3SFEC

Crystal structure of porcine mitochondrial respiratory complex ii bound with oxaloacetate and thiabendazole
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
139
structure length
139
Chain Sequence
b'GTTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
molecule tags Oxidoreductase
publication title Thiabendazole inhibits ubiquinone reduction activity of mitochondrial respiratory complex II via a water molecule mediated binding feature.
pubmed doi rcsb
total genus 47
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2011-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3sfeC01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3sfeC02
2WP9C 1ZP0C 3P4SC 1NENC 3AE7C 1L0VD 4YTNC 1KFYC 3AE8D 3P4PD 1YQ4D 2WDQD 2WU5C 4YT0C 3SFDD 4KX6C 3AE1D 2WU2D 1OW6A 3AE5C 3AEDD 3VR8D 1ZOYC 1NEND 5C3JC 3AEGD 3P4QD 3VRAD 2FBWC 1YQ3D 2WS3D 4YSXD 2B76D 2H89C 2ACZD 4YTPD 2WQYC 4YTPC 1KTMA 4YSXC 3AE6C 4YXDD 3AEFD 2WDQC 2WU5D 3AEAD 3CIRC 4YTMD 4YSYC 2WDVC 3VR9C 2FBWD 3P4RC 5C3JD 1PV3A 1NEKD 5C2TD 3VRBD 3CIRD 4YSYD 4YTMC 3AE1C 2WU2C 1YQ4C 3SFDC 4YT0D 2G3AA 2WQYD 3AE8C 3ABVC 2ACZC 3P4PC 1L0VC 2H89D 3AE9D 4YTND 1KF6C 1ZP0D 3P4SD 2WP9D 3P4RD 3AEED 3B71A 3AEEC 1QLBC 3P4QC 3VRAC 1K05A 3AE3C 1OW7A 3AEFC 1OW8A 3AEBC 1KF6D 3AE4C 3ABVD 3AEDC 3SFED 3AE5D 3AE2C 3AE2D 4YSZD 1KFYD 3VRBC 1NEKC 2BS4C 2H88D 3AE7D 1K04A 1ZOYD 2WDRD 3AE3D 2H88C 2WDVD 3VR9D 3VR8C 3AEAC 4YSZC 4KX6D 1E7PC 3AE6D 3AECC 3S9OA 4YXDC 3AE9C 2BS2C 3SFEC 3AE4D 2B76C 3AECD 3AEBD 2BS3C 1YQ3C 2WS3C 5C2TC 3AEGC 2WDRC
chains in the Genus database with same CATH superfamily
2JP3A 3AE7C 1JEKA 4NPEA 1NTME 3L72D 2ZAEB 3G3ZA 1J1EC 3CX5D 5APTA 3CCSP 2ZVOB 5C3JC 3PH0A 2FYZA 2PFXA 5AVVB 2W8ZA 3GMAA 4H13C 1NTMD 2HYNA 2B76D 3H1KG 2I8DA 1KTMA 1X9VA 4YSXC 3AE6C 1AVYA 2IDBA 1BGYG 2QJYC 1KB9E 4OH8B 4ZMDA 3R2PA 2ZYAA 1Q90D 1Q7YQ 3ITKA 3PTZA 1IK7A 1LT9B 1NU1D 4N78E 4HYTB 4YTND 3TGUJ 3GHGB 2O1JA 4Y99C 1IK9A 1SQBK 3D71A 5APSA 2Q7CA 1SFCC 2KNCA 4I7ZC 4Y28J 2E76B 5KLVJ 3N7NA 4UB6E 2IBZE 1KYOD 1YBKA 1VL2A 3W67A 2FKWB 1FOSE 1R5LA 2K9JB 3AEAC 4K3AA 2LR2A 1FC2C 3CCJP 3RL0C 1JO5A 1HGVA 1AVOA 4OGQC 4IL6H 3H1HE 1J1EB 3HTKB 1PGQA 2AXCA 1HH0A 5KLIB 5H2FE 3OAKA 2HPCB 1BE3G 3H1JD 3LW5H 2P7JA 1JUNA 2BCCD 1URQD 2H7HA 2NRGA 1H0TB 1SQBJ 2KXPB 1GU4A 3GLMA 1BCCJ 3L4FA 2YKPA 4EDFA 3L75D 2AXTE 1FAVA 4PD4H 1G2CB 3P4QD 2D2CD 1HBWA 4I6MC 1KYOE 2H89C 2FYNB 4ZNCA 2GUSA 5H2FH 1L4AD 5GTHE 3M9BA 2RMZA 3EQ2A 4BRYA 5BU5A 1NU1J 3SWFA 1JY2P 4WY4D 1GW3A 3HD7C 3L35A 2G3AA 2ZJSE 1GDTA 1R8EA 1BE3J 1QEXA 1ZXGA 4C7RA 1HUCA 1VPCA 3JCUH 5AVTB 3JCUE 3B71A 2ZYDA 1SQBG 3O6QA 1YHQP 1L0LE 1X22A 3G6EP 4AYCA 3AEDC 2XKMA 1PP9J 4OGQD 3CCEP 2Z4EA 3AE2D 1VQPP 1SQPD 1JTHB 2BS4C 1FBMA 1Q86Q 1JTHA 2H88C 5KJ7D 4R4MA 4EOTA 1FDMA 3OW2O 1IFIA 4GKGA 1JOCA 2BS2C 1FZCB 3V5BA 3Q3DA 3L37A 4W80A 3V4QA 1RF1A 5C2TC 3I55P 2OYHB 1RE4A 2O1KA 2FXPA 5GTIH 2N1TA 5CJ4A 2DW3A 3NMDA 4LGDE 4KT0J 4YT0C 2PAJA 1G1JA 1BDDA 3H32B 3AEDD 1X8YA 4I1LA 3B8EB 2WZ7A 1KILE 2I1JA 1YIJP 1EQ7A 2P58A 4XE5B 3CWBJ 5AW8B 4HKZH 4GT1A 5KJ7A 2IBZG 4YSXD 1FJPA 4RO0A 1AJYA 1RE4C 1GZLA 4DZOA 1PGOA 1PPJD 4YSYC 2LXCB 4CPGA 2OYOA 5TJHA 1K73Q 3SFDC 3FX0A 1L4AC 1GK4A 1VQLP 1BE3D 1X0TA 5AVQB 3CCRP 1H8AA 2WP9D 2NZ2A 2A06D 2HFED 3AEEC 1KB9D 3AE3C 1NTMJ 1LP1B 3AEFC 3CWBE 2KYVA 1RF0A 3MGNA 1SQQK 1JY3N 1PPJG 3TYYA 1SQXE 1KB9H 1FZGA 3AE7D 3EWKA 1W2BO 1U7JA 5AW4B 2WDVD 1ZV8A 1NWQA 3OJAB 4DDGA 3AE9C 5KAFH 1NGMB 5EFWB 2QJKC 3F89A 1DH3A 2WDRC 2V4HA 1URQA 1SP4A 3VMAA 2P10A 2E74D 1IC2A 1EC5A 2WSFH 1NAYA 3M0AA 1RQVA 4L75A 3M9HA 2OQQA 1X79B 3A0BE 1EDLA 3MUDC 1JY3P 1FJKA 2OYHC 1Q81Q 5B66H 3L70J 3K5BA 3WUUA 2HODA 2WQYC 1LNQA 3CC7P 1OVRA 2WDQC 1CZQA 4W7YA 1IFDA 5B5EE 4ASWA 2FBWD 3L70E 3HTKA 4H0LB 1GD2E 