3SFEC

Crystal structure of porcine mitochondrial respiratory complex ii bound with oxaloacetate and thiabendazole
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
139
structure length
139
Chain Sequence
GTTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Thiabendazole inhibits ubiquinone reduction activity of mitochondrial respiratory complex II via a water molecule mediated binding feature.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
total genus 47
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2011-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3sfeC01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3sfeC02
4YXDD 1PV3A 3AEAC 3AE3D 3AEFC 3AEEC 1KFYD 2WU2D 3AEED 5C3JD 1L0VC 3AE9C 1NENC 3AE6D 3P4RD 5C3JC 5C2TD 3AE9D 3P4RC 4YT0C 1NEKD 3SFEC 3AE7C 4KX6D 1YQ3C 1K04A 3AEAD 2FBWC 1ZOYD 3S9OA 2FBWD 2B76C 2WDQC 4YTND 2ACZC 1ZP0C 3AE8D 2WU2C 3AE1C 2WDRD 1NEKC 3SFDC 4YTMD 3AEBC 3AE6C 2WQYC 1NEND 3AEDD 4YSXD 3SFDD 4YTMC 2WQYD 2G3AA 3AE4D 4YTPD 4YSYD 1KF6C 3VR8D 4KX6C 1KF6D 3AEGC 3SFED 3VR8C 3AEGD 1YQ4C 2H89D 2B76D 1ZOYC 3ABVD 3VR9D 2WU5C 3VRBC 3AE5D 1E7PC 2WP9D 2WS3D 3VRBD 2WP9C 2WS3C 3AE4C 3AEDC 3AEBD 4YSXC 3P4QC 1QLBC 3P4QD 1K05A 2BS3C 2H88D 1YQ4D 2H88C 3B71A 1OW8A 2WDVC 3P4PC 4YT0D 3VR9C 3AE2C 3AE8C 2ACZD 2WU5D 3AECD 3VRAC 3ABVC 4YXDC 3AECC 3VRAD 3P4SC 3CIRD 2WDRC 1YQ3D 2BS4C 1KFYC 4YTPC 3AE3C 3AEFD 2WDQD 4YTNC 4YSZD 1ZP0D 1OW7A 4YSZC 5C2TC 3AE1D 1OW6A 1L0VD 2H89C 1KTMA 2WDVD 3P4PD 3AE2D 3AE7D 4YSYC 3AE5C 3P4SD 2BS2C 3CIRC
chains in the Genus database with same CATH superfamily
4YXDD 2YKOA 1E5WA 3A0HH 1L0NJ 4U3FJ 1NU1K 2WU2D 1QGKB 1LWUC 1YIJP 2C0WA 2LR2A 3NXSA 3O8ZA 3AE7C 4OGQD 1G1JA 1YQ3C 3HUSA 2PGDA 3CWBJ 3CPWO 2IDBA 3IAOA 1GTWA 3HTKA 4ZKUA 1BSNA 1GL2A 1NEKC 3AE6C 1PP9E 4R4MA 4YTPD 3TGUD 1KMIZ 3WUUA 4I7ZB 3D70A 3H1LG 3QH9A 3BCCG 1OWAA 2WPQA 1E7PC 3B4SA 2P58A 1M1KQ 1LNQA 1L4AB 2XV5A 3E1IA 4GIFA 2JO1A 1K05A 1R5LA 1M1JC 3Q1MA 1IFIA 3L71G 3VR9C 1UIIA 1SQBG 2N9BA 1L0LD 2Z5IA 2E76B 4ASWA 3Q5RA 1U57A 4Y99C 2HODA 1G2CA 1PPJD 5TISH 4D6TG 3B5NC 1G1IA 3L75E 1L0NE 4U3FG 4GOEA 1PP9J 1USDA 3SSUA 1SQQJ 5AVYB 3CCRP 3CD6P 1KQGB 2LXBA 4ZMDA 4W7ZA 3H25A 1LJ2A 2JWDA 3CWBG 3USSA 1GL2B 1SQPG 1S72P 1ZRTE 2UWJE 4RO0A 3U1AA 1RY3A 4C7RA 4ASVA 2P67A 1D7MA 3L70J 3TK1A 1NHLA 3L74G 2PAJA 1JUNA 1GL2D 4PJ0H 1YYCA 2WU2C 1QLED 1N7SC 1YJWP 1KFMA 4BXLA 2IPPA 1ZN5A 2M0BA 2FXOA 1PP9D 1LWUA 1YQ4C 3HD7D 1ZOYC 5BU8B 1SQBD 2WP9D 3L72J 2QJYC 3AE4C 1JB0J 1JOCA 1ZR4A 3CC4P 1NGMB 2BEQD 4XA4A 3LIDA 2J5UA 1JTHA 1OMIA 3AECD 1URQD 1IO4A 3CIRD 4IL6X 1JMBA 3UIAA 3JCUE 2WSFH 1G2CB 5KTBA 3QWOC 2OYIA 2B89A 2B87B 1DEBA 2Q3IA 2AEMA 1NTMJ 3AE7D 1NOHA 1NU1J 1M7LA 3H32A 2W90A 3V2NA 3PP5A 1KFYD 2I1JA 2O01J 1M8OB 2RN0A 1NTMK 4LGDE 4XE5B 2N9YB 4D6TD 2KS1B 2FBWC 1N73A 4MN4C 2WDQC 2YO3A 1H0TB 4TT3H 2FYUJ 1H89A 2C9LY 2WQYC 4NPEA 1H0TA 1VDFA 2G3AA 3ITKA 1N73B 1FBMA 3CLQA 3AEGC 1LWUB 3JCUH 2WPRA 2P1JA 4OGQB 3HD7C 1QX8A 2WSFJ 3VR9D 1IFJA 2E74D 4WBAA 3V5BA 2XKMA 2WS3D 1HJBA 1JO5A 1BSHA 1SFCD 1BCCG 1BDDA 4PD4D 3TGUG 1JY3O 1JY2P 2IYOA 1P84I 1KQFB 3VN0A 1MFTA 3AECC 2YNYA 3P4SC 1GU5A 1JNMA 4PV1D 1OVUA 3H1IG 1NTKJ 5KJ7C 3FWNA 1PPJE 2PP6A 3KPEA 3P4PD 2ZVOB 1FDMA 3T97B 1FZFA 2FKWB 1Y47A 3PRJA 1L0LE 5H2FE 3Q5PA 2BCCD 3GF3A 1EDJA 2FYUG 3FX0A 3PH0A 3AEED 2WSCJ 2L91A 2K88A 2POHA 3A3YB 2HR3A 4ZKPA 1NTKD 1KYOH 1LT1A 2N1TC 1M57D 3HTKB 1W2EA 1EZVG 4A7PA 4KX6D 3RK3E 1PL5A 4KT0J 4DZOA 2B76C 1LTAC 3H1LD 1FJPA 2Q5UA 2OYOA 1S2EA 2WDRD 1NU1G 1N7SB 1J1DB 4WY4A 2JEEA 3CC7P 3VR8C 2K1AA 3L71E 4OWFA 1JY3P 2QM7A 2CK3H 3P8MC 2KZJA 3M9HA 3CWBD 3VP8A 1SQBE 2WT7A 2HPCA 1AA0A 4RKUJ 3TYYA 1KD1Q 5L8RJ 5KAFE 1BDCA 1PGPA 1X0TA 4HYTB 3VOPA 2YMKA 4YXWH 2K37A 3M06A 3AEDC 5AVTB 5TJHA 