3SFDC

Crystal structure of porcine mitochondrial respiratory complex ii bound with oxaloacetate and pentachlorophenol
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Thiabendazole inhibits ubiquinone reduction activity of mitochondrial respiratory complex II via a water molecule mediated binding feature.
pubmed doi rcsb
total genus 49
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2011-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3sfdC01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3sfdC02
3P4RD 4YSYC 1K05A 3VRAC 3SFED 2H89C 2BS2C 4YXDD 3B71A 3AE7C 4YT0C 1OW7A 2H89D 2WP9C 1NEKD 5C2TC 2WDQC 1ZOYC 1K04A 3AEEC 1KTMA 4YT0D 4YTNC 2WP9D 5C2TD 2WDQD 3AE9D 1ZOYD 3AE6C 3AEED 3AE3D 3AEAD 2WU5C 3AEDC 1KFYC 4YTND 3SFDC 3AEGC 3P4QC 3AE8C 2FBWC 3AE6D 4YTMC 2WQYC 4YSYD 3AEDD 3AE2C 1KFYD 3VRAD 3SFDD 1YQ4C 3AEGD 3AE8D 1L0VC 2FBWD 3AE1C 1ZP0C 1NENC 2WS3C 2WQYD 3VRBC 3AE2D 3AE7D 3AEBC 1YQ4D 4YSXC 3VR8C 1NEND 1ZP0D 3AE1D 3VRBD 3AE5C 3P4SC 2WDVC 2BS3C 1OW6A 2B76C 2BS4C 4YSXD 2ACZC 1KF6C 5C3JC 4YSZC 3AE5D 2WU5D 3P4SD 2WDVD 2WU2C 2B76D 2ACZD 1KF6D 5C3JD 3P4QD 4YSZD 2G3AA 1YQ3C 4YTMD 3VR9C 3ABVC 2WU2D 1QLBC 4YXDC 3AEFC 1PV3A 4YTPC 1L0VD 2WDRC 1YQ3D 2WS3D 1OW8A 1NEKC 1E7PC 3ABVD 3CIRC 3P4PC 3VR9D 3AECC 3AEFD 4YTPD 3AEBD 3VR8D 3AE4C 2WDRD 3CIRD 3P4PD 2H88C 3AE9C 4KX6C 3S9OA 3P4RC 3AE3C 3AEAC 3AECD 3SFEC 3AE4D 2H88D 4KX6D
chains in the Genus database with same CATH superfamily
3P4RD 1URQD 5AVQB 1NGMB 2W6AA 3D6YA 2OYOA 3MZWB 1SLQA 3L70D 2B9BA 3IFMA 1BSNA 3H1LD 1JY3N 3LIEA 2PP6A 2K37A 3MUDA 1KTMA 1GK4A 4HYTB 5B5EH 5DJUB 1AQTA 1YTZI 5CCGA 1QGKB 3TNUA 2KLUA 1IFDA 1FC2C 2WQYC 3L4FA 1R8EA 4BRYB 3S1KA 3H1HJ 1MFTA 1FZFA 3SWYA 2HG5D 1M1JA 1H0TB 1MZ9A 3G3ZA 1VQOP 3RK3C 3L72J 2Y0EA 2XV5A 1SP4A 4W7YA 1L0ND 2N9YB 2L91A 5H2FE 1RQVA 3VONA 2ZFCA 3H6PA 1URQB 1HWTC 1KILD 2N1TC 1LT9C 1D7MA 5APSA 5AW5B 5AW8B 4Y99C 3AEBD 4U7JA 5KAFH 4N3YB 1EQ7A 2WVRA 3CLQA 5APXA 5CCHA 2OTJP 2H88D 2UWJE 2KSJA 4L74A 2XDJA 1EDIA 2H89C 1LWUB 3L74J 2FYUD 3M9BA 4OGQC 1HTLC 2PGDA 1NTMJ 3FWNA 1T8ZA 1Q82Q 3MUDC 3GF7A 1FZCB 1IK9A 3HD7D 4DDGA 1YIJP 3L74G 3B5ND 3I5CA 1YI2P 4YTND 1FJKA 1NTKJ 3WUTA 3G71P 3V2NA 1S2EA 4YSYD 1W2EA 1U7JA 1SQPJ 3GLMA 2KI7B 5KLVG 2QJKC 5GTIE 1NTZE 3L75E 1N73C 1IZNB 3VRBC 1M1JC 4YSXC 4TLFA 4K3AA 1FS0E 2K9YA 3II6A 1KILB 1N7SA 3RL0D 2ACZC 1KF6C 4JPZB 2ZT9C 1PPJG 1QVGO 5KJ7D 3TGUE 3D71A 3VMYA 2E43A 3H1JJ 2QM7A 1KN7A 4D6TJ 3A0BE 1FZAA 2ZXXA 1EZVI 3V5BA 