1E5WA 1N8RQ 3L72G 3VRBD 2WT7A 1N73C 1EXJA 1U7MA 3CWBG 3MUDA 1S5LH 4QMAA 2WSCH 2J58A 3ABVC 2A45I 1T2KD 3VMYA 2M5AB 1VQNP 2QE7H 1QLBC 2I1KA 1NAFA 5KLVD 1VQKP 2IBZD 3VP8A 1A02F 5TISH 3A0HH 1IFMA 1SQPJ 2L91A 2IBZI 2QVAA 1PZQA 1OFCX 3L71E 5CMZA 4N6JA 4C46A 3L72J 2OYIB 2KIKA 5E79E 1VQOP 3RL0B 3L74D 1L0VD 3H25A 2WDQD 1OVUA 3HUSA 2FYNC 3CI9A 4NPDA 4U7JA 5AW1B 3BCCJ 4LLHA 3VOPA 1FZBA 2WPSA 3TNUB 3NXSA 3O8ZA 2WS3D 1IO4A 4DDIA 2ACZD 3L36A 4YXDD 2WU5D 1DX7A 2W90A 2E74C 1KORA 3CC2P 1EDKA 1PGPA 2E75D 2IPPA 1QLED 1BCCE 2BCCE 1LWUB 1NU1G 4GIFA 1KFMA 2E74B 2G8YA 2N1TB 3G71P 1Y47A 3CXHH 2KZJA 3AEED 1K05A 2N1TC 2MJZA 1SQPE 4U3FD 2KP8A 1GL2B 1H89A 4D6TG 4NPFX 5CCHD 4K35A 3BCCD 3L74G 2RKLA 5AW0B 2OYHA 1PIXA 2Y0DA 1LTIC 1NKZB 2N9YB 1KFYC 1AV1A 2P1JA 2WWWA 3PHLA 2B87B 3M91A 3H1KE 4D6TD 5K5GB 3SSUA 5KLVG 2A06G 2BEQD 5AVSB 5KAIH 3VMZA 1LTJA 4ZKUA 1T6AA 2O01H 4RJTA 1RE3A 1USDA 5KKZC 1L0NG 2FYUD 3T97A 1KQFB 1VQ9P 3CMEP 3L75E 5KAFE 2FYUK 1EXIA 3LW5J 1KYOH 1BCCD 2QJYB 1NTZD 3JSVC 1ZLLA 3BATA 2LKMA 1L0LK 1ZRTD 1K8AQ 2AXTH 4B86A 3VRAC 1VQ4P 1OW8A 3H1ID 2E5YA 1KILA 2YKOA 1SQVE 1FOSF 5AVYB 1YITP 4YSZD 3V2QA 1TFFA 1HGZA 3C1LA 1K04A 3E1RA 3P32A 1OIPA 3P8MC 1BSNA 1Y9BA 2C0WA 2YNYA 1J1DC 1ZP0C 3CXHD 3PJSK 3JC22 3L73E 3AE8D 2B89A 3M0DA 3TGUE 1N7LA 2E75C 2B88A 3CCLP 2R44A 1CI6A 2GUVA 1YJWP 4Y99B 4IOIH 2OYIC 2CPSA 3R4YA 3II6A 3U1CA 4DHIB 1GTWA 4N78D 4TLFA 2KI7B 1SLQA 2XDJA 2E76D 2ZXEB 1A02J 3HE4A 3AEAD 1EZVD 4YTMD 2E75B 2D2CB 3L70D 4L76A 2HLOA 2JJLA 1DIPA 5CBNA 2LXBA 3EFGA 1P84D 5CCHA 3RBXA 2K1AA 1NTZE 1RF0C 1YTZT 4Z1MH 3E1IA 1KF6C 1Q82Q 4PV1B 1KFNA 1JY3O 3RL0D 1FZFA 1L0LD 3TGUD 3H1HD 3USSA 3GF3A 1LT9C 1KFYD 5AVRB 3CX5H 4DHZA 2XV5A 2M0BA 1EDIA 1M1JB 3CWBD 3HE4B 1KMIZ 2B76C 2ZFCA 2OYIA 5GTHH 5DJUB 2Y0EA 3AEGC 4IFFA 2WP9C 2NPSD 1NENC 4RKUJ 2AEJA 1BGYJ 4XA4A 3SFDD 3B4SA 5DJTB 3VONA 2WSEH 3CXHI 3AE5C 2ZT9D 5APVA 1TU3F 1NTKD 1MFZA 1RY3A 3P7KA 2K88A 4YTPC 2POHA 2IFMA 3FXDA 2OARA 3VR9C 2YIUC 5AW7B 1NEKD 2YKQA 3B5NC 1YQ4C 3KPEA 4YT0D 1NHLA 3MHVA 1L2PA 2ACZC 1N86A 1LT1A 2R3SA 3H1LJ 2A06E 2QA4P 2ZFYA 1M1JC 1XTGB 2IZ0A 2XU6A 3AEBC 3TGUG 2AEFA 3NFQA 3H1HG 3OA7A 1NTZK 1J2JB 2Y9ZA 2WT7B 1LTJB 1NEKC 1NTZJ 1SVFA 2QJPB 4C7NB 2K3RA 2C9NY 1EZVG 1ZRTE 3IN6A 3QH9A 1H0TA 3VR9D 4JF7A 4H44D 3AECC 3H1LG 2WPVB 1NO4A 5AVWB 1LTJC 5KAIE 1P84H 3L70G 4H0LD 3RK3C 1VQ8P 1KQGB 3D6ZA 2PP6A 1RHZB 1KN7A 2FYUJ 1SQQD 2UWJE 5CJ0A 3HD7D 2K9JA 4GDOA 3IAOA 2B9BA 4PJ0E 4DOJA 4BXLA 2NPSC 3RGUA 4ZKPA 2QJPC 3G9RA 3AEGD 1LTSC 1VQ6P 4U3FE 2R32A 1GL2D 1JNMA 2M3EA 3P4RC 2Z5IA 1SQQG 2GA1A 3A5TA 2JWAA 4YSYD 2JO1A 1KC8Q 2WU2C 2WQYD 3GG2A 3TSIA 3H1IJ 1MZ9A 1AQ5A 2ZVNB 4WY4B 2W6AA 2Q1KA 1OW7A 4WY4A 1KILB 4H13B 3L74J 3B5NB 3HRNA 2BEZF 2IX7C 3HD7B 5KKZB 3B5NA 4YPCA 2HG5D 1L4AB 2KSJA 4BWNA 5AW5B 3KXDA 1L4AA 2SPZA 3HE5B 3RK2C 4I2LC 1LWUA 2L5GB 3HE5A 1JCDA 2C9LY 1ZR4A 1N7SD 2WPRA 1LP1A 2QM7A 2QEXP 1SQQJ 2WVRA 4OVNF 4HH2A 2FFDC 1QL1A 4YTNC 1GL2A 2E76C 1QVGO 3KDPB 5AVXB 1YJNP 2WU2D 1W2EA 5E79H 1IFJA 2YO2A 3TK1A 2WITA 1SQVD 4IFMA 4EI2A 1PGJA 3HD7A 3A3YB 1K9MQ 4KHXA 1YQ3D 2WSCJ 1N2DC 5AVUB 2N1TD 3GHGA 2OGUA 3KZIE 1HTLC 2RN0A 1NTZG 4YXWH 1PP9E 2WSFJ 1LGHB 3BCCG 3H1IE 3Q5PA 2IZ1A 3CIRD 3H1JG 1JMBA 3IF4A 2KS1B 2H89D 1URQC 2FYUE 5AW2B 1D7MA 2KS1A 3H1IG 4W7ZA 4MN4C 1NKNA 2D2CC 4XFJA 3V6IA 3H1LE 2JR8A 3L71D 4H0LC 3VN0A 2MKVA 3KHUA 3KYQA 3M06A 1JM0A 3GHGC 3A2AA 3UIAA 2M5AA 1MFTA 4R4LA 3CCQP 1S9KE 1SS1A 3L73D 1L0NK 1W5CE 3P8CD 2JWDA 4YXDC 1KD1Q 3H1KJ 2QSIA 3AEBD 2J5UA 3HUSC 2WS3C 3RK2D 2OTKE 1SQBD 3LIDA 4PJ0H 5CBOA 1NJIQ 2A45H 3RK3E 2WPQA 1M1KQ 4C7NA 4YTPD 3O6QB 3L72E 3CIRC 3I5CA 1VF5B 3MD0A 5C3JD 2FYUG 1T2KC 2HR3A 1KZUB 1RQUA 1SQPK 1HVVA 3E7KA 1SQXD 1EZVE 1IJDB 5C39A 1LTBC 4LC1A 5CCHC 3P4QC 5APUA 2XNDH 4LDTA 1JY2N 