E74B 2FYNC 3ABVC 3AEGC 3S9OA 1KFYD 2QJKC 1YQ3D 5C3JC 2MKVA 3GF3A 3P4QC 1EXJA 5L8RJ 2H88D 3AE5D 4YXDD 1R8EA 5KKZC 4RKUJ 2E75C 2H89C 1PL5A 4U7JA 2WSCJ 3FGAD 2G3AA 1L0VD 3P4RC 2E74D 2ZT9C 1NENC 1YQ4D 3AEDD 2WSEJ 4XFJA 3Q5RA 3AE4D 3Q3DA 3CIRD 2D2CC 3AE3D 3Q5PA 1FDOA 1NEKD 4YSYC 4YSXC 1KMIZ 2E75B 3AE2C 4PV1B 2K9YA 3P4SC 3P4PC 1NYHA 2ZT9B 1DIPA 3AEBD 2QJYC 3B71A 4IL6X 3T97B 2WP9D 2D2CB 3Q1MA 2ACZC 2WDVC 4KT0J 1PIXA 1QLBC 4YSZD 1RQVA 2H89D 3D6ZA 1ZOYC 3AEEC 3AE8D 4YTNC 4PV1D 3P4RD 4H0LC 2WDQC 3AECD 2ZT9D 1NEND 1JB0J 2B76D 1KTMA 1KQGB 2WDRC 4YTMC 2D2CD 1FDIA 3SFDC 4YSYD 3D71A 3O6QA 3VR9C 1RQUA 4YSXD 1AJYA 4KX6C 1DD4A 4GDOA 2JP3A 1OW6A 4H13C 3P4PD 3P4SD 1HJ0A 4H0LB 1KORA 1MKMA 2BEZF 2YIUC 3VR8C 2O01J 1TU3F 1OW7A 2ACZD 3R4YA 2WDVD 3G9RA 2V7QJ 1UIXA 2QJPC 3VRAC 3RL0g 2P10A 3AE6C 1ZOYD 2BS2C 3AEAC 3ABVD 4H13B 3AEGD 1U57A 3VRBC 4H0LD 1KILE 1OW8A 2YMKA 2WDQD 5C3JD 2E76C 3P4QD 1S1CX 2G8YA 4YTMD 2BS3C 5C2TD 2E75D 3LW5J 3SFDD 2WS3C 3AE1C 4KX6D 1KFYC 1HF9A 3SFEC 3GLMA 2WSFJ 1NGMB 5M1BA 2FBWC 2E76B 2H88C 4YXDC 1VL2A 4YTPC 3VR8D 3AE9C 1ZRTE 2QSIA 1IK7A 3H25A 1K05A 3AE2D 3VRAD 2NZ2A 3AEFC 3RK3E 4YT0C 3AEAD 1YQ4C 3AEDC 3IAOA 2WU2C 3AE3C 3AE4C 3GF7A 1GMJA 3D70A 5C2TC 2JO1A 4Z1MH 4YTND 3AEED 2WQYC 4H44C 1E7PC 3AE1D 2WU5C 3SFED 3AEBC 3D6YA 3C8VA 3IN6A 1KF6C 2WP9C 2WDRD 1ZP0C 2WPVB 3Q5SA 3EWKA 1OMIA 1VF5C 2FBWD 4YTPD 4YSZC 3AE9D 3VR9D 3AE7C 3AE8C 4OGQC 4PV1C 1YQ3C 2OQQA 4H13D 4H44B 3AECC 3AEFD 1S5LX 4YT0D 2B76C 5KLIC 3GMAA 3AE5C 2FXPA 1EXIA 2WU2D 4Y28J 4TT3H 1L0VC 1VF5B 1KQFB 2J5UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AE6 D;  3VRB D;  2WQY D;  3CIR C;  2WU5 D;  2BS4 C;  1KF6 D;  1NEK C;  1PV3 A;  1ZP0 D;  2WS3 D;  3AE7 D;  1K04 A;  3S9O A;  1KFY D;  3ABV C;  3AEG C;  1YQ3 D;  5C3J C;  3P4Q C;  3AE5 D;  2H88 D;  4YXD D;  2H89 C;  1L0V D;  2G3A A;  3P4R C;  1NEN C;  1YQ4 D;  3AED D;  3CIR D;  3AE3 D;  1NEK D;  4YSY C;  4YSX C;  3AE2 C;  3P4S C;  3P4P C;  3AEB D;  3B71 A;  2WP9 D;  2ACZ C;  2WDV C;  1QLB C;  4YSZ D;  2H89 D;  3AE8 D;  1ZOY C;  3AEE C;  4YTN C;  3P4R D;  2WDQ C;  3AEC D;  1NEN D;  2B76 D;  1KTM A;  2WDR C;  4YTM C;  3SFD C;  4YSY D;  3VR9 C;  4YSX D;  4KX6 C;  1OW6 A;  3P4P D;  3P4S D;  3VR8 C;  1OW7 A;  2ACZ D;  2WDV D;  3VRA C;  3AE6 C;  1ZOY D;  2BS2 C;  3VRB C;  3AEA C;  3ABV D;  3AEG D;  2WDQ D;  1OW8 A;  5C3J D;  3P4Q D;  4YTM D;  