3AEFD 3B4SA 2HPCA 1GL2B 1ZV8A 4JF7A 2WZ7A 4D6TG 3W67A 2OYIA 3HD7B 1N86A 2KZIA 5AVTB 3B5NB 1SFCD 3H1IE 2KYVA 1K8AQ 1CI6B 3CX5E 3NFQA 1M8OB 2FXMA 1ZLLA 1GZLA 1J1DC 2WP9C 3A7OA 1VQKP 1BGYJ 3UIAA 1NTMK 3NXSA 3RBXA 1EC5A 1Q81Q 2M8RA 4L76A 1PGOA 4YT0D 1WRGA 5APWA 1SQBD 2Y0CA 2GUSA 3BASA 3Q2YA 1L4AD 3SFDC 1SQXG 1NTKK 1OX3A 3NMDA 4YTMC 3RL0B 1VQ7P 2IBZE 2PFXA 3L73J 1L0VC 1HUCA 1H89A 1SQPK 3AE7D 4H0LD 3M9QA 2Q1KA 5TISH 1MUUA 5APYA 1Q90D 2MJZA 1HJ0A 1NAYA 3RBZA 1T6AA 4RKUJ 2YXQB 1KC8Q 1FOSE 1Y47A 3P4QD 1GDTA 2FFDA 2YIUB 2WU2D 1QVFO 5AW9B 3D6ZA 1SFCB 2QG4A 2POHA 2WSSH 3H1KD 1RE3C 3CIRD 5AW3B 2KIKA 3MP7B 3CCRP 3H1HE 4HB1A 2I1JA 1PP9D 3H32B 1E79H 4KX6D 4PD4E 3CWBJ 4AQRD 1AQ5A 2A06E 1AVYA 3SFED 2AEJA 2BS2C 1RF0C 1L4AB 1SVFA 1ZR4A 4PV1D 4EOTA 3L72E 4WVZA 3AEEC 1RY3A 1NH4A 1N8RQ 1FZGA 1G2CA 5AVRB 2JWAA 4H0LB 3AE6C 3AE3D 2HLOA 1IFJA 1QL2A 3AEDC 3S4RA 1VPCA 5APVA 1S3JA 2FBWC 3L37A 5KLIC 3RL0g 3E7KA 3SSUA 2Q6QA 1JTHA 1BCCD 2WMMA 1KILC 3B8EB 1OVVA 3GHGB 3KYQA 3AEBC 4K35A 1KB9E 3L74E 3TGUD 1K9MQ 3KHUA 3R2PA 4I7ZB 4YSZC 1NTME 4C46A 2WU5D 3P4SD 4NPFX 1J1EB 2PAJA 5C3JD 1KZUB 5KKZB 1T2KC 2W90A 3VR9C 2SPZA 4OWFA 1LT1A 2WDRC 1IO4A 1YQ3D 1NTKE 3V2PA 1VF5D 3GMAA 2O1JA 1NWQA 3HD7C 3CC7P 3CI9A 5H2FH 2K3RA 1SQPE 3N4XA 1RF1C 3AECD 5APTA 3H1ID 4C7RA 2BS3C 4W7ZA 3RGUA 4YSYC 2M0BA 1LP1B 1YITP 2CPSA 5CCGD 2WSCJ 4N78D 3BRVB 1VQ5P 3I56P 1DEEG 1HH0A 2NZ2A 1PGQA 3H1JE 4AYCA 3AEAD 2AEMA 1QX8A 2IBZD 2W6BA 2L5GB 3C8VA 4WY4D 2E5TA 1KFYD 3VRAD 1NTZG 3JCUE 3L75G 2NPSC 1ZP0C 1A02F 2Z5IA 3HUSA 2ZYDA 3L71J 2WSCH 1YQ4D 2RMZA 2WPVB 2WDVC 2B76C 3GF3A 3U1CA 5GTIH 1VF5B 4GIFA 3CCLP 2Z4EA 1IFPA 1BGYE 3LIDA 1SQQJ 4YPCA 1VQ6P 2WPSA 5CHXA 1JM0A 2WTYA 2D2CD 3H1HD 5CJ4A 2QJPB 1UIIA 1J2JB 1IK7A 3TNUB 4DDIA 1SQVJ 3L73E 3A0BH 1RQUA 2AXCA 4TT3H 2IYPA 1JOCA 3IAOA 1N7LA 3PLNA 2QE7H 1GTWA 1SQVG 4A7PA 3PP5A 3AE7C 3E1IA 2FYNB 4ZKPA 3OW2O 4WY4B 4JBZA 5C2TC 3HTKA 1YTZT 3A3YB 1X9VA 2E74D 3WUUA 2R44A 3CX5H 1KYOE 1ZRTE 1RE4C 2IFNA 3P4QC 5E79E 2IBZG 2W8ZA 2XZRA 3L74D 3HUSC 1VQ4P 1JY3P 3CWBE 2K9JA 4UB8E 1NEND 1HBWA 3RK2B 1LTSC 4H13C 4EDFA 2G8YA 1X79B 2H8PD 2D2CB 1BE3J 5KLVD 4I2LC 2OTLP 3TF5A 4O9BA 1N2DC 4GODA 1N73A 1PZQA 1SQQK 2FKWB 1U7MA 2E76D 2B89A 3P4PC 3P7KA 1NAFA 1BE3G 4PV1C 2HODA 1PPJD 5AW4B 4YTPD 1LTIC 2Q3IA 2IZ0A 3AE4C 3IN6A 1JY2N 1AA0A 3H1HG 3L35A 3AE3C 1YBKA 3V2RA 4DHZA 2E74B 2WT7B 1SQVK 2A06G 3T97A 2RKLA 4U3FJ 2QJYC 1L0LJ 2Q5UA 3L72G 5AVZB 1AV1A 1Q2NA 2E75D 4PD4H 5AVUB 2IBZI 3P8CE 5C39A 4D6TD 