3P4QC 3V4WA 2KUBA 2BS3C 1YTZI 4K3AA 3TF5A 4I2LC 4PJ0E 2KSJA 3HD7A 3VRAD 1AVOA 2ZFYA 2BS4C 2WSSH 3TSIA 3AE3C 3F5HA 4YTNC 3H1LJ 3RK2B 3MP7B 1PIXA 3P4SD 5AW9B 1HUCA 1Y8AA 2OARA 1X22A 3D6ZA 3H1ID 1IZNB 1WRGA 5C3JC 3AE9D 1KQSO 4RESB 2K3RA 3CXHD 2D2CD 2OTJP 2FYZA 1SQXK 1NTMD 3S9OA 4RJTA 4L75A 1VQKP 3A0HE 2IBZD 4DJGA 4YTND 2QG4A 1OFCX 1VQ4P 1XTGB 4BRYB 1VF5D 2WQYD 2BCCJ 3GLMA 4LLHA 2FYNC 2R5BA 3PHLA 1KILD 2A06D 1KF6D 3SFED 3TNUA 3I56P 4I6MC 2JDIH 1EZVI 1OX3A 1LTGC 3H1LE 3VRBC 4DHIB 3MD0A 1FZAA 5B66E 1RE4C 1FZCB 4O9BA 4AYCA 1JCCA 1CW5A 5APQA 3CC2P 1SFCB 2WDVC 2R3CA 1IFDA 1LT9B 2HG5D 1KYOI 2WDRC 1EDIA 3L73E 3L37A 2AXTH 3JC22 3L35A 1IFMA 1CI6A 1ZMEC 2ITAA 4NPFX 4DT0A 2YO2A 1PGOA 5BU5A 3HD7B 3L75G 1L0NG 3AE5C 1K73Q 3H1JG 2WTYA 3AE3D 4JYCA 3AEEC 3CI9A 4DHJA 3KHUA 1YITP 1SLQA 2IYPA 3D6YA 3MUDC 3CX5E 1TFFA 3BRVB 3FGAD 3G3ZA 4H13D 2V7QH 1KN7A 5AVSB 3KZIH 1RHZB 2KXPB 5GTHE 2K9JA 1FC2C 2KNCB 1NTZD 3AE8D 4WY4B 2W6BA 2OYHC 1EZVE 4YTMD 3M0AA 1UIXA 5AVRB 4YSXD 3V2RA 3SFDD 4DOJA 5KKZB 1KF6C 3H1HE 1Q81Q 4WY4C 2R44A 1SQPJ 1T2KC 2H89D 4UB8H 2OQQA 1SQXG 2OYIC 1HF9A 4GDOA 2O01N 3CX5I 3L70G 5APUA 4IL6H 3NMDA 5CBOA 1PPJG 1EDLA 5CCGD 1KZUB 1NTZJ 3B71A 4GKGA 3AE2C 2QJKB 2N1TD 1L0LG 3C9IA 2XNXA 4YXDC 1YQ3D 3C8VA 2O1KA 2V7QJ 1SQBJ 1BE3D 1KB9H 1OW7A 1P84E 2G8YA 3AE1D 1KTMA 1ZR2A 3BCCD 3A0BH 2OTKE 5APSA 1FU1A 4BWNA 2IBZG 1AQTA 3CMEP 1L0VC 3IR9A 4H13B 3P4RD 1L0ND 5CJ4A 3HE5B 1RQUA 1ZXGA 3L74D 2GUVA 3BVHA 2H7HA 4DDIA 3LIEA 1NYHA 1AQ5A 3AEAD 3S1KA 2H8PD 1FOSF 3RL0B 4IOIH 2L5GB 1FZGA 5KJ7D 2BEZF 3TGUJ 1GL2C 1K9MQ 1W5CE 4BRYA 2Y0CA 1NTZE 1WMKA 3GG2A 5BVZA 5AW2B 3SFDC 3A0BE 4YTMC 3WMM0 2JR8A 1NKNA 2W6JH 4JBZA 3PTZA 2J58A 2HPCB 1TU3F 1VQMP 3P7KA 4N78D 3VYIA 3P32A 4H44B 2FFDA 1E79H 1NTKE 3LW5H 3WU2E 3HE5A 3AE5D 2Y9ZA 3H1KE 2WP9C 3CMAP 3W68A 3P8CD 1KFNA 5AVWB 3EFFK 1BCCE 2KI7B 3L71D 1BGYD 1HWTC 2OYHA 1OXZA 4IL6E 3L73D 4GT1A 2E5YA 1N8RQ 4R4LA 1JY2N 3L74J 5KLVG 1KFYC 4PV1C 4EYYQ 3L72E 3RK3D 1VQ9P 1X79B 5DJTB 4C7NA 2FYUK 2BS2C 5KAIE 3RL0g 1FZEA 1IJDB 4B86A 4Y28J 2LKMA 5GTHH 2QJPB 2QE7H 3LW5J 3A2AA 3IN6A 2FXMA 1NU1D 1NTZK 3L73J 2XDJA 1HVVA 3H1JD 2ACZC 2MKVA 1GDTA 1GW3A 4JPZB 3AE1C 3SWFA 1JY3N 2W6AA 2AXCA 3KXDA 2KB7P 2ZT9C 2NRGA 1PP9G 2AXTE 1GD2E 1S5LX 5AW3B 5TISE 5KLVK 5DJUB 1X9VA 4W7YA 2XU6A 4H44D 5AVZB 1BE3J 1EXIA 2W27A 1RF1C 3IFMA 3BCCE 2O1JA 2H88D 3BRTB 3P8CE 1JCDA 2P7JA 2KZIA 3L70E 3V2PA 2JP3A 5APWA 1QEXA 5AW0B 3RBXA 1RE3A 1S3JA 2DW3A 4L73A 3MZWB 3CX5H 5CCHD 1NWQA 5GTIE 3VMYA 1OW6A 3MGNA 1Q7YQ 2XZRA 5CMZA 2ZFCA 2WMMA 4U3FE 4LC1A 3Q3DA 1DIPA 2KK7A 3CX5D 1NVOA 2W8ZA 3N7NA 2WZ7A 2ZAEB 3CXHH 4K35A 3H1HG 1YHQP 3CWBE 3M0DC 1JTHB 1LTSC 3TNUB 1RE4A 4Y99B 2PFXA 4U7JA 1SQXD 3AEDD 2HLOA 1RF0A 4YSYD 5GTIH 2NPSC 3SWKA 3L75J 1DH3A 2WT7B 4OGQC 2E5TA 3HUSB 3U1CA 1PFIA 2I8DA 2Y0DA 2E75C 3OA7A 1AV1A 1BGYJ 3OAKA 4PV1B 1N7LA 4XFJA 4H44C 4QMAA 3M9BA 3P4QD 2A45I 5AVQB 1S5LH 1YQ4D 2H88C 1MFZA 3AE8C 3L75D 3WUTA 1KB9D 3HRNA 1SQBK 3BCCJ 3A7OA 1MZ9A 2M3BA 2IX7C 3N4XA 3C1LA 1GW4A 5KLVE 3T97A 1CSBA 3R4YA 2GA1A 2R5DA 2E42A 2FY8A 1IC2A 1DEEG 5AW8B 3H1JE 3CCQP 3R2PA 5C3JD 2AEJA 3AE9C 3GHGA 4ZNCA 1J2JB 1KYOE 1SQPD 2WPSA 4EDFA 3RBZA 1SQVJ 2A06G 2M5AB 1VQ8P 4H0LD 2M3EA 2NPSB 4HJGH 5CJ0A 3I5CA 2QJYB 4GODA 2FFDC 3AE4D 2NPSA 1FS0E 2M5AA 1M90Q 5APVA 1X8YA 1ZW0A 1HBWA 4JYBA 1SQXE 3KDPB 4UB6E 3M0DA 3L72G 3NFQA 1LTTC 2ZYDA 1EQ7A 1FDIA 5KLIC 2QRXA 1AJYA 1YTZT 4DHZA 4H0LB 1IK9A 2WU5D 2WWWA 3TGUE 3ABVC 2Q9IA 3Q2YA 5AVXB 1NAYA 2QJPC 2MJZA 3H1KJ 4YSZD 2WDVD 1XTCC 2JWAA 2Q1KA 4LDTA 1OVVA 4YSYC 3V2QA 1Y9BA 3CL3D 4IFFA 1URQC 4IFDK 2K9YA 1JM0A 2RKLA 2OYIB 3EFGA 2KOGA 2IBZE 1EDKA 1U7JA 5KAIH 1NH4A 5AW6B 1BGYG 1KV4A 4TLFA 1QVFO 2IZ1A 3L74E 2Q6QA 3RK3B 3VONA 2CPSA 1L0NK 3V6IA 1MV8A 1YJ9P 1ZOYD 