2BS3 C;  3SFD D;  2WS3 C;  3AE1 C;  4KX6 D;  1KFY C;  3SFE C;  2FBW C;  3VR8 D;  2H88 C;  4YXD C;  4YTP C;  3AE9 C;  1K05 A;  3AE2 D;  3VRA D;  3AEF C;  4YT0 C;  3AEA D;  1YQ4 C;  3AED C;  2WU2 C;  3AE3 C;  3AE4 C;  5C2T C;  4YTN D;  3AEE D;  2WQY C;  1E7P C;  3AE1 D;  2WU5 C;  3SFE D;  3AEB C;  1KF6 C;  2WP9 C;  2WDR D;  1ZP0 C;  5C2T D;  2FBW D;  4YTP D;  4YSZ C;  3AE9 D;  3VR9 D;  3AE7 C;  3AE8 C;  1YQ3 C;  3AEC C;  3AEF D;  4YT0 D;  2B76 C;  3AE5 C;  2WU2 D;  3AE4 D;  1L0V C; 
#chains in the Genus database with same CATH topology
 1X0T A;  4WWI A;  3CIR C;  1AV1 A;  4WB4 A;  3TNU B;  3RGU A;  3VN0 A;  1JY2 O;  1NU1 J;  5CJ4 A;  5CBN A;  3CLQ A;  3PP5 A;  4JYB A;  1PL5 A;  2WSC J;  2G3A A;  1SQX G;  3H1H J;  1EZV E;  4BRY A;  1URQ C;  1L4A C;  1KB9 E;  3OA7 A;  3HTK B;  4W7Z A;  3H32 A;  2D2C B;  4AQR D;  1L0L K;  2ZFC A;  4YTN C;  2Y0C A;  3GG2 A;  1KQG B;  1FDI A;  4YSY D;  1AJY A;  1NTM E;  4KX6 C;  2ITA A;  1NO4 A;  2H8P D;  4N78 E;  3RBZ A;  4AUW A;  2XND H;  3L75 E;  4PJ0 H;  2FYU J;  4H0L D;  5CCG D;  2XU6 A;  2E76 C;  2K37 A;  1LTT C;  2KLU A;  3CL3 D;  3P32 A;  1RF1 C;  1NTM D;  3NFQ A;  4A7P A;  4N78 D;  1A02 J;  2WSF J;  3L75 D;  2OYO A;  3RK2 C;  1NTZ K;  1U7J A;  3VRA D;  3HTK A;  5CMZ A;  4EIJ A;  3H1K D;  3D6Y A;  2FFD B;  3KXD A;  2WDR D;  3KZI E;  1FS0 E;  2WIT A;  3TDK A;  1EQ7 A;  3AEC C;  2Q3E A;  4OH8 B;  1X79 B;  1NHL A;  1HVV A;  1OFC X;  1MFT A;  4OGQ D;  1N73 C;  3A3Y B;  2KUB A;  3L70 E;  1UII A;  3SWK A;  4K3A A;  3OW2 O;  4YSX C;  2A06 E;  1VPC A;  2AEM A;  5APW A;  1JY2 P;  2BAS A;  1H88 A;  4D6T J;  1FZC C;  3L70 D;  3S1K A;  3T97 B;  2FFD A;  3HUS B;  2ZFY A;  4KT0 J;  1QLB C;  3RL0 C;  3H1L D;  2OYI C;  3EQ2 A;  1Y47 A;  1OWA A;  1ZV8 A;  2QE7 H;  1Q81 Q;  2BEZ F;  5APT A;  5KLV D;  3KHU A;  3A0B H;  1OVV A;  3L4F A;  3B5N D;  3P4Q D;  1FZG A;  2AEJ A;  3H1J E;  5AVR B;  1KFY C;  1QEX A;  1BE3 G;  4PD4 H;  4M3L A;  5CCG A;  3RK3 C;  2QSI A;  3AEA D;  3AED C;  1BDC A;  2PP6 A;  5C2T C;  3T97 A;  1BSN A;  2BCC E;  1ZP0 C;  1BGY G;  4JPZ B;  3VR9 D;  4RO0 A;  4DCK A;  1S72 P;  1SQP J;  2CPS A;  3A5T A;  1KZU B;  1NTK K;  3M9B A;  4ZKP A;  1LTJ B;  2ZJS E;  1J1E B;  2YNY A;  2QIW A;  3AE6 D;  1SQX E;  1PV3 A;  2M3B A;  3S9O A;  4JF7 A;  1S5L E;  2MKV A;  2B9B A;  2W6B A;  4WY4 D;  2ZXX A;  1D7M A;  4DHJ A;  