3PJSK 4XA4A 2RN0A 4CPGA 4MN4C 1ZOYD 2WU5C 2OYHC 3ITKA 2YXRB 1GL2D 3L70J 2O01J 2AEFA 1GMJA 3M91A 2AXTE 3AE1C 3WMM0 3H1LJ 3HE4A 1VQ9P 1VF5C 2V7QJ 1KQGB 2OYIB 3CXHE 3FGAD 3U59A 2E76B 1SQXD 1NTMG 1OW6A 4LGDE 1DD4A 3CCSP 3MTUE 1H0TA 1S9KE 4BWNA 5BU8B 1KB9H 1EDJA 1NTKG 2HR3A 1NU1J 1UIXA 2O01H 2XU6A 5DJTB 3PH0A 1G1JA 4OVNF 1E5WA 3RK3E 3KDPB 1SQPG 2C9LY 2V7QH 3M0AA 3MGNA 3S9OA 5BVZA 3AEAC 2E75B 2KXPB 2YO2A 1NU1G 1LTJC 1AJYA 1W2BO 3L71E 3O6QB 5CMZA 3VRAC 1LTBC 1L0NJ 1KORA 2BEQD 1OVRA 4L73A 2IFMA 4ZKUA 1MKMA 2JEEA 1RE3A 1T3UA 1L0LK 2WDQC 1K04A 1ZRTD 4DHIB 3H1JG 1SQQE 1YYCA 1VL2A 2A45G 4YXWH 2KP8A 2JO1A 5CBOA 1RF0A 3AE8C 3OA7A 4H44D 3O8ZA 2V4HA 2FYUJ 4EIJA 1SQVE 3WU2E 3AEGD 3KXDA 4EI2A 2ZYAA 1OWAA 2KS1B 3AE2D 5AVSB 3Q5SA 2A45H 3F89A 2WWWA 1VQ8P 3AE5C 3JCUH 3HRNA 1BGYG 1OFCX 1M56D 1USEA 2HYNA 3R4YA 3ABVC 1KILA 1DIPA 4W80A 3EFFK 1G2CB 1NU1K 5B66E 1S72P 1IC2A 5AW2B 4ZMDA 3VR8D 3L73G 2ZVNB 4XE5B 2YMKA 3P4RC 1URQC 4NPEA 2WITA 1DH3A 3VMXA 1FJPA 4GOEA 3VMZA 2W6JH 1L0NK 1M7LA 3B71A 4QMAA 1OIPA 4FJVA 2ZFYA 1BE3E 3HD7A 4H44B 3B5NA 1RF1A 1LWUC 2QVAA 1CI6A 1IFMA 4IFMA 3VOPA 2J5UA 4Y28J 1HGZA 1FZCC 1JY3O 3V6IA 1DEBA 1NJIQ 4JQ0D 3V2QA 1RH5B 3EQ2A 3MIWA 1KYOH 2OQQA 1USDA 2WQYD 3CWBG 2RH0A 5AVYB 3BRTB 2XKMA 5E79H 2KUBA 1BDDA 2J58A 1NYHA 2BCCJ 4WBAA 5KAIE 4U3FE 1SQBJ 1NKZB 1P84E 5KJ7A 1XTGB 1L0LE 1NTZD 3L75D 1X8YA 1FDOA 2XNDH 1EXIA 4NPDA 4UB8H 2GUVA 1NOHA 2NPSA 2BCCG 3RK3D 1JO5A 3N7NA 1KV4A 3K5BA 1FDMA 4HKZH 1EZVE 1FBMA 1WT6A 3L70E 4C7NA 2N1TD 2H88C 2WPQA 1JCCA 4DHJA 3H1LE 1SFCA 1JMBA 3Q1MA 3HE5A 3FXEA 2W27A 1GL2C 2KZJA 2JJLA 2IPPA 2CK3H 2M5AA 5AW1B 1S5LE 1HGVA 1W5CE 4PJ0H 2H89D 3H32A 3B5NC 2E42A 3PHLA 3H1KJ 5CBNA 4YTNC 1G1IA 1OVUA 1R5SA 3CX5D 1NU1E 2YO3A 2H7HA 1L2PA 3P32A 1PP9J 1SQVD 4L75A 3PTZA 1XTCC 1S5LX 1LGHB 3TYYA 4IOIH 2WPRA 2B87A 3BATA 3LW5J 1FZBA 3Q5PA 1OMIA 3ZDMA 1JMMA 3RK3B 3RL0C 3PRJA 4WB4A 1GD2E 3VRBD 1L0NE 5KJ7C 2BS4C 2N9BA 1RE4A 4YSXD 2AXTH 1SQBK 5APQA 1A02J 1KILE 2Z5HA 4IFDK 4DOJA 2N1TB 1LT9B 3VMAA 2ACZD 1KF6D 2ZT9D 4Y99B 3CXHH 4HH2A 3A2AA 3MD0A 3HTKB 4UB6H 1BCCJ 1VQPP 3CC2P 3AEFC 2WS3D 2Y9ZA 1IFIA 1FZEA 2H43A 3LW5H 2YIUC 5K5GB 2ZAEB 4Z1MH 3D70A 2FYUE 1KQFB 5GTHH 3OAKA 3L71G 1SFCC 4OGQB 3KZIE 5AVVB 1OXZA 2WSEJ 1K05A 3RK2D 1BE3D 5CCHD 3USSA 2Q3EA 2WSFJ 4YT0C 1IJDB 1SQQG 2I1KA 4PD4D 1QLED 2A06D 1K73Q 1L4AC 1LP1A 2QSIA 2WP9D 2B88A 1JCDA 2QJKB 2QM8A 1N73B 3L36A 1M1JB 3L72D 4IL6E 4B86A 5APUA 3SFDD 2KNCA 2HODB 4H0LC 1VQLP 2ZJSE 2O3JA 3EWKA 