1AFOA 1R5SA 3V4WA 3CC4P 3H1JJ 1YI2P 2J59M 1KV4A 1VQMP 3M0DC 3VRBC 1NU1E 1ZOYD 2A45G 1M57D 2QRXA 1LJ2A 3KQGA 5APYA 1G2CA 4HB1A 4O9BA 4IFDK 3A7OA 5KLVK 1NH4A 1SFCB 1CW5A 1QX8A 4HJGH 2YMYA 1YQ4D 2WU5C 3MIWA 1ZOYC 1NTKG 1N7SB 1S72P 3L75J 2BASA 1N7SA 1AQTA 3W68A 3RL0g 3FWNA 2KZIA 1Q2NA 1L0LJ 3MZWB 3SWKA 2Q3IA 1OWAA 3AEFD 3KZIH 2JDIH 5KTBA 3B5ND 3H32A 2P2UA 1PV3A 1WMKA 2ZXXA 3TNUA 4I7ZB 1M90Q 3NTNA 1SQQE 2W83C 5KLIC 3P4SD 2ITAA 1IFNA 5CHXA 3P8CE 3C8VA 3ABVD 1NU1K 3CLQA 4JYBA 1SQVG 1BGYD 2QM8A 3MP7B 1GU5A 4YSZC 1J1DB 2B87A 3H1LD 5CCGC 3S9OA 3F5HA 3Q2YA 5APQA 3SFEC 3L71J 4WWIA 3AECD 2FXOA 4PD4E 3VMXA 4H44B 1FS0E 3H1JE 4M3LA 2K37A 4DCKA 2M3BA 3PP5A 1QGKB 3D70A 3GW6A 1BDCA 3BRVB 2H8PD 2KSEA 1YTZI 4N3YB 2WSSH 1CSBA 2E5TA 4D6TJ 1SQXK 3Q5RA 2W6JH 1FZAA 5KLVE 2Z5HA 3BASA 1M56D 3BVHA 1MKMA 3CX5E 5CCGA 2WDVC 1OMIA 5KJ7C 4JPZB 1ZR2A 1KILC 1M8OB 1DD3A 1CI6B 5APXA 2V7QJ 4YTMC 2Q9IA 4WB4A 4ASVA 4PD4I 2WTYA 3AE8C 3P4PC 3AE9D 1ZP0D 3L74E 3H6PA 3WUVA 1PPJE 2JEEA 1PFIA 3S1KA 3Q1MA 2W6BA 3CCMP 3SWYA 1S3JA 1RF1C 1SQXJ 3Q5SA 2ZT9C 1WT6A 3AE5D 3BCCE 1P84E 1EDJA 1S4XA 3I56P 2FFDB 1URQB 1BE3E 3IFMA 2Q6QA 2KUBA 3AE3D 4I6LA 1MV8A 2Q5UA 1L0ND 1KQSO 1FE6A 2ZT9B 3AE4D 3CX5I 1NTMK 4KJMA 1KB9I 4TT3H 4JYCA 3PRJA 3CCVP 5APWA 1YQ3C 2QG4A 5TISE 4RESB 1NVOA 2HODB 3CCUP 2NPSA 2IYOA 3P4PD 1L0NE 2O01N 3RBZA 4BRYB 2OTJP 3AE1D 1U57A 4JQ0D 1OX3A 2YIUB 1XTCC 3VRAD 4U3FG 2K9YA 3WUTA 4AUWA 4WVZA 3RK3B 1SFCD 1WRGA 5AW6B 3C9IA 2R5BA 2WSEJ 5B5EH 3VP9A 1NTKE 2OTLP 5C2TD 1IFPA 3AE1C 1S2EA 4PV1D 5B66E 5AW9B 1HJ0A 1BSHA 5AVZB 3RK2B 2QJKB 2NPSB 1NOHA 2YXRB 3P4RD 3V2RA 2Y9YA 1YJ9P 1L0LG 1UIIA 1UIXA 2YXQB 3AE4C 1FU1A 3M9QA 3AE2C 5CCGD 1FZEA 4IL6E 3BRTB 1Y8AA 5BVZA 3CL3D 4WY4C 4U3FJ 1GW4A 2O3JA 1HF9A 3U59A 1LTTC 2KLVA 2FY8A 3L73G 2E42A 3V2NA 1E7PC 5AW3B 3IR9A 1VQ5P 4UB6H 2JKVA 1FDOA 2BS3C 1OVVA 1L0NJ 2V7QH 1SFCA 1JY2O 1VF5D 2HPCA 2N9BA 3VTPC 2W27A 1RE3C 1DEEG 2AEMA 4GOEA 3RK3D 4WBAA 1FDIA 4JBZA 4UB8H 1HJBA 4KX6C 2M8RA 1OW6A 2Y0CA 1M1JA 4L74A 2KNCB 2PRRA 1G1IA 1ZMEC 3H1KD 4D6TE 1PP9G 1KYOI 1HWTC 2FBWC 2ZYGA 1JCCA 1ZN5A 3WU2H 4PV1C 1T3UA 2CK3H 1OXZA 1N73A 4H44C 1S9KD 1KILD 1IZNB 1KQLA 4A7PA 3PLNA 3EFFK 1JB0J 4DHJA 3L75G 1QVFO 1L0VC 3CD6P 3CXHE 1N7SC 1RH5B 1Z56A 3T97B 1T3JA 2YMKA 4L73A 1VQ7P 2WMMA 2XZRA 2R3CA 3GF7A 1FZCC 3SFED 5GTIE 3MTUE 1T8ZA 3WU2E 3VR8C 3FXEA 3G4SP 1LTGC 3L73J 1N73B 1JMMA 3V2PA 3AE6D 1LWUC 3FWLA 5L8RJ 3ZDMA 4H13D 4EYYQ 3P4SC 1RF1B 4GODA 5BU8B 1USEA 4UB8E 1ZW0A 1VDFA 2KLUA 2H43A 1GMJA 2C0XA 1SQPG 3VR8D 2KOGA 2YO3A 1NEND 1GL2C 3WMM0 1S1CX 2FFDA 3CMAP 2KK7A 3A0HE 3TDKA 1DEBA 3LIEA 3FGAD 1FZCA 3N4XA 2VRSA 1NTKJ 3CPWO 2R5DA 2BCCG 1BCCG 3D6YA 1OZHA 3TF5A 1EZVI 3QWOC 5M1BA 1NTKK 2O01J 2IFNA 1BGYE 3S4RA 1MUUA 1QL2A 1S5LE 1SQXG 2FXMA 2IYPA 1E79H 1KF6D 4FJVA 1LTAC 1PP9D 4OGQB 2Q3EA 4EIJA 1S5LX 1H88A 1DD4A 4PD4D 1AA0A 4DT0A 1P84I 2H88D 2GM4A 1M7LA 3VYIA 2RH0A 1YYCA 2WDRD 2CPBA 3HUSB 1SQBE 4IL6X 1PL5A 4KX6D 2E43A 4DJGA 1NTMG 2QIWA 1SQVJ 4AQRD 2KB7P 2PGDA 3A0BH 4GOFA 2XNXA 2P67A 1GK6A 3H1HJ 1VF5C 1NYHA 4OWFA 1LT9A 3U1AA 2BCCJ 1SQVK 3L71G
chains in the Genus database with same CATH topology
2WP9C 1ZP0C 3P4SC 2JP3A 3AE7C 4RKUJ 1NENC 2FXPA 1L0VD 4YTNC 1KFYC 3AE8D 2P10A 2E74D 3P4PD 3D70A 1FDIA 4KT0J 3H25A 1GMJA 1YQ4D 2E76C 2WDQD 2WU5C 4YT0C 3SFDD 3GLMA 4KX6C 3AE1D 2WU2D 1OW6A 1U57A 3AE5C 2FYNC 2ZT9D 4GDOA 2E75C 3IAOA 4U7JA 3AEDD 3VR8D 1ZOYC 1TU3F 1NEND 1ZMEC 1RQVA 1KILE 2QJPC 3G9RA 3AEGD 5C3JC 2OQQA 3Q5RA 3P4QD 2D2CD 3VRAD 1S1CX 2FBWC 1YQ3D 2BEQD 3GMAA 2WS3D 2WSCJ 3R4YA 3RL0g 4H13C 3RK3E 2K9YA 4YSXD 2B76D 2H89C 2ACZD 1AJYA 4YTPD 2WQYC 4YTPC 1KTMA 5KKZC 4YSXC 3AE6C 2IDBA 4YXDD 4PV1C 3AEFD 2E76D 2WDQC 1KQFB 2WU5D 1MKMA 2QJYC 3AEAD 3CIRC 1VF5B 4H44C 4YTMD 4YSYC 2WDVC 