4H0LC 3SWYA 2P10A 4HB1A 2FBWD 3VP9A 2RMZA 2B88A 5CCHA 4GOFA 1KYOD 2KP8A 3H1HD 5EFWB 4OH8B 1NU1E 1KB9E 2B76D 3KQGA 1LTJA 2D2CB 1GZLA 1NTKG 2WSEH 3WU2H 1MUUA 1ZLLA 2QVAA 3WUVA 5K5GB 2H43A 1K8AQ 1SFCC 3E7KA 1GK4A 1L4AD 4YT0D 5CHXA 2E74C 4WWIA 1PGQA 1SP4A 3GHGB 1M1JA 2IFMA 5B5EE 4YTPC 3FWLA 1HGZA 3NTNA 1ZP0D 1EXJA 4YSZC 3HE4B 1GK6A 3AE2D 3L4FA 1KC8Q 1LTIC 3VMZA 3H1HJ 1L0LK 1PV3A 3GW6A 1FDOA 1NO4A 3AEFC 2CPBA 1AVYA 1QL2A 2FYUD 4DDGA 4Z1MH 4N78E 3RL0C 4HKZH 1PGJA 1BE3G 4WY4D 1K04A 5CCGC 1N73C 1H88A 4WVZA 4PD4I 2B9BA 1R5SA 2YXRB 3FXEA 1VQ5P 4PD4H 1KILE 2A06E 2FYNB 2JJLA 2Y0EA 1MKMA 2KLVA 4AQRD 1EC5A 2E76D 2QIWA 3ABVD 2WU5C 1N86A 3V4QA 1T3UA 3H1KD 1QLBC 2SPZA 3RK2C 4U3FD 3PJSK 4WB4A 4L74A 1OW8A 1FOSE 1SQVE 2WPVB 2ZYAA 3U59A 4C7NB 3H1IE 1QVGO 1LTJC 3CCUP 1T8ZA 1VF5C 1SVFA 1SQPK 1M56D 1NJIQ 1IK7A 3KZIE 1P84D 2NPSD 2HODB 1VQ7P 1JEKA 1ZRTD 1Z56A 1LP1B 3VMAA 1T3JA 1SQQE 1LT9A 1J1EB 1VQPP 1RF1A 3K5BA 3CIRC 1DX7A 1SFCA 2VRSA 3O6QB 2BCCE 1URQB 3MIWA 3TDKA 1L4AA 1VQOP 2C9NY 3IF4A 5CCHC 3AE6D 1FAVA 1NEKD 3MTUE 3BATA 3CXHE 2FFDB 3MUDA 1L2PA 3BASA 1A02J 3CCLP 3B8EB 4DCKA 4IFMA 2KYVA 4EIJA 5KLVJ 3L72D 5CBNA 1S5LE 2QEXP 2A45G 1SQVK 3RL0D 4H13C 2ZXXA 2KLUA 1DD3A 5B66H 3F89A 5APTA 4JQ0D 2KIKA 4D6TJ 2N1TA 3W67A 2Y9YA 3CXHI 3VRBD 5CCGA 1Q90D 2KSEA 2QSIA 1USEA 3G71P 1SQQK 1KILC 5AW7B 1T2KD 3E1RA 1HH0A 5AVVB 2R32A 1HJ0A 3B5NB 2Q7CA 5KAFH 1VF5B 1LP1A 2WITA 1VQ6P 4C46A 4D6TE 2A45H 1BGYE 3CCEP 2QJKC 1NTMG 3AEFD 3FXDA 5AW1B 5KJ7A 2E76C 3M91A 2H89C 2RH0A 1OIPA 2D2CC 1IFNA 2AEFA 3KYQA 1BCCD 1AFOA 2YMYA 3L36A 2BASA 3JSVC 1VQNP 1FZCC 5C2TD 3CCJP 2HYNA 1WT6A 3SFEC 4YPCA 2OYHB 3RK2D 1S9KD 2QA4P 2XNDH 1FZBA 2WVRA 2E75D 2QM8A 4EI2A 5H2FH 1IFPA 1BCCJ 3AEBC 1NEND 1BE3E 4FJVA 2C0XA 4CPGA 2KNCA 2IZ0A 4KX6C 2K9JB 1L0LJ 2NZ2A 3VTPC 3AEGD 2GUSA 4I7ZC 5B5EH 3L70D 3L71J 2ZVNB 5AVUB 1Q2NA 1VQLP 3H1IJ 2WS3C 4EOTA 4YSXC 2HFED 5E79E 2FXPA 4I1LA 1A02F 4PD4E 1OVRA 1H8AA 3G4SP 1SQQD 4JF7A 3Q5SA 3CCVP 3L73G 1U7MA 1CZQA 2IFNA 1KQLA 2OGUA 1CI6B 1S4XA 2WDQD 1LGHB 2Z5HA 2O01H 2M8RA 2PRRA 2YXQB 1RQVA 4KHXA 3H6PA 1S1CX 2Z4EA 1RF1B 1KILB 1S9KE 3GMAA 3AEAC 1OZHA 3S4RA 1LT9C 3P4RC 4YT0C 1YJNP 2BCCG 2GM4A 1Q82Q 5C39A 2Q3EA 1VPCA 3GHGC 3EWKA 3GF7A 2YKPA 3MHVA 1YBKA 3ZDMA 2LXCB 3RK3C 2J59M 5AW5B 2ZJSE 1EZVD 2ZXEB 3VR8D 4AUWA 1P84H 2W83C 5AW4B 1NTKK 1PZQA 1HTLC 3OJAB 2YIUC 3D71A 2E74B 2ZT9B 3AEBD 3M9QA 1M1JB 1KILA 3P4PC 1JY2O 2ACZD 1W2BO 2P2UA 1J1EC 3G6EP 1VL2A 1N2DC 1NKZB 2V4HA 2WSEJ 3RGUA 4N6JA 2WSCH 1RE3C 1FZCA 2JKVA 5M1BA 1KORA 3G9RA 1SQXJ 2IBZI 2ZYGA 3PLNA 1L0VD 1L4AC 1LTJB 1JMMA 1SQPE 2O3JA 3CCSP 1NTME 1FJKA 4L76A 1RF0C 2FYUE 5KKZC 3HE4A 1GMJA 4NPDA 4OVNF 1QL1A 3VMXA 1NENC 4W80A 1J1DC 1ZV8A 3B5NA 2ZT9D 2OTLP 2E75B 3II6A 4I6LA 3HUSC 1ZP0C 1NTZG 1N7SA 1N7SD 2I1KA 3EQ2A 3CCMP 5KLVD 3H1JJ 2YIUB 1FE6A 2N1TB 1YI2P 5E79H 1HGVA 3B5ND 4KJMA 4UB6H 3H1KG 2B87A 1R8EA 1NAFA 3A5TA 1T6AA 4UB8E 1GU4A 5APYA 1KB9I 1RH5B 2YKQA 2R3SA 2KS1A 1DD4A 4HH2A 5KLIB 1SQVG 3I55P 3VRAC 1SS1A 4M3LA 5APXA 1URQA 5C2TC 1LTBC 3O6QA 4N3YB 3H32B 2E43A 1SQVD 3OW2O 1SQQG 1Q86Q
chains in the Genus database with same CATH topology
4YXDD 3RL0g 1DIPA 2K9YA 3GMAA 1PV3A 3AEAC 3GF3A 5KKZC 1FDOA 1GMJA 3AE3D 3AEFC 1KQGB 4Y28J 3AEEC 1KFYD 3D6ZA 2WU2D 3AEED 2WSCJ 3H25A 5C3JD 1L0VC 3AE9C 4H13B 1NENC 3AE6D 2O01J 1ZRTE 3P4RD 5C2TD 5C3JC 3AE9D 3LW5J 3P4RC 4YT0C 1NEKD 1RQUA 4Z1MH 2D2CD 3IN6A 3D6YA 2ZT9D 3FGAD 4H13D 3AE7C 3SFEC 4OGQD 4KX6D 1NYHA 1K04A 1YQ3C 2E75B 3RK3E 3AEAD 1PL5A 2FBWC 3EWKA 4KT0J 4H0LC 1ZOYD 2P10A 3S9OA 2FBWD 3GF7A 4H0LD 2IDBA 2BEZF 2E75D 3IAOA 2B76C 2ACZC 1ZP0C 2MKVA 2WDQC 4U7JA 3AE8D 4TT3H 4YTND 2WU2C 3AE1C 1VF5D 2WDRD 1NEKC 3SFDC 1WMKA 4YTMD 3AEBC 3AE6C 2WQYC 1UIXA 1NEND 3AEDD 4YSXD 3SFDD 4R4MA 4YTMC 