1EDKA 2IDBA 3JSVC 1LTGC 2ZT9B 3BCCJ 2WSFH 2DW3A 3VR8C 1NKNA 3SWFA 4GDOA 2OYHA 2C0WA 3WU2H 4WWIA 3FXDA 2K1AA 3GHGC 2WU2C 1N7SD 3VTPC 2YKPA 4IL6X 3BCCG 3F5HA 3FX0A 1YJNP 1KB9D 4LDTA 3CD6P 3VP9A 3V4QA 1GK6A 2LKMA 4I7ZC 1NO4A 1OZHA 4DJGA 1NTMD 2XNXA 3CIRC 4M3LA 1J1EC 3JC22 5KKZC 2IZ1A 2M3EA 1HF9A 1TFFA 2ZVOB 3VP8A 4KX6C 3OJAB 3SFEC 1AFOA 4RESB 1NTKD 4DT0A 2M3BA 5B66H 1J1DB 1Y8AA 1FOSF 3TSIA 2IYOA 2BCCE 3HE4B 1SQBE 1SQPD 1EXJA 1VDFA 3CX5I 1LJ2A 3QH9A 1NU1D 3E1RA 3VYIA 2P10A 1X0TA 2ZXEB 3CCEP 1LTJA 1MV8A 4PJ0E 3AE9D 4IFFA 1JY2P 4GOFA 3AEED 2JWDA 4WY4A 1BSHA 3Q3DA 1QL1A 1Q7YQ 3AE6D 2HFED 3AEDD 3IR9A 1N7SB 3H1JD 2LXBA 1HVVA 1M1KQ 2FBWD 2JDIH 4U3FG 3KQGA 1L0LG 3P4SC 2Q7CA 4JYBA 1LNQA 3CCQP 5C3JC 2GA1A 1WMKA 2R5BA 1HJBA 1DX7A 4DCKA 3MHVA 2P58A 2R5DA 3TK1A 4HJGH 3H1KE 3A0HH 3NTNA 1KMIZ 1YQ3C 3WUVA 4KJMA 2HPCB 5KAIH 1ZN5A 4YSZD 5BU5A 1EZVG 1P84H 2QRXA 4I6LA 1T2KD 3VR9D 1PP9E 2OARA 1BGYD 3L70G 3AECC 4BRYA 2GM4A 4UB6E 2WDRD 1PFIA 2Y0DA 3H1LG 4XFJA 3A5TA 5EFWB 2FXOA 5KLVJ 1YHQP 1M57D 2QJPC 4PD4I 5CCGC 2KK7A 5GTHE 3GG2A 2IX7C 3QWOC 1TU3F 3L73D 4YXDD 2BEZF 3CC4P 4ZNCA 2WT7A 1CSBA 5L8RJ 1JNMA 1NEKD 1RHZB 1URQA 5KLIB 1BCCE 1S5LH 2VRSA 2FYNC 4WY4C 2KLVA 1KFYC 3M0DA 3M9HA 1Y9BA 1P84I 2I8DA 4N6JA 4KT0J 2P67A 1YQ4C 1KYOD 5TJHA 1BDCA 2WS3C 1LWUA 1L0NG 2NPSD 1ZP0D 2FFDB 2Q9IA 1KB9I 5CJ0A 1U57A 3CL3D 1FZCA 2J59M 2WDVD 3V4WA 2B76D 3CWBD 3RK2C 5CCHC 1LTAC 2NRGA 2D2CC 2O1KA 1RF1B 1SS1A 3M06A 5AW6B 2FYUG 1M90Q 2FXPA 4LC1A 1SQXJ 2OGUA 1GW3A 2BCCD 4N78E 1FE6A 3BCCE 3CCVP 1ZXGA 5KLVK 4EYYQ 1JEKA 5B5EE 2LR2A 3IF4A 2Y9YA 2E74C 1CW5A 3GW6A 3KZIH 4ASVA 2JR8A 3O6QA 1VQMP 3FWLA 1FU1A 2C0XA 5C2TD 1JTHB 3EFGA 1GL2A 1N7SC 2NPSB 1GU5A 3M0DC 1YJ9P 3P8CD 2A45I 1S1CX 4RO0A 1NENC 4C7NB 4I1LA 4IL6H 3CMEP 4GKGA 3HE5B 1NVOA 1EDLA 2KS1A 3C1LA 4DZOA 2M5AB 4H13D 2R3CA 2LXCB 2OYIC 1QEXA 2E76C 3TDKA 1FDIA 2P2UA 3CXHD 1H8AA 2FYUK 3CCUP 2QEXP 4YTPC 5KAFE 3G4SP 1OW8A 4R4MA 3A0HE 1S9KD 4KHXA 3G9RA 3P4PD 3AE9C 2ZYGA 3U1AA 1SQXK 3AE4D 2P7JA 2OTKE 1SQBG 2B87B 2R3SA 3BVHA 2E75C 3CCMP 1FAVA 3H25A 1JY2O 2E5YA 2C9NY 1OW7A 3L71D 1ZOYC 5AVXB 1YJWP 4JYCA 4R4LA 1GW4A 1VQNP 1KYOI 3I55P 1CZQA 2KB7P 3HUSB 1SQQD 2FY8A 2ITAA 1LTTC 1ZR2A 4H13B 2FFDC 4OH8B 5M1BA 4OGQD 1PL5A 2JKVA 5KLVE 1L4AA 3AE1D 3G6EP 3W68A 3H1KG 1MFZA 4PV1B 1PPJE 2KOGA 2P1JA 2K88A 3SWKA 4YXDC 1PP9G 1PV3A 5AVWB 1ZMEC 1NEKC 1E7PC 2MKVA 1PGJA 5KTBA 4I6MC 3BCCD 3CPWO 3GHGA 3P8MC 2QJYB 1NTZJ 3L75J 4RJTA 1S4XA 2KNCB 3CCJP 2PRRA 4D6TE 1PGPA 