2FYN B;  1Q2N A;  5AVT B;  2QJK B;  4XFJ A;  5AW2 B;  2WPS A;  5KAI E;  1NU1 D;  5KKZ B;  2KB7 P;  5KJ7 C;  1PIX A;  1CI6 B;  1RQV A;  1ZXG A;  2H89 D;  1ZOY C;  1RF0 A;  3H1H D;  3TYY A;  2YO3 A;  3JCU H;  1VQ8 P;  2FXM A;  2OGU A;  2NPS C;  1LTJ A;  3OJA B;  1YYC A;  3G71 P;  3P4P D;  1K73 Q;  2XKM A;  3L74 G;  1LTI C;  2OTL P;  1K9M Q;  1H8A A;  1SQX K;  2FYU E;  2KSJ A;  3EFF K;  2WDQ D;  1KIL E;  2YMK A;  1FOS F;  2WPR A;  3P8C E;  1URQ D;  2NRG A;  3L73 J;  1ZRT E;  2FYU D;  2PRR A;  1KIL D;  1X22 A;  3M06 A;  2QVA A;  4YTN D;  3AEB C;  3CCV P;  1ZRT D;  2FBW D;  4C46 A;  1PP9 J;  2N1T B;  4PV1 C;  2M0B A;  1KQF B;  1Q90 D;  2JKV A;  1NVO A;  2E76 D;  2BS4 C;  1N7S D;  2HFE D;  2WSE H;  1L0L J;  5CBO A;  5C3J C;  2A45 I;  1AFO A;  3V2N A;  5L8R J;  4RKU J;  2KP8 A;  1LJ2 A;  1PPJ E;  1KFN A;  2E74 D;  4LDT A;  1FZB A;  3PJS K;  3Q3D A;  4AYC A;  4ZMD A;  4YSY C;  4WY4 A;  3A0H H;  3HE4 A;  1AA0 A;  1JY3 O;  4D6T E;  1URQ B;  1ZW0 A;  4IL6 X;  4GOF A;  1L4A B;  2QA4 P;  1YJ9 P;  1PPJ D;  2N1T A;  4RES B;  3MD0 A;  3P4R D;  4H0L C;  3AEC D;  2B88 A;  1NTZ J;  4D6T D;  3CXH I;  2YIU C;  1TU3 F;  2QJP C;  3VRA C;  1BE3 E;  2W90 A;  3VRB C;  4BWN A;  2Q7C A;  1M57 D;  1VQ7 P;  4IL6 H;  4NPE A;  3CX5 I;  2A45 G;  1NGM B;  2E76 B;  1VL2 A;  2R5D A;  1SQV J;  1FZF A;  1JTH B;  1X8Y A;  2OYH B;  1YQ4 C;  1BGY E;  3RK2 B;  3GF7 A;  1URQ A;  2POH A;  2ZXE B;  1L4A A;  4ASV A;  3RL0 D;  3FX0 A;  1SQV G;  1KIL A;  2WP9 C;  2FY8 A;  3SWY A;  2KK7 A;  3Q5S A;  4OGQ C;  1KD1 Q;  2B76 C;  3PHL A;  2WU2 D;  4TT3 H;  2AXT E;  1WMK A;  2RN0 A;  1K04 A;  1KFY D;  3ABV C;  1SQP D;  3AEG C;  1N8R Q;  3GF3 A;  1R8E A;  1N7S A;  1HGZ A;  2KI7 B;  1JTH A;  1RF1 A;  1YI2 P;  1N73 B;  1PZQ A;  3AED D;  3Q5P A;  1VDF A;  1VQK P;  3WU2 E;  1JNM A;  2K3R A;  1JMM A;  3V6I A;  5EFW B;  3MZW B;  1MUU A;  3CI9 A;  2XDJ A;  3LID A;  4I6L A;  1KFM A;  2KZI A;  5BVZ A;  2KZJ A;  3B5N C;  3L72 J;  3VON A;  1IK9 A;  3WUT A;  3QH9 A;  3RL0 B;  1K8A Q;  2OYI B;  2QG4 A;  3KZI H;  1JY3 P;  1OW7 A;  2R3C A;  5B66 E;  3AEA C;  1HBW A;  1OVU A;  2HG5 D;  1BDD A;  1W2E A;  1S1C X;  2G8Y A;  2BS3 C;  3KQG A;  3LW5 J;  1N86 A;  2WS3 C;  2Q3I A;  3HRN A;  5DJU B;  1GZL A;  4GIF A;  5TIS H;  1NTK J;  4Y99 B;  1QL1 A;  2HLO A;  1SFC B;  5KJ7 D;  1LNQ A;  1USD A;  3IAO A;  2E5Y A;  2VRS