2WQYD 2G3AA 3AE4D 3GLMA 4YTPD 2FYNC 1KILE 4YSYD 1KF6C 1KMIZ 3VR8D 4KX6C 2ZT9C 1MKMA 1KF6D 3AEGC 4H13C 1TU3F 3SFED 4OGQC 3VR8C 2NZ2A 3AEGD 2E76D 1DD3A 1S5LX 1YQ4C 4I7ZC 2H89D 2QIWA 4I7ZB 2E75C 3D70A 2OQQA 1ZOYC 4H44B 2D2CB 4OGQB 4RKUJ 2B76D 4PV1B 2WSFJ 3ABVD 3VR9D 2E74D 5L8RJ 1HF9A 2WU5C 1R8EA 4XFJA 3AE5D 3VRBC 4GDOA 4H44C 1E7PC 2WP9D 2WS3D 3VRBD 2YIUC 4H44D 2YMKA 2WP9C 3D71A 1EXIA 2WS3C 2QJYC 1Q90D 3AE4C 2E74B 2ZT9B 3AEDC 3AEBD 4YSXC 1JB0J 3P4QC 1QLBC 1FDIA 2QSIA 5KLIC 3P4QD 2JO1A 2BEQD 2FXPA 1NGMB 1AJYA 1K05A 2BS3C 2H88D 1YQ4D 2H88C 1DD4A 3B71A 4H0LB 1OW8A 2J5UA 3Q1MA 2WDVC 3P4PC 3Q5SA 4YT0D 3AE2C 2WPVB 3AE8C 1OMIA 1KQFB 2ACZD 3VR9C 1HJ0A 2E74C 2WU5D 3AECD 3VRAC 3ABVC 2E76B 2JP3A 3AECC 4YXDC 4R4LA 1VL2A 3Q5RA 3VRAD 1VF5B 3P4SC 3CIRD 1VF5C 2WDRC 1U57A 3C8VA 4IL6X 3Q2YA 1YQ3D 2WSEJ 4PV1D 2BS4C 1KFYC 4PV1C 4YTPC 2QJKC 2V7QJ 1IK7A 2QJPC 3AE3C 5M1BA 2WDQD 3AEFD 4YTNC 1ZP0D 4YSZD 1OW7A 1EXJA 1KORA 1ZMEC 2G8YA 4YSZC 5C2TC 3G9RA 2E76C 1RQVA 3AE1D 1OW6A 1L0VD 2H89C 1KTMA 2WDVD 3O6QA 3P4PD 3AE2D 2D2CC 3T97B 1PIXA 3AE7D 1S1CX 4YSYC 3AE5C 1Y9BA 3P4SD 2BS2C 3CIRC 3R4YA 3Q3DA 3Q5PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YXD D;  1PV3 A;  3AEA C;  3AE3 D;  3AEF C;  3AEE C;  1KFY D;  2WU2 D;  3AEE D;  5C3J D;  1L0V C;  3AE9 C;  1NEN C;  3AE6 D;  3P4R D;  5C3J C;  5C2T D;  3AE9 D;  3P4R C;  4YT0 C;  1NEK D;  3SFE C;  3AE7 C;  4KX6 D;  1YQ3 C;  1K04 A;  3AEA D;  2FBW C;  1ZOY D;  3S9O A;  2FBW D;  2B76 C;  2WDQ C;  4YTN D;  2ACZ C;  1ZP0 C;  3AE8 D;  2WU2 C;  3AE1 C;  2WDR D;  1NEK C;  3SFD C;  4YTM D;  3AEB C;  3AE6 C;  2WQY C;  1NEN D;  3AED D;  4YSX D;  3SFD D;  4YTM C;  2WQY D;  2G3A A;  3AE4 D;  4YTP D;  4YSY D;  1KF6 C;  3VR8 D;  4KX6 C;  1KF6 D;  3AEG C;  3SFE D;  3VR8 C;  3AEG D;  1YQ4 C;  2H89 D;  2B76 D;  1ZOY C;  3ABV D;  3VR9 D;  2WU5 C;  3VRB C;  3AE5 D;  1E7P C;  2WP9 D;  2WS3 D;  3VRB D;  2WP9 C;  2WS3 C;  3AE4 C;  3AED C;  3AEB D;  4YSX C;  3P4Q C;  1QLB C;  3P4Q D;  1K05 A;  2BS3 C;  2H88 D;  1YQ4 D;  2H88 C;  3B71 A;  1OW8 A;  2WDV C;  3P4P C;  4YT0 D;  3VR9 C;  3AE2 C;  3AE8 C;  2ACZ D;  2WU5 D;  3AEC D;  3VRA C;  3ABV C;  4YXD C;  3AEC C;  3VRA D;  3P4S C;  3CIR D;  2WDR C;  1YQ3 D;  2BS4 C;  1KFY C;  4YTP C;  3AE3 C;  3AEF D;  2WDQ D;  4YTN C;  4YSZ D;  1ZP0 D;  1OW7 A;  4YSZ C;  5C2T C;  3AE1 D;  1OW6 A;  1L0V D;  2H89 C;  1KTM A;  2WDV D;  3P4P D;  3AE2 D;  3AE7 D;  4YSY C;  3AE5 C;  3P4S D;  2BS2 C;  3CIR C; 
#chains in the Genus database with same CATH topology
 4YXD D;  2YKO A;  1E5W A;  3A0H H;  1L0N J;  4U3F J;  1NU1 K;  2WU2 D;  1QGK B;  1LWU C;  1YIJ P;  2C0W A;  2LR2 A;  3NXS A;  3O8Z A;  3AE7 C;  4OGQ D;  1G1J A;  1YQ3 C;  3HUS A;  2PGD A;  3CWB J;  3CPW O;  2IDB A;  3IAO A;  1GTW A;  3HTK A;  4ZKU A;  1BSN A;  1GL2 A;  1NEK C;  3AE6 C;  1PP9 E;  4R4M A;  4YTP D;  3TGU D;  1KMI Z;  3WUU A;  4I7Z B;  3D70 A;  3H1L G;  3QH9 A;  3BCC G;  1OWA A;  2WPQ A;  1E7P C;  3B4S A;  2P58 A;  1M1K Q;  1LNQ A;  1L4A B;  2XV5 A;  3E1I A;  4GIF A;  2JO1 A;  1K05 A;  1R5L A;  1M1J C;  3Q1M A;  1IFI A;  3L71 G;  3VR9 C;  1UII A;  1SQB G;  2N9B A;  1L0L D;  2Z5I A;  2E76 B;  4ASW A;  3Q5R A;  1U57 A;  4Y99 C;  2HOD A;  1G2C A;  1PPJ D;  5TIS H;  4D6T G;  3B5N C;  1G1I A;  3L75 E;  1L0N E;  4U3F G;  4GOE A;  1PP9 J;  1USD A;  3SSU A;  1SQQ J;  5AVY B;  3CCR P;  3CD6 P;  1KQG B;  2LXB A;  4ZMD A;  4W7Z A;  3H25 A;  1LJ2 A;  2JWD A;  3CWB G;  3USS A;  1GL2 B;  1SQP G;  1S72 P;  1ZRT E;  2UWJ E;  4RO0 A;  3U1A A;  1RY3 A;  4C7R A;  4ASV A;  2P67 A;  1D7M A;  3L70 J;  3TK1 A;  1NHL A;  3L74 G;  2PAJ A;  1JUN A;  1GL2 D;  4PJ0 H;  1YYC A;  2WU2 C;  1QLE D;  1N7S C;  1YJW P;  1KFM A;  4BXL A;  2IPP A;  