3KPEA 2YNYA 2FYZA 2BASA 1DD3A 1KD1Q 2OYHB 2YKOA 3TGUJ 1T3JA 1BCCG 1JB0J 1Z56A 5AW7B 2WDQD 4GT1A 4ASWA 4H44C 4LLHA 2O01N 1JUNA 3AEGC 2CPBA 1AVOA 3TGUG 1KFMA 2K9JB 4AUWA 1KFNA 3AE2C 1SQXE 5TISE 2W83C 1NHLA 2KSEA 3AE8D 3C9IA 3VN0A 1R5LA 3H1IJ 4BXLA 2JP3A 3CXHI 2QA4P 1H88A 3AE5D 3CMAP 1KQSO 2WSEH 2YMYA 2G3AA 1KQLA 4YTMD 4U3FD 1PIXA 2R32A 1QLBC 3H1IG 1P84D 1L0LD 1ZW0A 1L0VD 2YKQA 3ABVD 1LTJB 2N1TA 1X22A 1LT9A 3T97B 2QIWA 1GU4A 3Q5RA 1IFNA 1EZVD 1Q86Q 5AW0B 1NTZK
chains in the Genus database with same CATH topology
3P4RD 1NGMB 2QJPC 2WSEJ 3D6YA 4YSYC 1K05A 3VRAC 3SFED 1KORA 2BEQD 2H89C 2BS2C 2E75C 2QJYC 1TU3F 3H25A 4OGQC 4YXDD 2E74C 2BEZF 1EXJA 2WSCJ 2WSFJ 3B71A 3AE7C 4YT0C 1DD3A 5L8RJ 1OW7A 1MKMA 2H89D 2WP9C 1NEKD 2E75D 3AE8D 2WDQC 5C2TC 4PV1D 4H44B 1ZOYC 3O6QA 1K04A 3AEEC 3GF7A 2E74D 1KTMA 2P10A 1JB0J 2NZ2A 4YT0D 4YTNC 2QSIA 1VL2A 4R4LA 2WP9D 5C2TD 2WDQD 3AE9D 1ZOYD 4H0LB 3AE6C 3AEED 3AE3D 2FYNC 3AEAD 3Q2YA 2WU5C 1ZRTE 3AEDC 1KFYC 4YTND 3SFDC 2JO1A 2J5UA 3Q3DA 4H44C 1Y9BA 4Y28J 3AEGC 3P4QC 3AE8C 2FBWC 3AE6D 4YTMC 3C8VA 2WQYC 4KT0J 1S1CX 4YSYD 5KLIC 3AE2C 3RL0g 1KFYD 3AEDD 3SFDD 2O01J 3VRAD 4H44D 4H0LC 1S5LX 3GLMA 1R8EA 4H13B 1GMJA 1YQ4C 3EWKA 2OQQA 3AEGD 5M1BA 1L0VC 2QJKC 2IDBA 4OGQD 2FBWD 3AE1C 1PL5A 1ZP0C 3LW5J 1NENC 2WQYD 2WS3C 3VRBC 3AE2D 3AE7D 2H88D 3Q5SA 2ZT9B 3Q5PA 1VF5C 2V7QJ 4H0LD 1OMIA 1KQGB 3AEBC 1YQ4D 4YSXC 3VR8C 2WPVB 1NEND 1ZP0D 3AE1D 4GDOA 1NYHA 2K9YA 3AE5C 3P4SC 3VRBD 2WDVC 3FGAD 4H13C 2E76B 2BS3C 2JP3A 1U57A 1OW6A 2G8YA 2B76C 3GF3A 2BS4C 4YSXD 4I7ZB 1Q90D 1WMKA 1VF5B 2D2CB 1KF6C 2ACZC 4YSZC 2ZT9C 5C3JC 1FDOA 1HJ0A 1DD4A 1KILE 2WU5D 3AE5D 2WDVD 2WU2C 3P4SD 4H13D 4RKUJ 1EXIA 4IL6X 2B76D 4PV1B 2ACZD 1KF6D 5C3JD 3P4QD 4YSZD 1KMIZ 1YQ3C 2E76C 2G3AA 2ZT9D 3R4YA 1FDIA 3D71A 1PIXA 3ABVC 4YTMD 3VR9C 2WU2D 1QLBC 4I7ZC 1RQVA 4YXDC 2D2CC 3AEFC 1PV3A 4YTPC 1ZMEC 1UIXA 1DIPA 3D6ZA 1L0VD 2WDRC 1YQ3D 2E76D 2WS3D 1OW8A 4R4MA 1NEKC 1E7PC 3ABVD 3CIRC 3P4PC 3VR9D 2MKVA 4PV1C 3AECC 5KKZC 1VF5D 2D2CD 3GMAA 3RK3E 3AEFD 4YTPD 3T97B 3G9RA 3AEBD 2YIUC 4U7JA 3VR8D 2FXPA 3AE4C 2QIWA 3IN6A 1HF9A 2WDRD 3CIRD 2YMKA 3P4PD 2H88C 1IK7A 3AE9C 4Z1MH 3S9OA 3D70A 4KX6C 3P4RC 3AE3C 3AEAC 1KQFB 2E75B 3Q5RA 3AECD 4XFJA 1RQUA 4OGQB 3SFEC 2E74B 3AE4D 4TT3H 3Q1MA 1AJYA 4KX6D 3IAOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P4R D;  4YSY C;  1K05 A;  3VRA C;  3SFE D;  2H89 C;  2BS2 C;  4YXD D;  3B71 A;  3AE7 C;  4YT0 C;  1OW7 A;  2H89 D;  2WP9 C;  