2E74C 2E75B 2FBWD 3VR9C 1OMIA 2D2CB 3P4RC 1KORA 5C3JD 2WSEJ 2YIUC 1PV3A 3FGAD 1DIPA 1Q90D 1DD3A 1WMKA 1NEKD 2WSFJ 4H0LB 5C2TD 2E75D 3Q5PA 3VRBD 1RQUA 3CIRD 2V7QJ 1EXIA 2JO1A 4YSYD 3AE1C 4YTMC 2WU2C 4PV1D 3LW5J 1EXJA 1YQ4C 1IK7A 1JB0J 4I7ZB 3SFDC 3D6YA 4YT0D 2G3AA 2WQYD 1HJ0A 1R8EA 3AE8C 2E74B 3ABVC 2ACZC 3P4PC 2G8YA 1L0VC 2H89D 3AE9D 5M1BA 4YTND 4Z1MH 1KF6C 5KLIC 1ZP0D 2O01J 4PV1B 3P4SD 2WP9D 2NZ2A 3P4RD 3AEED 3T97B 3Q1MA 3B71A 3AEEC 1QLBC 3P4QC 3O6QA 2D2CC 4XFJA 1K05A 3D71A 3VRAC 3AE3C 1OW7A 2YMKA 3AEFC 4H13B 1OW8A 4I7ZC 3AEBC 1KF6D 1UIXA 4Y28J 3C8VA 3GF7A 4H0LC 3AE4C 3Q5SA 2ZT9C 3AEDC 4OGQB 3ABVD 3AE5D 1S5LX 4OGQD 3SFED 2BEZF 3AE2C 2E76B 2MKVA 1DD4A 3GF3A 3AE2D 4YSZD 1KFYD 3VRBC 1NEKC 1VL2A 1HF9A 2BS4C 2H88D 3AE7D 3EWKA 1K04A 1ZOYD 2WDRD 3AE3D 2H88C 1ZRTE 3IN6A 4R4MA 2WDVD 4IL6X 3VR9D 4R4LA 3VR8C 1PL5A 3AEAC 4YSZC 4H44D 4KX6D 1E7PC 3AE6D 1KMIZ 3AECC 3S9OA 2WPVB 4YXDC 3AE9C 3Q2YA 1Y9BA 2QIWA 4OGQC 2BS2C 2ZT9B 5L8RJ 3SFEC 3AE4D 2B76C 1NGMB 4H0LD 2QSIA 3Q3DA 4TT3H 3AECD 1FDOA 3AEBD 4H13D 2QJKC 1KQGB 2J5UA 3D6ZA 2BS3C 1VF5C 4H44B 1NYHA 1PIXA 1YQ3C 2WS3C 5C2TC 3AEGC 1VF5D 2WDRC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WP9 C;  1ZP0 C;  3P4S C;  1NEN C;  3AE7 C;  1L0V D;  4YTN C;  1KFY C;  3AE8 D;  3P4P D;  1YQ4 D;  2WDQ D;  2WU5 C;  4YT0 C;  3SFD D;  4KX6 C;  3AE1 D;  2WU2 D;  1OW6 A;  3AE5 C;  3AED D;  3VR8 D;  1ZOY C;  1NEN D;  5C3J C;  3AEG D;  3P4Q D;  3VRA D;  2FBW C;  1YQ3 D;  2WS3 D;  4YSX D;  2B76 D;  2H89 C;  2ACZ D;  4YTP D;  2WQY C;  4YTP C;  1KTM A;  4YSX C;  3AE6 C;  4YXD D;  3AEF D;  2WDQ C;  2WU5 D;  3AEA D;  3CIR C;  4YTM D;  4YSY C;  2WDV C;  3VR9 C;  2FBW D;  3P4R C;  5C3J D;  1PV3 A;  1NEK D;  5C2T D;  3VRB D;  3CIR D;  4YSY D;  4YTM C;  3AE1 C;  2WU2 C;  1YQ4 C;  3SFD C;  4YT0 D;  2G3A A;  2WQY D;  3AE8 C;  3ABV C;  2ACZ C;  3P4P C;  1L0V C;  2H89 D;  3AE9 D;  4YTN D;  1KF6 C;  1ZP0 D;  3P4S D;  2WP9 D;  3P4R D;  3AEE D;  3B71 A;  3AEE C;  1QLB C;  3P4Q C;  3VRA C;  1K05 A;  3AE3 C;  1OW7 A;  3AEF C;  1OW8 A;  3AEB C;  1KF6 D;  3AE4 C;  3ABV D;  3AED C;  3SFE D;  3AE5 D;  3AE2 C;  3AE2 D;  4YSZ D;  1KFY D;  3VRB C;  1NEK C;  2BS4 C;  2H88 D;  3AE7 D;  1K04 A;  1ZOY D;  2WDR D;  3AE3 D;  2H88 C;  2WDV D;  3VR9 D;  3VR8 C;  3AEA C;  4YSZ C;  4KX6 D;  1E7P C;  3AE6 D;  3AEC C;  3S9O A;  4YXD C;  3AE9 C;  2BS2 C;  3SFE C;  3AE4 D;  2B76 C;  3AEC D;  3AEB D;  2BS3 C;  1YQ3 C;  2WS3 C;  5C2T C;  3AEG C;  2WDR C; 
#chains in the Genus database with same CATH topology
 2JP3 A;  3AE7 C;  1JEK A;  4NPE A;  1NTM E;  3L72 D;  2ZAE B;  3G3Z A;  1J1E C;  3CX5 D;  5APT A;  3CCS P;  2ZVO B;  5C3J C;  3PH0 A;  2FYZ A;  2PFX A;  5AVV B;  2W8Z A;  3GMA A;  4H13 C;  1NTM D;  2HYN A;  2B76 D;  3H1K G;  2I8D A;  1KTM A;  1X9V A;  4YSX C;  3AE6 C;  1AVY A;  2IDB A;  1BGY G;  2QJY C;  1KB9 E;  4OH8 B;  4ZMD A;  3R2P A;  2ZYA A;  1Q90 D;  1Q7Y Q;  3ITK A;  3PTZ A;  1IK7 A;  1LT9 B;  1NU1 D;  4N78 E;  4HYT B;  4YTN D;  3TGU J;  3GHG B;  2O1J A;  4Y99 C;  1IK9 A;  1SQB K;  3D71 A;  5APS A;  2Q7C A;  1SFC C;  2KNC A;  4I7Z C;  4Y28 J;  2E76 B;  5KLV J;  3N7N A;  4UB6 E;  2IBZ E;  1KYO D;  1YBK A;  1VL2 A;  3W67 A;  2FKW B;  1FOS E;  1R5L A;  2K9J B;  3AEA C;  4K3A A;  2LR2 A;  1FC2 C;  3CCJ P;  3RL0 C;  1JO5 A;  1HGV A;  1AVO A;  4OGQ C;  4IL6 H;  3H1H E;  1J1E B;  3HTK B;  1PGQ A;  2AXC A;  1HH0 A;  5KLI B;  5H2F E;  3OAK A;  2HPC B;  1BE3 G;  3H1J D;  3LW5 H;  2P7J A;  1JUN A;  2BCC D;  1URQ D;  2H7H A;  2NRG A;  1H0T B;  1SQB J;  2KXP B;  1GU4 A;  3GLM A;  1BCC J;  3L4F A;  2YKP A;  4EDF A;  3L75 D;  2AXT E;  1FAV A;  4PD4 H;  1G2C B;  3P4Q D;  2D2C D;  1HBW A;  4I6M C;  1KYO E;  2H89 C;  2FYN B;  4ZNC