1ZN5 A;  2M0B A;  2FXO A;  1PP9 D;  1LWU A;  1YQ4 C;  3HD7 D;  1ZOY C;  5BU8 B;  1SQB D;  2WP9 D;  3L72 J;  2QJY C;  3AE4 C;  1JB0 J;  1JOC A;  1ZR4 A;  3CC4 P;  1NGM B;  2BEQ D;  4XA4 A;  3LID A;  2J5U A;  1JTH A;  1OMI A;  3AEC D;  1URQ D;  1IO4 A;  3CIR D;  4IL6 X;  1JMB A;  3UIA A;  3JCU E;  2WSF H;  1G2C B;  5KTB A;  3QWO C;  2OYI A;  2B89 A;  2B87 B;  1DEB A;  2Q3I A;  2AEM A;  1NTM J;  3AE7 D;  1NOH A;  1NU1 J;  1M7L A;  3H32 A;  2W90 A;  3V2N A;  3PP5 A;  1KFY D;  2I1J A;  2O01 J;  1M8O B;  2RN0 A;  1NTM K;  4LGD E;  4XE5 B;  2N9Y B;  4D6T D;  2KS1 B;  2FBW C;  1N73 A;  4MN4 C;  2WDQ C;  2YO3 A;  1H0T B;  4TT3 H;  2FYU J;  1H89 A;  2C9L Y;  2WQY C;  4NPE A;  1H0T A;  1VDF A;  2G3A A;  3ITK A;  1N73 B;  1FBM A;  3CLQ A;  3AEG C;  1LWU B;  3JCU H;  2WPR A;  2P1J A;  4OGQ B;  3HD7 C;  1QX8 A;  2WSF J;  3VR9 D;  1IFJ A;  2E74 D;  4WBA A;  3V5B A;  2XKM A;  2WS3 D;  1HJB A;  1JO5 A;  1BSH A;  1SFC D;  1BCC G;  1BDD A;  4PD4 D;  3TGU G;  1JY3 O;  1JY2 P;  2IYO A;  1P84 I;  1KQF B;  3VN0 A;  1MFT A;  3AEC C;  2YNY A;  3P4S C;  1GU5 A;  1JNM A;  4PV1 D;  1OVU A;  3H1I G;  1NTK J;  5KJ7 C;  3FWN A;  1PPJ E;  2PP6 A;  3KPE A;  3P4P D;  2ZVO B;  1FDM A;  3T97 B;  1FZF A;  2FKW B;  1Y47 A;  3PRJ A;  1L0L E;  5H2F E;  3Q5P A;  2BCC D;  3GF3 A;  1EDJ A;  2FYU G;  3FX0 A;  3PH0 A;  3AEE D;  2WSC J;  2L91 A;  2K88 A;  2POH A;  3A3Y B;  2HR3 A;  4ZKP A;  1NTK D;  1KYO H;  1LT1 A;  2N1T C;  1M57 D;  3HTK B;  1W2E A;  1EZV G;  4A7P A;  4KX6 D;  3RK3 E;  1PL5 A;  4KT0 J;  4DZO A;  2B76 C;  1LTA C;  3H1L D;  1FJP A;  2Q5U A;  2OYO A;  1S2E A;  2WDR D;  1NU1 G;  1N7S B;  1J1D B;  4WY4 A;  2JEE A;  3CC7 P;  3VR8 C;  2K1A A;  3L71 E;  4OWF A;  1JY3 P;  2QM7 A;  2CK3 H;  3P8M C;  2KZJ A;  3M9H A;  3CWB D;  3VP8 A;  1SQB E;  2WT7 A;  2HPC A;  1AA0 A;  4RKU J;  3TYY A;  1KD1 Q;  5L8R J;  5KAF E;  1BDC A;  1PGP A;  1X0T A;  4HYT B;  3VOP A;  2YMK A;  4YXW H;  2K37 A;  3M06 A;  3AED C;  5AVT B;  5TJH A;  3P4Q C;  3V4W A;  2KUB A;  2BS3 C;  1YTZ I;  4K3A A;  3TF5 A;  4I2L C;  4PJ0 E;  2KSJ A;  3HD7 A;  3VRA D;  1AVO A;  2ZFY A;  2BS4 C;  2WSS H;  3TSI A;  3AE3 C;  3F5H A;  4YTN C;  3H1L J;  3RK2 B;  3MP7 B;  1PIX A;  3P4S D;  5AW9 B;  1HUC A;  1Y8A A;  2OAR A;  1X22 A;  3D6Z A;  3H1I D;  1IZN B;  1WRG A;  5C3J C;  3AE9 D;  1KQS O;  4RES B;  2K3R A;  3CXH D;  2D2C D;  2OTJ P;  2FYZ A;  1SQX K;  1NTM D;  3S9O A;  4RJT A;  4L75 A;  1VQK P;  3A0H E;  2IBZ D;  4DJG A;  4YTN D;  2QG4 A;  1OFC X;  1VQ4 P;  1XTG B;  4BRY B;  1VF5 D;  2WQY D;  2BCC J;  3GLM A;  4LLH A;  2FYN C;  2R5B A;  3PHL A;  1KIL D;  2A06 D;  1KF6 D;  3SFE D;  3TNU A;  3I56 P;  4I6M C;  2JDI H;  1EZV I;  1OX3 A;  1LTG C;  3H1L E;  3VRB C;  4DHI B;  3MD0 A;  1FZA A;  5B66 E;  1RE4 C;  1FZC B;  4O9B A;  4AYC A;  1JCC A;  1CW5 A;  5APQ A;  3CC2 P;  1SFC B;  2WDV C;  2R3C A;  1IFD A;  1LT9 B;  2HG5 D;  1KYO I;  2WDR C;  1EDI A;  3L73 E;  3L37 A;  2AXT H;  3JC2 2;  3L35 A;  1IFM A;  1CI6 A;  1ZME C;  2ITA A;  4NPF X;  4DT0 A;  2YO2 A;  1PGO A;  5BU5 A;  3HD7 B;  3L75 G;  1L0N G;  3AE5 C;  1K73 Q;  3H1J G;  2WTY A;  3AE3 D;  4JYC A;  3AEE C;  3CI9 A;  4DHJ A;  3KHU A;  1YIT P;  1SLQ A;  2IYP A;  3D6Y A;  3MUD C;  3CX5 E;  1TFF A;  3BRV B;  3FGA D;  3G3Z A;  4H13 D;  2V7Q H;  1KN7 A;  5AVS B;  3KZI H;  1RHZ B;  2KXP B;  5GTH E;  2K9J A;  1FC2 C;  2KNC B;  1NTZ D;  3AE8 D;  4WY4 B;  2W6B A;  2OYH C;  1EZV E;  4YTM D;  3M0A A;  1UIX A;  5AVR B;  4YSX D;  3V2R A;  3SFD D;  4DOJ A;  5KKZ B;  1KF6 C;  3H1H E;  1Q81 Q;  4WY4 C;  2R44 A;  1SQP J;  1T2K C;  2H89 D;  4UB8 H;  2OQQ A;  1SQX G;  2OYI C;  1HF9 A;  4GDO A;  2O01 N;  3CX5 I;  3L70 G;  5APU A;  4IL6 H;  3NMD A;  5CBO