1NEK D;  5C2T C;  2WDQ C;  1ZOY C;  1K04 A;  3AEE C;  1KTM A;  4YT0 D;  4YTN C;  2WP9 D;  5C2T D;  2WDQ D;  3AE9 D;  1ZOY D;  3AE6 C;  3AEE D;  3AE3 D;  3AEA D;  2WU5 C;  3AED C;  1KFY C;  4YTN D;  3SFD C;  3AEG C;  3P4Q C;  3AE8 C;  2FBW C;  3AE6 D;  4YTM C;  2WQY C;  4YSY D;  3AED D;  3AE2 C;  1KFY D;  3VRA D;  3SFD D;  1YQ4 C;  3AEG D;  3AE8 D;  1L0V C;  2FBW D;  3AE1 C;  1ZP0 C;  1NEN C;  2WS3 C;  2WQY D;  3VRB C;  3AE2 D;  3AE7 D;  3AEB C;  1YQ4 D;  4YSX C;  3VR8 C;  1NEN D;  1ZP0 D;  3AE1 D;  3VRB D;  3AE5 C;  3P4S C;  2WDV C;  2BS3 C;  1OW6 A;  2B76 C;  2BS4 C;  4YSX D;  2ACZ C;  1KF6 C;  5C3J C;  4YSZ C;  3AE5 D;  2WU5 D;  3P4S D;  2WDV D;  2WU2 C;  2B76 D;  2ACZ D;  1KF6 D;  5C3J D;  3P4Q D;  4YSZ D;  2G3A A;  1YQ3 C;  4YTM D;  3VR9 C;  3ABV C;  2WU2 D;  1QLB C;  4YXD C;  3AEF C;  1PV3 A;  4YTP C;  1L0V D;  2WDR C;  1YQ3 D;  2WS3 D;  1OW8 A;  1NEK C;  1E7P C;  3ABV D;  3CIR C;  3P4P C;  3VR9 D;  3AEC C;  3AEF D;  4YTP D;  3AEB D;  3VR8 D;  3AE4 C;  2WDR D;  3CIR D;  3P4P D;  2H88 C;  3AE9 C;  4KX6 C;  3S9O A;  3P4R C;  3AE3 C;  3AEA C;  3AEC D;  3SFE C;  3AE4 D;  2H88 D;  4KX6 D; 
#chains in the Genus database with same CATH topology
 3P4R D;  1URQ D;  5AVQ B;  1NGM B;  2W6A A;  3D6Y A;  2OYO A;  3MZW B;  1SLQ A;  3L70 D;  2B9B A;  3IFM A;  1BSN A;  3H1L D;  1JY3 N;  3LIE A;  2PP6 A;  2K37 A;  3MUD A;  1KTM A;  1GK4 A;  4HYT B;  5B5E H;  5DJU B;  1AQT A;  1YTZ I;  5CCG A;  1QGK B;  3TNU A;  2KLU A;  1IFD A;  1FC2 C;  2WQY C;  3L4F A;  1R8E A;  4BRY B;  3S1K A;  3H1H J;  1MFT A;  1FZF A;  3SWY A;  2HG5 D;  1M1J A;  1H0T B;  1MZ9 A;  3G3Z A;  1VQO P;  3RK3 C;  3L72 J;  2Y0E A;  2XV5 A;  1SP4 A;  4W7Y A;  1L0N D;  2N9Y B;  2L91 A;  5H2F E;  1RQV A;  3VON A;  2ZFC A;  3H6P A;  1URQ B;  1HWT C;  1KIL D;  2N1T C;  1LT9 C;  1D7M A;  5APS A;  5AW5 B;  5AW8 B;  4Y99 C;  3AEB D;  4U7J A;  5KAF H;  4N3Y B;  1EQ7 A;  2WVR A;  3CLQ A;  5APX A;  5CCH A;  2OTJ P;  2H88 D;  2UWJ E;  2KSJ A;  4L74 A;  2XDJ A;  1EDI A;  2H89 C;  1LWU B;  3L74 J;  2FYU D;  3M9B A;  4OGQ C;  1HTL C;  2PGD A;  1NTM J;  3FWN A;  1T8Z A;  1Q82 Q;  3MUD C;  3GF7 A;  1FZC B;  1IK9 A;  3HD7 D;  4DDG A;  1YIJ P;  3L74 G;  3B5N D;  3I5C A;  1YI2 P;  4YTN D;  1FJK A;  1NTK J;  3WUT A;  3G71 P;  3V2N A;  1S2E A;  4YSY D;  1W2E A;  1U7J A;  1SQP J;  3GLM A;  2KI7 B;  5KLV G;  2QJK C;  5GTI E;  1NTZ E;  3L75 E;  1N73 C;  1IZN B;  3VRB C;  1M1J C;  4YSX C;  4TLF A;  