A;  2GUS A;  5H2F H;  1L4A D;  5GTH E;  3M9B A;  2RMZ A;  3EQ2 A;  4BRY A;  5BU5 A;  1NU1 J;  3SWF A;  1JY2 P;  4WY4 D;  1GW3 A;  3HD7 C;  3L35 A;  2G3A A;  2ZJS E;  1GDT A;  1R8E A;  1BE3 J;  1QEX A;  1ZXG A;  4C7R A;  1HUC A;  1VPC A;  3JCU H;  5AVT B;  3JCU E;  3B71 A;  2ZYD A;  1SQB G;  3O6Q A;  1YHQ P;  1L0L E;  1X22 A;  3G6E P;  4AYC A;  3AED C;  2XKM A;  1PP9 J;  4OGQ D;  3CCE P;  2Z4E A;  3AE2 D;  1VQP P;  1SQP D;  1JTH B;  2BS4 C;  1FBM A;  1Q86 Q;  1JTH A;  2H88 C;  5KJ7 D;  4R4M A;  4EOT A;  1FDM A;  3OW2 O;  1IFI A;  4GKG A;  1JOC A;  2BS2 C;  1FZC B;  3V5B A;  3Q3D A;  3L37 A;  4W80 A;  3V4Q A;  1RF1 A;  5C2T C;  3I55 P;  2OYH B;  1RE4 A;  2O1K A;  2FXP A;  5GTI H;  2N1T A;  5CJ4 A;  2DW3 A;  3NMD A;  4LGD E;  4KT0 J;  4YT0 C;  2PAJ A;  1G1J A;  1BDD A;  3H32 B;  3AED D;  1X8Y A;  4I1L A;  3B8E B;  2WZ7 A;  1KIL E;  2I1J A;  1YIJ P;  1EQ7 A;  2P58 A;  4XE5 B;  3CWB J;  5AW8 B;  4HKZ H;  4GT1 A;  5KJ7 A;  2IBZ G;  4YSX D;  1FJP A;  4RO0 A;  1AJY A;  1RE4 C;  1GZL A;  4DZO A;  1PGO A;  1PPJ D;  4YSY C;  2LXC B;  4CPG A;  2OYO A;  5TJH A;  1K73 Q;  3SFD C;  3FX0 A;  1L4A C;  1GK4 A;  1VQL P;  1BE3 D;  1X0T A;  5AVQ B;  3CCR P;  1H8A A;  2WP9 D;  2NZ2 A;  2A06 D;  2HFE D;  3AEE C;  1KB9 D;  3AE3 C;  1NTM J;  1LP1 B;  3AEF C;  3CWB E;  2KYV A;  1RF0 A;  3MGN A;  1SQQ K;  1JY3 N;  1PPJ G;  3TYY A;  1SQX E;  1KB9 H;  1FZG A;  3AE7 D;  3EWK A;  1W2B O;  1U7J A;  5AW4 B;  2WDV D;  1ZV8 A;  1NWQ A;  3OJA B;  4DDG A;  3AE9 C;  5KAF H;  1NGM B;  5EFW B;  2QJK C;  3F89 A;  1DH3 A;  2WDR C;  2V4H A;  1URQ A;  1SP4 A;  3VMA A;  2P10 A;  2E74 D;  1IC2 A;  1EC5 A;  2WSF H;  1NAY A;  3M0A A;  1RQV A;  4L75 A;  3M9H A;  2OQQ A;  1X79 B;  3A0B E;  1EDL A;  3MUD C;  1JY3 P;  1FJK A;  2OYH C;  1Q81 Q;  5B66 H;  3L70 J;  3K5B A;  3WUU A;  2HOD A;  2WQY C;  1LNQ A;  3CC7 P;  1OVR A;  2WDQ C;  1CZQ A;  4W7Y A;  1IFD A;  5B5E E;  4ASW A;  2FBW D;  3L70 E;  3HTK A;  4H0L B;  1GD2 E;  1E5W A;  1N8R Q;  3L72 G;  3VRB D;  2WT7 A;  1N73 C;  1EXJ A;  1U7M A;  3CWB G;  3MUD A;  1S5L H;  4QMA A;  2WSC H;  2J58 A;  3ABV C;  2A45 I;  1T2K D;  3VMY A;  2M5A B;  1VQN P;  2QE7 H;  1QLB C;  2I1K A;  1NAF A;  5KLV D;  1VQK P;  2IBZ D;  3VP8 A;  1A02 F;  5TIS H;  3A0H H;  1IFM A;  1SQP J;  2L91 A;  2IBZ I;  2QVA A;  1PZQ A;  1OFC X;  3L71 E;  5CMZ A;  4N6J A;  4C46 A;  3L72 J;  2OYI B;  2KIK A;  5E79 E;  1VQO P;  3RL0 B;  3L74 D;  1L0V D;  3H25 A;  2WDQ D;  1OVU A;  3HUS A;  2FYN C;  3CI9 A;  4NPD A;  4U7J A;  5AW1 B;  3BCC J;  4LLH A;  3VOP A;  1FZB A;  2WPS A;  3TNU B;  3NXS A;  3O8Z A;  2WS3 D;  1IO4 A;  4DDI A;  2ACZ D;  3L36 A;  4YXD D;  2WU5 D;  1DX7 A;  2W90 A;  2E74 C;  1KOR A;  3CC2 P;  1EDK A;  1PGP A;  2E75 D;  2IPP A;  1QLE D;  1BCC E;  2BCC E;  1LWU B;  1NU1 G;  4GIF A;  1KFM A;  2E74 B;  2G8Y A;  2N1T B;  3G71 P;  1Y47 A;  3CXH H;  2KZJ A;  3AEE D;  1K05 A;  2N1T C;  2MJZ A;  1SQP E;  4U3F D;  2KP8 A;  1GL2 B;  1H89 A;  4D6T G;  4NPF X;  5CCH D;  4K35 A;  3BCC D;  3L74 G;  2RKL A;  5AW0 B;  2OYH A;  1PIX A;  2Y0D A;  1LTI C;  1NKZ B;  2N9Y B;  1KFY C;  1AV1 A;  2P1J A;  2WWW A;  3PHL A;  2B87 B;  3M91 A;  3H1K E;  4D6T D;  5K5G B;  3SSU A;  5KLV G;  2A06 G;  2BEQ D;  5AVS B;  5KAI H;  3VMZ A;  1LTJ A;  4ZKU A;  1T6A A;  2O01 H;  4RJT A;  1RE3 A;  1USD A;  5KKZ C;  1L0N G;  2FYU D;  3T97 A;  1KQF B;  1VQ9 P;  3CME P;  3L75 E;  5KAF E;  2FYU K;  1EXI A;  3LW5 J;  1KYO H;  1BCC D;  2QJY B;  1NTZ D;  3JSV C;  1ZLL A;  3BAT A;  2LKM A;  1L0L K;  1ZRT D;  1K8A Q;  2AXT H;  4B86 A;  3VRA C;  1VQ4 P;  1OW8 A;  3H1I D;  2E5Y A;  1KIL A;  2YKO A;  1SQV E;  1FOS F;  5AVY B;  1YIT P;  4YSZ D;  3V2Q A;  1TFF A;  1HGZ A;  3C1L A;  