A;  1PPJ G;  1EDL A;  5CCG D;  1KZU B;  1NTZ J;  3B71 A;  4GKG A;  3AE2 C;  2QJK B;  2N1T D;  1L0L G;  3C9I A;  2XNX A;  4YXD C;  1YQ3 D;  3C8V A;  2O1K A;  2V7Q J;  1SQB J;  1BE3 D;  1KB9 H;  1OW7 A;  1P84 E;  2G8Y A;  3AE1 D;  1KTM A;  1ZR2 A;  3BCC D;  3A0B H;  2OTK E;  5APS A;  1FU1 A;  4BWN A;  2IBZ G;  1AQT A;  3CME P;  1L0V C;  3IR9 A;  4H13 B;  3P4R D;  1L0N D;  5CJ4 A;  3HE5 B;  1RQU A;  1ZXG A;  3L74 D;  2GUV A;  3BVH A;  2H7H A;  4DDI A;  3LIE A;  1NYH A;  1AQ5 A;  3AEA D;  3S1K A;  2H8P D;  1FOS F;  3RL0 B;  4IOI H;  2L5G B;  1FZG A;  5KJ7 D;  2BEZ F;  3TGU J;  1GL2 C;  1K9M Q;  1W5C E;  4BRY A;  2Y0C A;  1NTZ E;  1WMK A;  3GG2 A;  5BVZ A;  5AW2 B;  3SFD C;  3A0B E;  4YTM C;  3WMM 0;  2JR8 A;  1NKN A;  2W6J H;  4JBZ A;  3PTZ A;  2J58 A;  2HPC B;  1TU3 F;  1VQM P;  3P7K A;  4N78 D;  3VYI A;  3P32 A;  4H44 B;  2FFD A;  1E79 H;  1NTK E;  3LW5 H;  3WU2 E;  3HE5 A;  3AE5 D;  2Y9Z A;  3H1K E;  2WP9 C;  3CMA P;  3W68 A;  3P8C D;  1KFN A;  5AVW B;  3EFF K;  1BCC E;  2KI7 B;  3L71 D;  1BGY D;  1HWT C;  2OYH A;  1OXZ A;  4IL6 E;  3L73 D;  4GT1 A;  2E5Y A;  1N8R Q;  4R4L A;  1JY2 N;  3L74 J;  5KLV G;  1KFY C;  4PV1 C;  4EYY Q;  3L72 E;  3RK3 D;  1VQ9 P;  1X79 B;  5DJT B;  4C7N A;  2FYU K;  2BS2 C;  5KAI E;  3RL0 g;  1FZE A;  1IJD B;  4B86 A;  4Y28 J;  2LKM A;  5GTH H;  2QJP B;  2QE7 H;  3LW5 J;  3A2A A;  3IN6 A;  2FXM A;  1NU1 D;  1NTZ K;  3L73 J;  2XDJ A;  1HVV A;  3H1J D;  2ACZ C;  2MKV A;  1GDT A;  1GW3 A;  4JPZ B;  3AE1 C;  3SWF A;  1JY3 N;  2W6A A;  2AXC A;  3KXD A;  2KB7 P;  2ZT9 C;  2NRG A;  1PP9 G;  2AXT E;  1GD2 E;  1S5L X;  5AW3 B;  5TIS E;  5KLV K;  5DJU B;  1X9V A;  4W7Y A;  2XU6 A;  4H44 D;  5AVZ B;  1BE3 J;  1EXI A;  2W27 A;  1RF1 C;  3IFM A;  3BCC E;  2O1J A;  2H88 D;  3BRT B;  3P8C E;  1JCD A;  2P7J A;  2KZI A;  3L70 E;  3V2P A;  2JP3 A;  5APW A;  1QEX A;  5AW0 B;  3RBX A;  1RE3 A;  1S3J A;  2DW3 A;  4L73 A;  3MZW B;  3CX5 H;  5CCH D;  1NWQ A;  5GTI E;  3VMY A;  1OW6 A;  3MGN A;  1Q7Y Q;  2XZR A;  5CMZ A;  2ZFC A;  2WMM A;  4U3F E;  4LC1 A;  3Q3D A;  1DIP A;  2KK7 A;  3CX5 D;  1NVO A;  2W8Z A;  3N7N A;  2WZ7 A;  2ZAE B;  3CXH H;  4K35 A;  3H1H G;  1YHQ P;  3CWB E;  3M0D C;  1JTH B;  1LTS C;  3TNU B;  1RE4 A;  4Y99 B;  2PFX A;  4U7J A;  1SQX D;  3AED D;  2HLO A;  1RF0 A;  4YSY D;  5GTI H;  2NPS C;  3SWK A;  3L75 J;  1DH3 A;  2WT7 B;  4OGQ C;  2E5T A;  3HUS B;  3U1C A;  1PFI A;  2I8D A;  2Y0D A;  2E75 C;  3OA7 A;  1AV1 A;  1BGY J;  3OAK A;  4PV1 B;  1N7L A;  4XFJ A;  4H44 C;  4QMA A;  3M9B A;  3P4Q D;  2A45 I;  5AVQ B;  1S5L H;  1YQ4 D;  2H88 C;  1MFZ A;  3AE8 C;  3L75 D;  3WUT A;  1KB9 D;  3HRN A;  1SQB K;  3BCC J;  3A7O A;  1MZ9 A;  2M3B A;  2IX7 C;  3N4X A;  3C1L A;  1GW4 A;  5KLV E;  3T97 A;  1CSB A;  3R4Y A;  2GA1 A;  2R5D A;  2E42 A;  2FY8 A;  1IC2 A;  1DEE G;  5AW8 B;  3H1J E;  3CCQ P;  3R2P A;  5C3J D;  2AEJ A;  3AE9 C;  3GHG A;  4ZNC A;  1J2J B;  1KYO E;  1SQP D;  2WPS A;  4EDF A;  3RBZ A;  1SQV J;  2A06 G;  2M5A B;  1VQ8 P;  4H0L D;  2M3E A;  2NPS B;  4HJG H;  5CJ0 A;  3I5C A;  2QJY B;  4GOD A;  2FFD C;  3AE4 D;  2NPS A;  1FS0 E;  2M5A A;  1M90 Q;  5APV A;  1X8Y A;  1ZW0 A;  1HBW A;  4JYB A;  1SQX E;  3KDP B;  4UB6 E;  3M0D A;  3L72 G;  3NFQ A;  1LTT C;  2ZYD A;  1EQ7 A;  1FDI A;  5KLI C;  2QRX A;  1AJY A;  1YTZ T;  4DHZ A;  4H0L B;  1IK9 A;  2WU5 D;  2WWW A;  3TGU E;  3ABV C;  2Q9I A;  3Q2Y A;  5AVX B;  1NAY A;  2QJP C;  2MJZ A;  3H1K J;  4YSZ D;  2WDV D;  1XTC C;  2JWA A;  2Q1K A;  4LDT A;  1OVV A;  4YSY C;  3V2Q A;  1Y9B A;  3CL3 D;  4IFF A;  1URQ C;  4IFD K;  2K9Y A;  1JM0 A;  2RKL A;  2OYI B;  3EFG A;  2KOG A;  2IBZ E;  1EDK A;  1U7J A;  5KAI H;  1NH4 A;  5AW6 B;  1BGY G;  