A;  3RK3 B;  4DDI A;  2O1J A;  2W6A A;  3IFM A;  4I6M C;  5CCH C;  3L73 D;  3H1J J;  2NPS D;  1OMI A;  1FZC A;  4YSZ C;  4L74 A;  1PP9 E;  5AVW B;  4KJM A;  4YT0 D;  2QEX P;  2OYI A;  4WY4 C;  3CCS P;  4EI2 A;  3H1I J;  4JYC A;  1EDK A;  4YPC A;  3H6P A;  3B8E B;  1KF6 D;  2BCC J;  1PP9 D;  1GU4 A;  4NPD A;  2R44 A;  3AE7 D;  2WVR A;  3MP7 B;  1L0L E;  1SVF A;  3H1I G;  2H89 C;  1L0V D;  2KS1 B;  3NXS A;  3E1I A;  3A7O A;  3BCC J;  3P4P C;  2L91 A;  1L0L D;  2I8D A;  3AEB D;  1SQX J;  1YBK A;  1LTA C;  3HE5 B;  3D6Z A;  4PV1 D;  1YJW P;  2WDQ C;  2ZT9 D;  2WWW A;  3BCC G;  3MUD A;  1DD4 A;  1NTZ E;  4W80 A;  1KQL A;  1JY2 N;  1YIJ P;  3L71 G;  3I55 P;  1KIL C;  3GHG C;  1E79 H;  1KYO I;  4WBA A;  5C3J D;  1BSH A;  1EZV D;  4UB8 E;  1NTZ D;  2C9L Y;  3V5B A;  1KB9 D;  2FBW C;  2KS1 A;  1VQO P;  1SQV E;  5AW0 B;  3VMZ A;  2KNC A;  3D70 A;  2WSC H;  3HE5 A;  3FWL A;  5KJ7 A;  1N7S C;  2WPV B;  1SQV D;  4YTP D;  3AE8 C;  3CXH E;  1CSB A;  2YKQ A;  3E7K A;  3M0D A;  3IR9 A;  1BCC G;  1LWU C;  2NPS A;  5APV A;  4I7Z C;  2E74 C;  3VRB D;  2R32 A;  5AVS B;  2Y0D A;  4UB6 E;  1FBM A;  3CX5 E;  1G2C B;  2JWD A;  1OX3 A;  3FGA D;  3P4R C;  1AVY A;  1T3U A;  3CCJ P;  1YQ4 D;  1SQV K;  5GTH E;  1FDO A;  3CX5 D;  3UIA A;  1NYH A;  3VMY A;  2KSE A;  2WP9 D;  1A02 F;  1LT1 A;  1IFJ A;  5APS A;  4PD4 I;  2KXP B;  2B76 D;  1LT9 C;  3L72 E;  3TF5 A;  1YIT P;  1JOC A;  3W67 A;  4CPG A;  4H0L B;  3U1A A;  1KOR A;  3CCR P;  3M9Q A;  1AQ5 A;  2C9N Y;  1AVO A;  2Y9Z A;  3ABV D;  3AEG D;  3L72 D;  1G2C A;  2YIU B;  4HKZ H;  3SFD D;  2QJP B;  2YKO A;  2A06 D;  2H88 C;  1NTK E;  4K35 A;  1JM0 A;  2WU2 C;  1BE3 J;  3C1L A;  4B86 A;  1NOH A;  1ZLL A;  1SQQ G;  1NTK D;  1IO4 A;  1RE3 A;  1S3J A;  5KLI C;  4DOJ A;  3HD7 C;  3B4S A;  4Y28 J;  2O1K A;  2FXO A;  1BGY J;  1CZQ A;  4OGQ B;  2AXC A;  4H44 D;  3H1I E;  1LTB C;  1ZME C;  3H1J D;  2LR2 A;  2WS3 D;  2ZYG A;  3MUD C;  4GKG A;  1WRG A;  3H1I D;  3Q5R A;  2BCC D;  2Q5U A;  4MN4 C;  3BCC E;  5CCH D;  1DIP A;  2YKP A;  3P8M C;  4YSZ D;  2K1A A;  2O01 H;  4EYY Q;  4EDF A;  2LKM A;  3BCC D;  1IFM A;  4O9B A;  1GK4 A;  1T2K D;  1IFN A;  3P4S D;  2IZ0 A;  1TFF A;  1MKM A;  1SQX D;  3B5N B;  2HPC B;  4QMA A;  2P10 A;  3MIW A;  1KQS O;  3TGU J;  1DEE G;  2AXT H;  5AW7 B;  3L74 J;  4BXL A;  3M0D C;  2Z4E A;  1JEK A;  4I2L