1K04 A;  3E1R A;  3P32 A;  1OIP A;  3P8M C;  1BSN A;  1Y9B A;  2C0W A;  2YNY A;  1J1D C;  1ZP0 C;  3CXH D;  3PJS K;  3JC2 2;  3L73 E;  3AE8 D;  2B89 A;  3M0D A;  3TGU E;  1N7L A;  2E75 C;  2B88 A;  3CCL P;  2R44 A;  1CI6 A;  2GUV A;  1YJW P;  4Y99 B;  4IOI H;  2OYI C;  2CPS A;  3R4Y A;  3II6 A;  3U1C A;  4DHI B;  1GTW A;  4N78 D;  4TLF A;  2KI7 B;  1SLQ A;  2XDJ A;  2E76 D;  2ZXE B;  1A02 J;  3HE4 A;  3AEA D;  1EZV D;  4YTM D;  2E75 B;  2D2C B;  3L70 D;  4L76 A;  2HLO A;  2JJL A;  1DIP A;  5CBN A;  2LXB A;  3EFG A;  1P84 D;  5CCH A;  3RBX A;  2K1A A;  1NTZ E;  1RF0 C;  1YTZ T;  4Z1M H;  3E1I A;  1KF6 C;  1Q82 Q;  4PV1 B;  1KFN A;  1JY3 O;  3RL0 D;  1FZF A;  1L0L D;  3TGU D;  3H1H D;  3USS A;  3GF3 A;  1LT9 C;  1KFY D;  5AVR B;  3CX5 H;  4DHZ A;  2XV5 A;  2M0B A;  1EDI A;  1M1J B;  3CWB D;  3HE4 B;  1KMI Z;  2B76 C;  2ZFC A;  2OYI A;  5GTH H;  5DJU B;  2Y0E A;  3AEG C;  4IFF A;  2WP9 C;  2NPS D;  1NEN C;  4RKU J;  2AEJ A;  1BGY J;  4XA4 A;  3SFD D;  3B4S A;  5DJT B;  3VON A;  2WSE H;  3CXH I;  3AE5 C;  2ZT9 D;  5APV A;  1TU3 F;  1NTK D;  1MFZ A;  1RY3 A;  3P7K A;  2K88 A;  4YTP C;  2POH A;  2IFM A;  3FXD A;  2OAR A;  3VR9 C;  2YIU C;  5AW7 B;  1NEK D;  2YKQ A;  3B5N C;  1YQ4 C;  3KPE A;  4YT0 D;  1NHL A;  3MHV A;  1L2P A;  2ACZ C;  1N86 A;  1LT1 A;  2R3S A;  3H1L J;  2A06 E;  2QA4 P;  2ZFY A;  1M1J C;  1XTG B;  2IZ0 A;  2XU6 A;  3AEB C;  3TGU G;  2AEF A;  3NFQ A;  3H1H G;  3OA7 A;  1NTZ K;  1J2J B;  2Y9Z A;  2WT7 B;  1LTJ B;  1NEK C;  1NTZ J;  1SVF A;  2QJP B;  4C7N B;  2K3R A;  2C9N Y;  1EZV G;  1ZRT E;  3IN6 A;  3QH9 A;  1H0T A;  3VR9 D;  4JF7 A;  4H44 D;  3AEC C;  3H1L G;  2WPV B;  1NO4 A;  5AVW B;  1LTJ C;  5KAI E;  1P84 H;  3L70 G;  4H0L D;  3RK3 C;  1VQ8 P;  1KQG B;  3D6Z A;  2PP6 A;  1RHZ B;  1KN7 A;  2FYU J;  1SQQ D;  2UWJ E;  5CJ0 A;  3HD7 D;  2K9J A;  4GDO A;  3IAO A;  2B9B A;  4PJ0 E;  4DOJ A;  4BXL A;  2NPS C;  3RGU A;  4ZKP A;  2QJP C;  3G9R A;  3AEG D;  1LTS C;  1VQ6 P;  4U3F E;  2R32 A;  1GL2 D;  1JNM A;  2M3E A;  3P4R C;  2Z5I A;  1SQQ G;  2GA1 A;  3A5T A;  2JWA A;  4YSY D;  2JO1 A;  1KC8 Q;  2WU2 C;  2WQY D;  3GG2 A;  3TSI A;  3H1I J;  1MZ9 A;  1AQ5 A;  2ZVN B;  4WY4 B;  2W6A A;  2Q1K A;  1OW7 A;  4WY4 A;  1KIL B;  4H13 B;  3L74 J;  3B5N B;  3HRN A;  2BEZ F;  2IX7 C;  3HD7 B;  5KKZ B;  3B5N A;  4YPC A;  2HG5 D;  1L4A B;  2KSJ A;  4BWN A;  5AW5 B;  3KXD A;  1L4A A;  2SPZ A;  3HE5 B;  3RK2 C;  4I2L C;  1LWU A;  2L5G B;  3HE5 A;  1JCD A;  2C9L Y;  1ZR4 A;  1N7S D;  2WPR A;  1LP1 A;  2QM7 A;  2QEX P;  1SQQ J;  2WVR A;  4OVN F;  4HH2 A;  2FFD C;  1QL1 A;  4YTN C;  1GL2 A;  2E76 C;  1QVG O;  3KDP B;  5AVX B;  1YJN P;  2WU2 D;  1W2E A;  5E79 H;  1IFJ A;  2YO2 A;  3TK1 A;  2WIT A;  1SQV D;  4IFM A;  4EI2 A;  1PGJ A;  3HD7 A;  3A3Y B;  1K9M Q;  4KHX A;  1YQ3 D;  2WSC J;  1N2D C;  5AVU B;  2N1T D;  3GHG A;  2OGU A;  3KZI E;  1HTL C;  2RN0 A;  1NTZ G;  4YXW H;  1PP9 E;  2WSF J;  1LGH B;  3BCC G;  3H1I E;  3Q5P A;  2IZ1 A;  3CIR D;  3H1J G;  1JMB A;  3IF4 A;  2KS1 B;  2H89 D;  1URQ C;  2FYU E;  5AW2 B;  1D7M A;  2KS1 A;  3H1I G;  4W7Z A;  4MN4 C;  1NKN A;  2D2C C;  4XFJ A;  3V6I A;  3H1L E;  2JR8 A;  3L71 D;  4H0L C;  3VN0 A;  2MKV A;  3KHU A;  3KYQ A;  3M06 A;  1JM0 A;  3GHG C;  3A2A A;  3UIA A;  2M5A A;  1MFT A;  4R4L A;  3CCQ P;  1S9K E;  1SS1 A;  3L73 D;  1L0N K;  1W5C E;  3P8C D;  2JWD A;  4YXD C;  1KD1 Q;  3H1K J;  2QSI A;  3AEB D;  2J5U A;  3HUS C;  2WS3 C;  3RK2 D;  2OTK E;  1SQB D;  3LID A;  4PJ0 H;  5CBO A;  1NJI Q;  2A45 H;  3RK3 E;  2WPQ A;  1M1K Q;  4C7N A;  4YTP D;  3O6Q B;  3L72 E;  3CIR C;  3I5C A;  1VF5 B;  3MD0 A;  5C3J D;  2FYU G;  1T2K C;  2HR3 A;  1KZU B;  1RQU A;  1SQP K;  1HVV