1KV4 A;  4TLF A;  1QVF O;  2IZ1 A;  3L74 E;  2Q6Q A;  3RK3 B;  3VON A;  2CPS A;  1L0N K;  3V6I A;  1MV8 A;  1YJ9 P;  1ZOY D;  4H0L C;  3SWY A;  2P10 A;  4HB1 A;  2FBW D;  3VP9 A;  2RMZ A;  2B88 A;  5CCH A;  4GOF A;  1KYO D;  2KP8 A;  3H1H D;  5EFW B;  4OH8 B;  1NU1 E;  1KB9 E;  2B76 D;  3KQG A;  1LTJ A;  2D2C B;  1GZL A;  1NTK G;  2WSE H;  3WU2 H;  1MUU A;  1ZLL A;  2QVA A;  3WUV A;  5K5G B;  2H43 A;  1K8A Q;  1SFC C;  3E7K A;  1GK4 A;  1L4A D;  4YT0 D;  5CHX A;  2E74 C;  4WWI A;  1PGQ A;  1SP4 A;  3GHG B;  1M1J A;  2IFM A;  5B5E E;  4YTP C;  3FWL A;  1HGZ A;  3NTN A;  1ZP0 D;  1EXJ A;  4YSZ C;  3HE4 B;  1GK6 A;  3AE2 D;  3L4F A;  1KC8 Q;  1LTI C;  3VMZ A;  3H1H J;  1L0L K;  1PV3 A;  3GW6 A;  1FDO A;  1NO4 A;  3AEF C;  2CPB A;  1AVY A;  1QL2 A;  2FYU D;  4DDG A;  4Z1M H;  4N78 E;  3RL0 C;  4HKZ H;  1PGJ A;  1BE3 G;  4WY4 D;  1K04 A;  5CCG C;  1N73 C;  1H88 A;  4WVZ A;  4PD4 I;  2B9B A;  1R5S A;  2YXR B;  3FXE A;  1VQ5 P;  4PD4 H;  1KIL E;  2A06 E;  2FYN B;  2JJL A;  2Y0E A;  1MKM A;  2KLV A;  4AQR D;  1EC5 A;  2E76 D;  2QIW A;  3ABV D;  2WU5 C;  1N86 A;  3V4Q A;  1T3U A;  3H1K D;  1QLB C;  2SPZ A;  3RK2 C;  4U3F D;  3PJS K;  4WB4 A;  4L74 A;  1OW8 A;  1FOS E;  1SQV E;  2WPV B;  2ZYA A;  3U59 A;  4C7N B;  3H1I E;  1QVG O;  1LTJ C;  3CCU P;  1T8Z A;  1VF5 C;  1SVF A;  1SQP K;  1M56 D;  1NJI Q;  1IK7 A;  3KZI E;  1P84 D;  2NPS D;  2HOD B;  1VQ7 P;  1JEK A;  1ZRT D;  1Z56 A;  1LP1 B;  3VMA A;  1T3J A;  1SQQ E;  1LT9 A;  1J1E B;  1VQP P;  1RF1 A;  3K5B A;  3CIR C;  1DX7 A;  1SFC A;  2VRS A;  3O6Q B;  2BCC E;  1URQ B;  3MIW A;  3TDK A;  1L4A A;  1VQO P;  2C9N Y;  3IF4 A;  5CCH C;  3AE6 D;  1FAV A;  1NEK D;  3MTU E;  3BAT A;  3CXH E;  2FFD B;  3MUD A;  1L2P A;  3BAS A;  1A02 J;  3CCL P;  3B8E B;  4DCK A;  4IFM A;  2KYV A;  4EIJ A;  5KLV J;  3L72 D;  5CBN A;  1S5L E;  2QEX P;  2A45 G;  1SQV K;  3RL0 D;  4H13 C;  2ZXX A;  2KLU A;  1DD3 A;  5B66 H;  3F89 A;  5APT A;  4JQ0 D;  2KIK A;  4D6T J;  2N1T A;  3W67 A;  2Y9Y A;  3CXH I;  3VRB D;  5CCG A;  1Q90 D;  2KSE A;  2QSI A;  1USE A;  3G71 P;  1SQQ K;  1KIL C;  5AW7 B;  1T2K D;  3E1R A;  1HH0 A;  5AVV B;  2R32 A;  1HJ0 A;  3B5N B;  2Q7C A;  5KAF H;  1VF5 B;  1LP1 A;  2WIT A;  1VQ6 P;  4C46 A;  4D6T E;  2A45 H;  1BGY E;  3CCE P;  2QJK C;  1NTM G;  3AEF D;  3FXD A;  5AW1 B;  5KJ7 A;  2E76 C;  3M91 A;  2H89 C;  2RH0 A;  1OIP A;  2D2C C;  1IFN A;  2AEF A;  3KYQ A;  1BCC D;  1AFO A;  2YMY A;  3L36 A;  2BAS A;  3JSV C;  1VQN P;  1FZC C;  5C2T D;  3CCJ P;  2HYN A;  1WT6 A;  3SFE C;  4YPC A;  2OYH B;  3RK2 D;  1S9K D;  2QA4 P;  2XND H;  1FZB A;  2WVR A;  2E75 D;  2QM8 A;  4EI2 A;  5H2F H;  1IFP A;  1BCC J;  3AEB C;  1NEN D;  1BE3 E;  4FJV A;  2C0X A;  4CPG A;  2KNC A;  2IZ0 A;  4KX6 C;  2K9J B;  1L0L J;  2NZ2 A;  3VTP C;  3AEG D;  2GUS A;  4I7Z C;  5B5E H;  3L70 D;  3L71 J;  2ZVN B;  5AVU B;  1Q2N A;  1VQL P;  3H1I J;  2WS3 C;  4EOT A;  4YSX C;  2HFE D;  5E79 E;  2FXP A;  4I1L A;  1A02 F;  4PD4 E;  1OVR A;  1H8A A;  3G4S P;  1SQQ D;  4JF7 A;  3Q5S A;  3CCV P;  3L73 G;  1U7M A;  1CZQ A;  2IFN A;  1KQL A;  2OGU A;  1CI6 B;  1S4X A;  2WDQ D;  1LGH B;  2Z5H A;  2O01 H;  2M8R A;  2PRR A;  2YXQ B;  1RQV A;  4KHX A;  3H6P A;  1S1C X;  2Z4E A;  1RF1 B;  1KIL B;  1S9K E;  3GMA A;  3AEA C;  1OZH A;  3S4R A;  1LT9 C;  3P4R C;  4YT0 C;  1YJN P;  2BCC G;  2GM4 A;  1Q82 Q;  5C39 A;  2Q3E A;  1VPC A;  3GHG C;  3EWK A;  3GF7 A;  2YKP A;  3MHV A;  1YBK A;  3ZDM A;  2LXC B;  3RK3 C;  2J59 M;  5AW5 B;  2ZJS E;  1EZV D;  2ZXE B;  3VR8 D;  4AUW A;  1P84 H;  2W83 C;  5AW4 B;  1NTK K;  1PZQ A;  1HTL C;  3OJA B;  2YIU C;  3D71 A;  2E74 B;  2ZT9 B;  3AEB D;  3M9Q A;  1M1J B;  1KIL A;  3P4P C;  1JY2 