4K3A A;  1FS0 E;  2K9Y A;  3II6 A;  1KIL B;  1N7S A;  3RL0 D;  2ACZ C;  1KF6 C;  4JPZ B;  2ZT9 C;  1PPJ G;  1QVG O;  5KJ7 D;  3TGU E;  3D71 A;  3VMY A;  2E43 A;  3H1J J;  2QM7 A;  1KN7 A;  4D6T J;  3A0B E;  1FZA A;  2ZXX A;  1EZV I;  3V5B A;  3AEF D;  3B4S A;  2HPC A;  1GL2 B;  1ZV8 A;  4JF7 A;  2WZ7 A;  4D6T G;  3W67 A;  2OYI A;  3HD7 B;  1N86 A;  2KZI A;  5AVT B;  3B5N B;  1SFC D;  3H1I E;  2KYV A;  1K8A Q;  1CI6 B;  3CX5 E;  3NFQ A;  1M8O B;  2FXM A;  1ZLL A;  1GZL A;  1J1D C;  2WP9 C;  3A7O A;  1VQK P;  1BGY J;  3UIA A;  1NTM K;  3NXS A;  3RBX A;  1EC5 A;  1Q81 Q;  2M8R A;  4L76 A;  1PGO A;  4YT0 D;  1WRG A;  5APW A;  1SQB D;  2Y0C A;  2GUS A;  3BAS A;  3Q2Y A;  1L4A D;  3SFD C;  1SQX G;  1NTK K;  1OX3 A;  3NMD A;  4YTM C;  3RL0 B;  1VQ7 P;  2IBZ E;  2PFX A;  3L73 J;  1L0V C;  1HUC A;  1H89 A;  1SQP K;  3AE7 D;  4H0L D;  3M9Q A;  2Q1K A;  5TIS H;  1MUU A;  5APY A;  1Q90 D;  2MJZ A;  1HJ0 A;  1NAY A;  3RBZ A;  1T6A A;  4RKU J;  2YXQ B;  1KC8 Q;  1FOS E;  1Y47 A;  3P4Q D;  1GDT A;  2FFD A;  2YIU B;  2WU2 D;  1QVF O;  5AW9 B;  3D6Z A;  1SFC B;  2QG4 A;  2POH A;  2WSS H;  3H1K D;  1RE3 C;  3CIR D;  5AW3 B;  2KIK A;  3MP7 B;  3CCR P;  3H1H E;  4HB1 A;  2I1J A;  1PP9 D;  3H32 B;  1E79 H;  4KX6 D;  4PD4 E;  3CWB J;  4AQR D;  1AQ5 A;  2A06 E;  1AVY A;  3SFE D;  2AEJ A;  2BS2 C;  1RF0 C;  1L4A B;  1SVF A;  1ZR4 A;  4PV1 D;  4EOT A;  3L72 E;  4WVZ A;  3AEE C;  1RY3 A;  1NH4 A;  1N8R Q;  1FZG A;  1G2C A;  5AVR B;  2JWA A;  4H0L B;  3AE6 C;  3AE3 D;  2HLO A;  1IFJ A;  1QL2 A;  3AED C;  3S4R A;  1VPC A;  5APV A;  1S3J A;  2FBW C;  3L37 A;  5KLI C;  3RL0 g;  3E7K A;  3SSU A;  2Q6Q A;  1JTH A;  1BCC D;  2WMM A;  1KIL C;  3B8E B;  1OVV A;  3GHG B;  3KYQ A;  3AEB C;  4K35 A;  1KB9 E;  3L74 E;  3TGU D;  1K9M Q;  3KHU A;  3R2P A;  4I7Z B;  4YSZ C;  1NTM E;  4C46 A;  2WU5 D;  3P4S D;  4NPF X;  1J1E B;  2PAJ A;  5C3J D;  1KZU B;  5KKZ B;  1T2K C;  2W90 A;  3VR9 C;  2SPZ A;  4OWF A;  1LT1 A;  2WDR C;  1IO4 A;  1YQ3 D;  1NTK E;  3V2P A;  1VF5 D;  3GMA A;  2O1J A;  1NWQ A;  3HD7 C;  3CC7 P;  3CI9 A;  5H2F H;  2K3R A;  1SQP E;  3N4X A;  1RF1 C;  3AEC D;  5APT A;  3H1I D;  4C7R A;  2BS3 C;  4W7Z A;  3RGU A;  4YSY C;  2M0B A;  1LP1 B;  1YIT P;  2CPS A;  5CCG D;  2WSC J;  4N78 D;  3BRV B;  1VQ5 P;  3I56 P;  1DEE G;  1HH0 A;  2NZ2 A;  1PGQ A;  3H1J E;  4AYC A;  3AEA D;  2AEM A;  1QX8 A;  2IBZ D;  2W6B A;  2L5G B;  3C8V A;  4WY4 D;  2E5T A;  1KFY D;  