A;  3E7K A;  1SQX D;  1EZV E;  1IJD B;  5C39 A;  1LTB C;  4LC1 A;  5CCH C;  3P4Q C;  5APU A;  2XND H;  4LDT A;  1JY2 N;  1AFO A;  1R5S A;  3V4W A;  3CC4 P;  3H1J J;  1YI2 P;  2J59 M;  1KV4 A;  1VQM P;  3M0D C;  3VRB C;  1NU1 E;  1ZOY D;  2A45 G;  1M57 D;  2QRX A;  1LJ2 A;  3KQG A;  5APY A;  1G2C A;  4HB1 A;  4O9B A;  4IFD K;  3A7O A;  5KLV K;  1NH4 A;  1SFC B;  1CW5 A;  1QX8 A;  4HJG H;  2YMY A;  1YQ4 D;  2WU5 C;  3MIW A;  1ZOY C;  1NTK G;  1N7S B;  1S72 P;  3L75 J;  2BAS A;  1N7S A;  1AQT A;  3W68 A;  3RL0 g;  3FWN A;  2KZI A;  1Q2N A;  1L0L J;  3MZW B;  3SWK A;  2Q3I A;  1OWA A;  3AEF D;  3KZI H;  2JDI H;  5KTB A;  3B5N D;  3H32 A;  2P2U A;  1PV3 A;  1WMK A;  2ZXX A;  3TNU A;  4I7Z B;  1M90 Q;  3NTN A;  1SQQ E;  2W83 C;  5KLI C;  3P4S D;  2ITA A;  1IFN A;  5CHX A;  3P8C E;  3C8V A;  3ABV D;  1NU1 K;  3CLQ A;  4JYB A;  1SQV G;  1BGY D;  2QM8 A;  3MP7 B;  1GU5 A;  4YSZ C;  1J1D B;  2B87 A;  3H1L D;  5CCG C;  3S9O A;  3F5H A;  3Q2Y A;  5APQ A;  3SFE C;  3L71 J;  4WWI A;  3AEC D;  2FXO A;  4PD4 E;  3VMX A;  4H44 B;  1FS0 E;  3H1J E;  4M3L A;  2K37 A;  4DCK A;  2M3B A;  3PP5 A;  1QGK B;  3D70 A;  3GW6 A;  1BDC A;  3BRV B;  2H8P D;  2KSE A;  1YTZ I;  4N3Y B;  2WSS H;  1CSB A;  2E5T A;  4D6T J;  1SQX K;  3Q5R A;  2W6J H;  1FZA A;  5KLV E;  2Z5H A;  3BAS A;  1M56 D;  3BVH A;  1MKM A;  3CX5 E;  5CCG A;  2WDV C;  1OMI A;  5KJ7 C;  4JPZ B;  1ZR2 A;  1KIL C;  1M8O B;  1DD3 A;  1CI6 B;  5APX A;  2V7Q J;  4YTM C;  2Q9I A;  4WB4 A;  4ASV A;  4PD4 I;  2WTY A;  3AE8 C;  3P4P C;  3AE9 D;  1ZP0 D;  3L74 E;  3H6P A;  3WUV A;  1PPJ E;  2JEE A;  1PFI A;  3S1K A;  3Q1M A;  2W6B A;  3CCM P;  3SWY A;  1S3J A;  1RF1 C;  1SQX J;  3Q5S A;  2ZT9 C;  1WT6 A;  3AE5 D;  3BCC E;  1P84 E;  1EDJ A;  1S4X A;  3I56 P;  2FFD B;  1URQ B;  1BE3 E;  3IFM A;  2Q6Q A;  2KUB A;  3AE3 D;  4I6L A;  1MV8 A;  2Q5U A;  1L0N D;  1KQS O;  1FE6 A;  2ZT9 B;  3AE4 D;  3CX5 I;  1NTM K;  4KJM A;  1KB9 I;  4TT3 H;  4JYC A;  3PRJ A;  3CCV P;  5APW A;  1YQ3 C;  2QG4 A;  5TIS E;  4RES B;  1NVO A;  2HOD B;  3CCU P;  2NPS A;  2IYO A;  3P4P D;  1L0N E;  2O01 N;  3RBZ A;  4BRY B;  2OTJ P;  3AE1 D;  1U57 A;  4JQ0 D;  1OX3 A;  2YIU B;  1XTC C;  3VRA D;  4U3F G;  2K9Y A;  3WUT A;  4AUW A;  4WVZ A;  3RK3 B;  1SFC D;  1WRG A;  5AW6 B;  3C9I A;  2R5B A;  2WSE J;  5B5E H;  3VP9 A;  1NTK E;  2OTL P;  5C2T D;  1IFP A;  3AE1 C;  1S2E A;  4PV1 D;  5B66 E;  5AW9 B;  1HJ0 A;  1BSH A;  5AVZ B;  3RK2 B;  2QJK B;  2NPS B;  1NOH A;  2YXR B;  3P4R D;  3V2R A;  2Y9Y A;  1YJ9 P;  1L0L G;  1UII A;  1UIX A;  2YXQ B;  3AE4 C;  1FU1 A;  3M9Q A;  3AE2 C;  5CCG D;  1FZE A;  4IL6 E;  3BRT B;  1Y8A A;  5BVZ A;  3CL3 D;  4WY4 C;  4U3F J;  1GW4 A;  2O3J A;  1HF9 A;  3U59 A;  1LTT C;  2KLV A;  2FY8 A;  3L73 G;  2E42 A;  3V2N A;  1E7P C;  5AW3 B;  3IR9 A;  1VQ5 P;  4UB6 H;  2JKV A;  1FDO A;  2BS3 C;  1OVV A;  1L0N J;  2V7Q H;  1SFC A;  1JY2 O;  1VF5 D;  2HPC A;  2N9B A;  3VTP C;  2W27 A;  1RE3 C;  1DEE G;  2AEM A;  4GOE A;  3RK3 D;  4WBA A;  1FDI A;  4JBZ A;  4UB8 H;  1HJB A;  4KX6 C;  2M8R A;  1OW6 A;  2Y0C A;  1M1J A;  4L74 A;  2KNC B;  2PRR A;  1G1I A;  1ZME C;  3H1K D;  4D6T E;  1PP9 G;  1KYO I;  1HWT C;  2FBW C;  2ZYG A;  1JCC A;  1ZN5 A;  3WU2 H;  4PV1 C;  1T3U A;  2CK3 H;  1OXZ A;  1N73 A;  4H44 C;  1S9K D;  1KIL D;  1IZN B;  1KQL A;  4A7P A;  3PLN A;  3EFF K;  1JB0 J;  4DHJ A;  3L75 G;  1QVF O;  1L0V C;  3CD6 P;  3CXH E;  1N7S C;  1RH5 B;  1Z56 A;  3T97 B;  1T3J A;  2YMK A;  4L73 A;  1VQ7 P;  2WMM A;  2XZR A;  2R3C A;  3GF7 A;  1FZC C;  3SFE D;  5GTI E;  3MTU E;  1T8Z A;  3WU2 E;  3VR8 C;  3FXE A;  3G4S P;  1LTG C;  3L73 J;  1N73 B;  1JMM A;  3V2P A;  3AE6 D;  1LWU C;  3FWL A;  5L8R J;  3ZDM