C;  3G4S P;  1K05 A;  3TGU G;  4YT0 C;  1GW3 A;  1OIP A;  1YHQ P;  5GTI E;  1FAV A;  2JO1 A;  2HR3 A;  2Y0E A;  2E42 A;  3AE1 D;  2W8Z A;  2Y9Y A;  1KF6 C;  1BCC E;  2WPQ A;  1DH3 A;  3AE7 C;  1NJI Q;  2OQQ A;  1LTS C;  1M7L A;  1PGP A;  1S9K E;  2YMY A;  3B5N A;  2HPC A;  1L0V C;  2J5U A;  1KYO E;  3N4X A;  3CWB G;  2B89 A;  4WY4 B;  4GT1 A;  2JEE A;  3HE4 B;  1X9V A;  1VF5 D;  2IDB A;  4DHI B;  3P8C D;  3VYI A;  3Q2Y A;  1S9K D;  1YQ3 D;  2J58 A;  1EXJ A;  3AE5 D;  1KYO D;  5B66 H;  2OTK E;  2ZT9 C;  2ZVO B;  2WSE J;  1R5L A;  2C0X A;  2N9Y B;  5AW9 B;  1KMI Z;  5B5E H;  2QRX A;  3SSU A;  4YXW H;  4IOI H;  1JCC A;  3AE8 D;  3AEE C;  2M5A B;  1W5C E;  2RMZ A;  3IF4 A;  5CCH A;  2M8R A;  1FZE A;  3O6Q A;  5KAF H;  4GDO A;  4H13 C;  3VMX A;  3K5B A;  1P84 I;  3NTN A;  3V2Q A;  3OAK A;  2ACZ D;  2K88 A;  2SPZ A;  1HH0 A;  1U57 A;  1GL2 D;  2IYP A;  2IZ1 A;  1RE3 C;  3PTZ A;  2H43 A;  1KIL B;  3A0B E;  2WT7 B;  2WSS H;  4YTP C;  1JY3 N;  1PGJ A;  4Z1M H;  4PD4 E;  1IZN B;  1QL2 A;  3SFE D;  2N9B A;  3CCE P;  4XE5 B;  4C7N A;  2P2U A;  2M5A A;  5AVX B;  3AE9 D;  3F5H A;  2QM8 A;  2JWA A;  1N7S B;  1BE3 D;  1RF1 B;  4PD4 D;  1RY3 A;  1NH4 A;  3TSI A;  1Y9B A;  5APU A;  1VQ6 P;  1YJN P;  1GU5 A;  5K5G B;  3VTP C;  1Q7Y Q;  1ZR2 A;  2BEQ D;  1LWU B;  2DW3 A;  4I7Z B;  2E74 B;  2JDI H;  5APQ A;  1KB9 H;  3GHG A;  2HYN A;  2WT7 A;  2H88 D;  1N7L A;  3VP8 A;  3W68 A;  2E75 C;  3N7N A;  1BGY D;  2XNX A;  2ZVN B;  1W2B O;  1SQQ K;  4UB8 H;  2ZYA A;  2LXC B;  1MFZ A;  3BRT B;  1NTM G;  2QJY C;  1FDM A;  4DZO A;  3L75 G;  1KV4 A;  1QLE D;  4HB1 A;  1SP4 A;  2IFM A;  3WMM 0;  3HD7 D;  3SFD C;  3D71 A;  1R5S A;  5TJH A;  2WZ7 A;  3M0A A;  5E79 E;  3CMA P;  1SLQ A;  1LT9 B;  3H1K G;  1UIX A;  1T6A A;  3KPE A;  3CCU P;  1L0N J;  1LWU A;  1FZA A;  2Z5I A;  1RHZ B;  3TGU E;  3L74 E;  3GLM A;  1FZC B;  1GL2 A;  1L0N G;  5AW1 B;  3TGU D;  1LP1 A;  4ASW A;  2RH0 A;  1JO5 A;  3L74 D;  4H44 C;  4OWF A;  4GOE A;  1JMB A;  1NKN A;  2P58 A;  3L37 A;  2R5B A;  1PGO A;  2ZAE B;  3AEF D;  1MV8 A;  1LTG C;  1M1J C;  1LT9 A;  3AE4 D;  5H2F E;  2K9J A;  1T3J A;  5KLI B;  3CCM P;  3H1L G;  5AVU B;  3TK1 A;  1VQP P;  5DJT B;  5KLV G;  1IC2 A;  3SWF A;  1NEK D;  2P1J A;  3LW5 H;  1T2K C;  3CCL P;  3O8Z A;  3P4S C;  3II6 A;  1FE6 A;  5APY A;  3I56 P;  1U7M A;  4HJG H;  2M3E A;  