O;  2ACZ D;  1W2B O;  2P2U A;  1J1E C;  3G6E P;  1VL2 A;  1N2D C;  1NKZ B;  2V4H A;  2WSE J;  3RGU A;  4N6J A;  2WSC H;  1RE3 C;  1FZC A;  2JKV A;  5M1B A;  1KOR A;  3G9R A;  1SQX J;  2IBZ I;  2ZYG A;  3PLN A;  1L0V D;  1L4A C;  1LTJ B;  1JMM A;  1SQP E;  2O3J A;  3CCS P;  1NTM E;  1FJK A;  4L76 A;  1RF0 C;  2FYU E;  5KKZ C;  3HE4 A;  1GMJ A;  4NPD A;  4OVN F;  1QL1 A;  3VMX A;  1NEN C;  4W80 A;  1J1D C;  1ZV8 A;  3B5N A;  2ZT9 D;  2OTL P;  2E75 B;  3II6 A;  4I6L A;  3HUS C;  1ZP0 C;  1NTZ G;  1N7S A;  1N7S D;  2I1K A;  3EQ2 A;  3CCM P;  5KLV D;  3H1J J;  2YIU B;  1FE6 A;  2N1T B;  1YI2 P;  5E79 H;  1HGV A;  3B5N D;  4KJM A;  4UB6 H;  3H1K G;  2B87 A;  1R8E A;  1NAF A;  3A5T A;  1T6A A;  4UB8 E;  1GU4 A;  5APY A;  1KB9 I;  1RH5 B;  2YKQ A;  2R3S A;  2KS1 A;  1DD4 A;  4HH2 A;  5KLI B;  1SQV G;  3I55 P;  3VRA C;  1SS1 A;  4M3L A;  5APX A;  1URQ A;  5C2T C;  1LTB C;  3O6Q A;  4N3Y B;  3H32 B;  2E43 A;  1SQV D;  3OW2 O;  1SQQ G;  1Q86 Q; 
#chains in the Genus database with same CATH homology
 4YXD D;  3RL0 g;  1DIP A;  2K9Y A;  3GMA A;  1PV3 A;  3AEA C;  3GF3 A;  5KKZ C;  1FDO A;  1GMJ A;  3AE3 D;  3AEF C;  1KQG B;  4Y28 J;  3AEE C;  1KFY D;  3D6Z A;  2WU2 D;  3AEE D;  2WSC J;  3H25 A;  5C3J D;  1L0V C;  3AE9 C;  4H13 B;  1NEN C;  3AE6 D;  2O01 J;  1ZRT E;  3P4R D;  5C2T D;  5C3J C;  3AE9 D;  3LW5 J;  3P4R C;  4YT0 C;  1NEK D;  1RQU A;  4Z1M H;  2D2C D;  3IN6 A;  3D6Y A;  2ZT9 D;  3FGA D;  4H13 D;  3AE7 C;  3SFE C;  4OGQ D;  4KX6 D;  1NYH A;  1K04 A;  1YQ3 C;  2E75 B;  3RK3 E;  3AEA D;  1PL5 A;  2FBW C;  3EWK A;  4KT0 J;  4H0L C;  1ZOY D;  2P10 A;  3S9O A;  2FBW D;  3GF7 A;  4H0L D;  2IDB A;  2BEZ F;  2E75 D;  3IAO A;  2B76 C;  2ACZ C;  1ZP0 C;  2MKV A;  2WDQ C;  4U7J A;  3AE8 D;  4TT3 H;  4YTN D;  2WU2 C;  3AE1 C;  1VF5 D;  2WDR D;  1NEK C;  3SFD C;  1WMK A;  4YTM D;  3AEB C;  3AE6 C;  2WQY C;  1UIX A;  1NEN D;  3AED D;  4YSX D;  3SFD D;  4R4M A;  4YTM C;  2WQY D;  2G3A A;  3AE4 D;  3GLM A;  4YTP D;  2FYN C;  1KIL E;  4YSY D;  1KF6 C;  1KMI Z;  3VR8 D;  4KX6 C;  2ZT9 C;  1MKM A;  1KF6 D;  3AEG C;  4H13 C;  1TU3 F;  3SFE D;  4OGQ C;  3VR8 C;  2NZ2 A;  3AEG D;  2E76 D;  1DD3 A;  1S5L X;  1YQ4 C;  4I7Z C;  2H89 D;  2QIW A;  4I7Z B;  2E75 C;  3D70 A;  2OQQ A;  1ZOY C;  4H44 B;  2D2C B;  4OGQ B;  4RKU J;  2B76 D;  4PV1 B;  2WSF J;  3ABV D;  3VR9 D;  2E74 D;  5L8R J;  1HF9 A;  2WU5 C;  1R8E A;  4XFJ A;  3AE5 D;  3VRB C;  4GDO A;  4H44 C;  1E7P C;  2WP9 D;  2WS3 D;  3VRB D;  2YIU C;  4H44 D;  2YMK A;  2WP9 C;  3D71 A;  1EXI A;  2WS3 C;  2QJY C;  1Q90 D;  3AE4 C;  2E74 B;  2ZT9 B;  3AED C;  3AEB D;  4YSX C;  1JB0 J;  3P4Q C;  1QLB C;  1FDI A;  2QSI A;  5KLI C;  3P4Q D;  2JO1 A;  2BEQ D;  2FXP A;  1NGM B;  1AJY A;  1K05 A;  2BS3 C;  2H88 D;  1YQ4 D;  2H88 C;  1DD4 A;  3B71 A;  4H0L B;  1OW8 A;  2J5U A;  3Q1M A;  2WDV C;  3P4P C;  3Q5S A;  4YT0 D;  3AE2 C;  2WPV B;  3AE8 C;  1OMI A;  1KQF B;  2ACZ D;  3VR9 C;  1HJ0 A;  2E74 C;  2WU5 D;  3AEC D;  3VRA C;  3ABV C;  2E76 B;  2JP3 A;  3AEC C;  4YXD C;  4R4L A;  1VL2 A;  3Q5R A;  3VRA D;  1VF5 B;  3P4S C;  3CIR D;  1VF5 C;  2WDR C;  1U57 A;  3C8V A;  4IL6 X;  3Q2Y A;  1YQ3 D;  2WSE J;  4PV1 D;  2BS4 C;  1KFY C;  4PV1 C;  4YTP C;  2QJK C;  2V7Q J;  1IK7 A;  2QJP C;  3AE3 C;  5M1B A;  2WDQ D;  3AEF D;  4YTN C;  1ZP0 D;  4YSZ D;  1OW7 A;  1EXJ A;  1KOR A;  1ZME C;  2G8Y A;  4YSZ C;  5C2T C;  3G9R A;  2E76 C;  1RQV A;  3AE1 D;  1OW6 A;  1L0V D;  2H89 C;  1KTM A;  2WDV D;  3O6Q A;  3P4P D;  3AE2 D;  2D2C C;  3T97 B;  1PIX A;  3AE7 D;  1S1C X;  4YSY C;  3AE5 C;  1Y9B A;  3P4S D;  2BS2 C;  3CIR C;  3R4Y A;  3Q3D A;  3Q5P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...