A;  4H13 D;  4EYY Q;  3P4S C;  1RF1 B;  4GOD A;  5BU8 B;  1USE A;  4UB8 E;  1ZW0 A;  1VDF A;  2KLU A;  2H43 A;  1GMJ A;  2C0X A;  1SQP G;  3VR8 D;  2KOG A;  2YO3 A;  1NEN D;  1GL2 C;  3WMM 0;  1S1C X;  2FFD A;  3CMA P;  2KK7 A;  3A0H E;  3TDK A;  1DEB A;  3LIE A;  3FGA D;  1FZC A;  3N4X A;  2VRS A;  1NTK J;  3CPW O;  2R5D A;  2BCC G;  1BCC G;  3D6Y A;  1OZH A;  3TF5 A;  1EZV I;  3QWO C;  5M1B A;  1NTK K;  2O01 J;  2IFN A;  1BGY E;  3S4R A;  1MUU A;  1QL2 A;  1S5L E;  1SQX G;  2FXM A;  2IYP A;  1E79 H;  1KF6 D;  4FJV A;  1LTA C;  1PP9 D;  4OGQ B;  2Q3E A;  4EIJ A;  1S5L X;  1H88 A;  1DD4 A;  4PD4 D;  1AA0 A;  4DT0 A;  1P84 I;  2H88 D;  2GM4 A;  1M7L A;  3VYI A;  2RH0 A;  1YYC A;  2WDR D;  2CPB A;  3HUS B;  1SQB E;  4IL6 X;  1PL5 A;  4KX6 D;  2E43 A;  4DJG A;  1NTM G;  2QIW A;  1SQV J;  4AQR D;  2KB7 P;  2PGD A;  3A0B H;  4GOF A;  2XNX A;  2P67 A;  1GK6 A;  3H1H J;  1VF5 C;  1NYH A;  4OWF A;  1LT9 A;  3U1A A;  2BCC J;  1SQV K;  3L71 G; 
#chains in the Genus database with same CATH homology
 2WP9 C;  1ZP0 C;  3P4S C;  2JP3 A;  3AE7 C;  4RKU J;  1NEN C;  2FXP A;  1L0V D;  4YTN C;  1KFY C;  3AE8 D;  2P10 A;  2E74 D;  3P4P D;  3D70 A;  1FDI A;  4KT0 J;  3H25 A;  1GMJ A;  1YQ4 D;  2E76 C;  2WDQ D;  2WU5 C;  4YT0 C;  3SFD D;  3GLM A;  4KX6 C;  3AE1 D;  2WU2 D;  1OW6 A;  1U57 A;  3AE5 C;  2FYN C;  2ZT9 D;  4GDO A;  2E75 C;  3IAO A;  4U7J A;  3AED D;  3VR8 D;  1ZOY C;  1TU3 F;  1NEN D;  1ZME C;  1RQV A;  1KIL E;  2QJP C;  3G9R A;  3AEG D;  5C3J C;  2OQQ A;  3Q5R A;  3P4Q D;  2D2C D;  3VRA D;  1S1C X;  2FBW C;  1YQ3 D;  2BEQ D;  3GMA A;  2WS3 D;  2WSC J;  3R4Y A;  3RL0 g;  4H13 C;  3RK3 E;  2K9Y A;  4YSX D;  2B76 D;  2H89 C;  2ACZ D;  1AJY A;  4YTP D;  2WQY C;  4YTP C;  1KTM A;  5KKZ C;  4YSX C;  3AE6 C;  2IDB A;  4YXD D;  4PV1 C;  3AEF D;  2E76 D;  2WDQ C;  1KQF B;  2WU5 D;  1MKM A;  2QJY C;  3AEA D;  3CIR C;  1VF5 B;  4H44 C;  4YTM D;  4YSY C;  2WDV C;  2E74 C;  2E75 B;  2FBW D;  3VR9 C;  1OMI A;  2D2C B;  3P4R C;  1KOR A;  5C3J D;  2WSE J;  2YIU C;  1PV3 A;  3FGA D;  1DIP A;  1Q90 D;  1DD3 A;  1WMK A;  1NEK D;  2WSF J;  4H0L B;  5C2T D;  2E75 D;  3Q5P A;  3VRB D;  1RQU A;  3CIR D;  2V7Q J;  1EXI A;  2JO1 A;  4YSY D;  3AE1 C;  4YTM C;  2WU2 C;  4PV1 D;  3LW5 J;  1EXJ A;  1YQ4 C;  1IK7 A;  1JB0 J;  4I7Z B;  3SFD C;  3D6Y A;  4YT0 D;  2G3A A;  2WQY D;  1HJ0 A;  1R8E A;  3AE8 C;  2E74 B;  3ABV C;  2ACZ C;  3P4P C;  2G8Y A;  1L0V C;  2H89 D;  3AE9 D;  5M1B A;  4YTN D;  4Z1M H;  1KF6 C;  5KLI C;  1ZP0 D;  2O01 J;  4PV1 B;  3P4S D;  2WP9 D;  2NZ2 A;  3P4R D;  3AEE D;  3T97 B;  3Q1M A;  3B71 A;  3AEE C;  1QLB C;  3P4Q C;  3O6Q A;  2D2C C;  4XFJ A;  1K05 A;  3D71 A;  3VRA C;  3AE3 C;  1OW7 A;  2YMK A;  3AEF C;  4H13 B;  1OW8 A;  4I7Z C;  3AEB C;  1KF6 D;  1UIX A;  4Y28 J;  3C8V A;  3GF7 A;  4H0L C;  3AE4 C;  3Q5S A;  2ZT9 C;  3AED C;  4OGQ B;  3ABV D;  3AE5 D;  1S5L X;  4OGQ D;  3SFE D;  2BEZ F;  3AE2 C;  2E76 B;  2MKV A;  1DD4 A;  3GF3 A;  3AE2 D;  4YSZ D;  1KFY D;  3VRB C;  1NEK C;  1VL2 A;  1HF9 A;  2BS4 C;  2H88 D;  3AE7 D;  3EWK A;  1K04 A;  1ZOY D;  2WDR D;  3AE3 D;  2H88 C;  1ZRT E;  3IN6 A;  4R4M A;  2WDV D;  4IL6 X;  3VR9 D;  4R4L A;  3VR8 C;  1PL5 A;  3AEA C;  4YSZ C;  4H44 D;  4KX6 D;  1E7P C;  3AE6 D;  1KMI Z;  3AEC C;  3S9O A;  2WPV B;  4YXD C;  3AE9 C;  3Q2Y A;  1Y9B A;  2QIW A;  4OGQ C;  2BS2 C;  2ZT9 B;  5L8R J;  3SFE C;  3AE4 D;  2B76 C;  1NGM B;  4H0L D;  2QSI A;  3Q3D A;  4TT3 H;  3AEC D;  1FDO A;  3AEB D;  4H13 D;  2QJK C;  1KQG B;  2J5U A;  3D6Z A;  2BS3 C;  1VF5 C;  4H44 B;  1NYH A;  1PIX A;  1YQ3 C;  2WS3 C;  5C2T C;  3AEG C;  1VF5 D;  2WDR C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...