2D2C D;  2V7Q H;  3BAS A;  1FJP A;  3BAT A;  2JP3 A;  1OW6 A;  2QM7 A;  2ZYD A;  3CD6 P;  1YTZ I;  5AW4 B;  3G9R A;  3G3Z A;  3HD7 A;  2KNC B;  2BS2 C;  3CC7 P;  2B87 B;  1J1D C;  2Z5H A;  3L71 J;  3AE1 C;  4LLH A;  3VR8 D;  2XZR A;  1SQB J;  2XV5 A;  1IFP A;  1IK7 A;  2NZ2 A;  2C0W A;  4IL6 E;  3AE3 C;  2NPS B;  2GUV A;  2YXR B;  3QWO C;  5BU8 B;  4U3F J;  3AEE D;  5APX A;  3E1R A;  1S2E A;  1SQB G;  1XTG B;  1VF5 C;  2I1J A;  3C9I A;  3U1C A;  1YQ3 C;  4H13 D;  1P84 E;  1VQM P;  3KDP B;  4U3F G;  3AE5 C;  1NU1 G;  1S5L H;  4DJG A;  4EOT A;  2E5T A;  2OAR A;  4R4M A;  3H1H G;  2B87 A;  1EC5 A;  1P84 D;  1BCC J;  3PLN A;  5KAI H;  4L73 A;  4I1L A;  3BVH A;  1QX8 A;  5AVQ B;  1XTC C;  3TNU A;  3AE2 C;  4PV1 B;  2ZT9 B;  3Q1M A;  2ACZ C;  1DEB A;  3CXH D;  1WT6 A;  2OYH C;  1GL2 C;  4NPF X;  5GTI H;  1NEN D;  1JB0 J;  3H1K E;  1NWQ A;  2FYU G;  2KYV A;  1GTW A;  2GA1 A;  1T8Z A;  2WDV D;  2LXB A;  2WSF H;  4H13 B;  1L0N E;  1KYO H;  4YTM D;  1FU1 A;  2E75 D;  4IFM A;  1Q86 Q;  2MJZ A;  1HF9 A;  3SFE C;  1NTM K;  4YXD C;  5C39 A;  3AE9 C;  2IPP A;  1HUC A;  2CK3 H;  3H25 A;  1NAF A;  1L0N D;  1HGV A;  1GMJ A;  2JJL A;  5TIS E;  1ZR4 A;  1E7P C;  5AW3 B;  1Q82 Q;  2WMM A;  2IFN A;  1M90 Q;  5CHX A;  3H1L E;  5BU5 A;  3JC2 2;  1SS1 A;  1SQQ J;  2E43 A;  1N2D C;  5AW8 B;  3U59 A;  2WQY D;  1Z56 A;  1PPJ G;  1L0N K;  1RH5 B;  3G6E P;  4FJV A;  5KLV E;  2L5G B;  1EDJ A;  1IFI A;  4D6T G;  3FXE A;  1CW5 A;  3CME P;  2E75 B;  4ZKU A;  3B71 A;  1MZ9 A;  4Y99 C;  2YXQ B;  1SFC C;  1ZN5 A;  2QJY B;  3EFG A;  2O01 J;  2W6J H;  3R4Y A;  2IX7 C;  3HUS A;  3NMD A;  3M91 A;  5KLV K;  4LC1 A;  1USE A;  3L71 E;  1G1I A;  3CC4 P;  1SQB E;  3AEF C;  1OZH A;  2OTJ P;  3CC2 P;  3AE4 C;  3ZDM A;  1OXZ A;  1SQP G;  1H0T B;  3L71 D;  4U3F E;  1NU1 E;  5AVY B;  1DX7 A;  1VQL P;  3IN6 A;  1JUN A;  2R3S A;  1SQB D;  1GD2 E;  4H44 B;  4PJ0 E;  3H1H E;  1IJD B;  2N1T D;  3EWK A;  4U3F D;  1DD3 A;  4KHX A;  4R4L A;  2WU5 D;  3CCQ P;  1NEK C;  1L2P A;  1M1J B;  3ITK A;  5E79 H;  2P67 A;  2PFX A;  3CWB J;  4N6J A;  3WU2 H;  2IBZ I;  3S4R A;  2UWJ E;  4W7Y A;  1SQB K;  3CIR D;  2D2C C;  3O6Q B;  3AE3 D;  3GW6 A;  2K9Y A;  1H0T A;  1BCC D;  4HYT B;  1NU1 K;  4HH2 A;  4IFD K;  2PGD A;  1M8O B;  1KTM A;  3MTU E;  1L4A D;  2W27 A;  1RQU A;  2Q1K A;  1HJ0 A;  3VR8 C;  1EDI A;  1E5W A;  4JBZ A;  1YTZ T;  1M1J A;  1CI6 A;  3L73 G;  4JQ0 D;  2Q9I A;  5H2F H;  1IFD A;  3R2P A;  4KX6 D;  2O01 N;  4C7N B;  4L75 A;  1J1D B;  3VMA A;  3AE2 D;  2IBZ G;  3L36 A;  2FFD C;  1EZV I;  5AVV B;  3M9H A;  1PP9 G;  3I5C A;  2FYU K;  1KB9 I;  1EDL A;  3RK2 D;  3JSV C;  1M56 D;  1RE4 A;  3GHG B;  3VP9 A;  1FJK A;  2FYZ A;  3PRJ A;  1KC8 Q;  1VF5 B;  2I1K A;  1L0L G;  2V4H A;  1SQQ E;  2W83 C;  5AW6 B;  1M1K Q;  1JCD A;  4LGD E;  1OVR A;  5CCG C;  3A2A A;  1LGH B;  4YXD D;  3V2P A;  3L35 A;  2HOD B;  1SQQ D;  4U7J A;  1PGQ A;  1NAY A;  1NEN C;  3HUS C;  3USS A;  4IFF A;  4DT0 A;  1EZV G;  4XA4 A;  2WDV C;  1NTZ G;  5AVZ B;  2H7H A;  2P7J A;  2GUS A;  3PH0 A;  2YO2 A;  2WDR C;  4YTM C;  2A45 H;  1NTM J;  1VQ5 P;  4YSX D;  2KOG A;  1G1J A;  5AW5 B;  1GL2 B;  3L75 J;  1P84 H;  1GK6 A;  1GDT A;  1LP1 B;  2HOD A;  3RBX A;  3H1K J;  1SQP E;  5M1B A;  1VQ4 P;  3BRV B;  3RK3 E;  1QVF O;  1VQN P;  2JR8 A;  4ZNC A;  1VQ9 P;  4DDG A;  3CXH H;  3MGN A;  1RF0 C;  3JCU E;  2K9J B;  2WQY C;  3MHV A;  1SFC D;  1S4X A;  3C8V A;  2AEF A;  2KLV A;  1LTJ C;  1QGK B;  1J1E C;  3RK3 D;  4UB6 H;  3VOP A;  2OYH A;  3F89 A;  1KN7 A;  1FOS E;  3GMA A;  3CX5 H;  5C2T D;  1J2J B;  3V4W A;  1H89 A;  1ZP0 D;  5GTH H;  1HJB A;  2FYN C;  4DHZ A;  1NKZ B;  2QJK C;  1QVG O;  3P4Q C;  3CWB E;  3L70 J;  2Q6Q A;  2KIK A;  5KKZ C;  1SQP K;  2IYO A;  3H1L J;  4OVN F;  3V4Q A;  5KTB A;  3WUV A;  3L72 G;  4L76 A;  3L70 G;  3CWB D;  2FKW B;  3HD7 B;  5KLV J;  2A06 G;  3FXD A;  5B5E E;  1N73 A;  3L73 E;  3VR9 C;  2O3J A;  1PFI A;  2GM4 A;  1AQT A;  1FC2 C;  3LIE A;  2V7Q J;  3RL0 g;  3AE6 C;  1ZOY D;  4TLF A;  1NTK G;  1OW8 A;  5KAF E;  3CPW O;  3V2R A;  3FWN A;  1RE4 C;  2IBZ E;  5CJ0 A;  4C7R A;  1HWT C;  3A0H E;  1GW4 A;  4GOD A;  4BRY B;  3H1J G;  3KYQ A;  2IBZ D;  2N1T C;  2RKL A;  3P7K A;  3H32 B;  2WU5 C;  2CPB A;  2PAJ A;  4WVZ A;  3WUU A;  2WTY A;  2J59 M;  1Y8A A;  1HTL C;  1S5L X;  2BCC G;  4RJT A;  1SFC A;  4N3Y B;  2FXP A;  1EXI A; 
#chains in the Genus database with same CATH homology
 1DD3 A;  4I7Z C;  2QIW A;  2E74 C;  3AE6 D;  4OGQ B;  3VRB D;  1Y9B A;  4R4L A;  1Q90 D;  4H44 D;  2WQY D;  3CIR C;  2WU5 D;  2E76 D;  1ZME C;  1KF6 D;  2BS4 C;  1NEK C;  4R4M A;  1PV3 A;  1ZP0 D;  1WMK A;  1VF5 D;  2IDB A;  2BEQ D;  2WS3 D;  3AE7 D;  3Q2Y A;  1K04 A;  4I7Z B;  4OGQ D;  2E74 B;  2FYN C;  3ABV C;  3AEG C;  3S9O A;  1KFY D;  2QJK C;  1YQ3 D;  5C3J C;  2MKV A;  3GF3 A;  3P4Q C;  1EXJ A;  5L8R J;  2H88 D;  3AE5 D;  4YXD D;  1R8E A;  5KKZ C;  4RKU J;  2E75 C;  2H89 C;  1PL5 A;  4U7J A;  2WSC J;  3FGA D;  2G3A A;  1L0V D;  3P4R C;  2E74 D;  2ZT9 C;  1NEN C;  1YQ4 D;  3AED D;  2WSE J;  4XFJ A;  3Q5R A;  3AE4 D;  3Q3D A;  3CIR D;  2D2C C;  3AE3 D;  3Q5P A;  1FDO A;  1NEK D;  4YSY C;  4YSX C;  1KMI Z;  2E75 B;  3AE2 C;  4PV1 B;  2K9Y A;  3P4S C;  3P4P C;  1NYH A;  2ZT9 B;  1DIP A;  3AEB D;  2QJY C;  3B71 A;  4IL6 X;  3T97 B;  2WP9 D;  2D2C B;  3Q1M A;  2ACZ C;  2WDV C;  4KT0 J;  1PIX A;  1QLB C;  4YSZ D;  1RQV A;  2H89 D;  3D6Z A;  1ZOY C;  3AEE C;  3AE8 D;  4YTN C;  4PV1 D;  3P4R D;  4H0L C;  2WDQ C;  3AEC D;  2ZT9 D;  1NEN D;  1JB0 J;  2B76 D;  1KTM A;  1KQG B;  2WDR C;  4YTM C;  2D2C D;  1FDI A;  3SFD C;  4YSY D;  3D71 A;  3O6Q A;  3VR9 C;  1RQU A;  4YSX D;  1AJY A;  4KX6 C;  1DD4 A;  4GDO A;  2JP3 A;  1OW6 A;  4H13 C;  3P4P D;  3P4S D;  1HJ0 A;  4H0L B;  1KOR A;  1MKM A;  2BEZ F;  2YIU C;  3VR8 C;  2O01 J;  1TU3 F;  1OW7 A;  2ACZ D;  3R4Y A;  2WDV D;  3G9R A;  2V7Q J;  1UIX A;  2QJP C;  3VRA C;  3RL0 g;  2P10 A;  3AE6 C;  1ZOY D;  2BS2 C;  3AEA C;  3ABV D;  4H13 B;  3AEG D;  1U57 A;  3VRB C;  4H0L D;  1KIL E;  1OW8 A;  2YMK A;  2WDQ D;  5C3J D;  2E76 C;  3P4Q D;  1S1C X;  2G8Y A;  4YTM D;  2BS3 C;  5C2T D;  2E75 D;  3LW5 J;  3SFD D;  2WS3 C;  3AE1 C;  4KX6 D;  1KFY C;  1HF9 A;  3SFE C;  3GLM A;  2WSF J;  1NGM B;  5M1B A;  2FBW C;  2E76 B;  2H88 C;  4YXD C;  1VL2 A;  4YTP C;  3VR8 D;  3AE9 C;  1ZRT E;  2QSI A;  1IK7 A;  3H25 A;  1K05 A;  3AE2 D;  3VRA D;  2NZ2 A;  3AEF C;  3RK3 E;  4YT0 C;  3AEA D;  1YQ4 C;  3AED C;  3IAO A;  2WU2 C;  3AE3 C;  3AE4 C;  3GF7 A;  1GMJ A;  3D70 A;  5C2T C;  2JO1 A;  4Z1M H;  4YTN D;  3AEE D;  2WQY C;  4H44 C;  1E7P C;  3AE1 D;  2WU5 C;  3SFE D;  3AEB C;  3D6Y A;  3C8V A;  3IN6 A;  1KF6 C;  2WP9 C;  2WDR D;  1ZP0 C;  2WPV B;  3Q5S A;  3EWK A;  1OMI A;  1VF5 C;  2FBW D;  4YTP D;  4YSZ C;  3AE9 D;  3VR9 D;  3AE7 C;  3AE8 C;  4OGQ C;  4PV1 C;  1YQ3 C;  2OQQ A;  4H13 D;  4H44 B;  3AEC C;  3AEF D;  1S5L X;  4YT0 D;  2B76 C;  5KLI C;  3GMA A;  3AE5 C;  2FXP A;  1EXI A;  2WU2 D;  4Y28 J;  4TT3 H;  1L0V C;  1VF5 B;  1KQF B;  2J5U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...