3VRA D;  1NTZ G;  3JCU E;  3L75 G;  2NPS C;  1ZP0 C;  1A02 F;  2Z5I A;  3HUS A;  2ZYD A;  3L71 J;  2WSC H;  1YQ4 D;  2RMZ A;  2WPV B;  2WDV C;  2B76 C;  3GF3 A;  3U1C A;  5GTI H;  1VF5 B;  4GIF A;  3CCL P;  2Z4E A;  1IFP A;  1BGY E;  3LID A;  1SQQ J;  4YPC A;  1VQ6 P;  2WPS A;  5CHX A;  1JM0 A;  2WTY A;  2D2C D;  3H1H D;  5CJ4 A;  2QJP B;  1UII A;  1J2J B;  1IK7 A;  3TNU B;  4DDI A;  1SQV J;  3L73 E;  3A0B H;  1RQU A;  2AXC A;  4TT3 H;  2IYP A;  1JOC A;  3IAO A;  1N7L A;  3PLN A;  2QE7 H;  1GTW A;  1SQV G;  4A7P A;  3PP5 A;  3AE7 C;  3E1I A;  2FYN B;  4ZKP A;  3OW2 O;  4WY4 B;  4JBZ A;  5C2T C;  3HTK A;  1YTZ T;  3A3Y B;  1X9V A;  2E74 D;  3WUU A;  2R44 A;  3CX5 H;  1KYO E;  1ZRT E;  1RE4 C;  2IFN A;  3P4Q C;  5E79 E;  2IBZ G;  2W8Z A;  2XZR A;  3L74 D;  3HUS C;  1VQ4 P;  1JY3 P;  3CWB E;  2K9J A;  4UB8 E;  1NEN D;  1HBW A;  3RK2 B;  1LTS C;  4H13 C;  4EDF A;  2G8Y A;  1X79 B;  2H8P D;  2D2C B;  1BE3 J;  5KLV D;  4I2L C;  2OTL P;  3TF5 A;  4O9B A;  1N2D C;  4GOD A;  1N73 A;  1PZQ A;  1SQQ K;  2FKW B;  1U7M A;  2E76 D;  2B89 A;  3P4P C;  3P7K A;  1NAF A;  1BE3 G;  4PV1 C;  2HOD A;  1PPJ D;  5AW4 B;  4YTP D;  1LTI C;  2Q3I A;  2IZ0 A;  3AE4 C;  3IN6 A;  1JY2 N;  1AA0 A;  3H1H G;  3L35 A;  3AE3 C;  1YBK A;  3V2R A;  4DHZ A;  2E74 B;  2WT7 B;  1SQV K;  2A06 G;  3T97 A;  2RKL A;  4U3F J;  2QJY C;  1L0L J;  2Q5U A;  3L72 G;  5AVZ B;  1AV1 A;  1Q2N A;  2E75 D;  4PD4 H;  5AVU B;  2IBZ I;  3P8C E;  5C39 A;  4D6T D;  3PJS K;  4XA4 A;  2RN0 A;  4CPG A;  4MN4 C;  1ZOY D;  2WU5 C;  2OYH C;  3ITK A;  2YXR B;  1GL2 D;  3L70 J;  2O01 J;  2AEF A;  1GMJ A;  3M91 A;  2AXT E;  3AE1 C;  3WMM 0;  3H1L J;  3HE4 A;  1VQ9 P;  1VF5 C;  2V7Q J;  1KQG B;  2OYI B;  3CXH E;  3FGA D;  3U59 A;  2E76 B;  1SQX D;  1NTM G;  1OW6 A;  4LGD E;  1DD4 A;  3CCS P;  3MTU E;  1H0T A;  1S9K E;  4BWN A;  5BU8 B;  1KB9 H;  1EDJ A;  1NTK G;  2HR3 A;  1NU1 J;  1UIX A;  2O01 H;  2XU6 A;  5DJT B;  3PH0 A;  1G1J A;  4OVN F;  1E5W A;  3RK3 E;  3KDP B;  1SQP G;  2C9L Y;  2V7Q H;  3M0A A;  3MGN A;  3S9O A;  5BVZ A;  3AEA C;  2E75 B;  2KXP B;  2YO2 A;  1NU1 G;  1LTJ C;  1AJY A;  1W2B O;  3L71 E;  3O6Q B;  5CMZ A;  3VRA C;  1LTB C;  1L0N J;  1KOR A;  2BEQ D;  1OVR A;  4L73 A;  2IFM A;  4ZKU A;  1MKM A;  2JEE A;  1RE3 A;  1T3U A;  1L0L K;  2WDQ C;  1K04 A;  1ZRT D;  4DHI B;  3H1J G;  1SQQ E;  1YYC A;  1VL2 A;  2A45 G;  4YXW H;  2KP8 A;  2JO1 A;  5CBO A;  1RF0 A;  3AE8 C;  3OA7 A;  4H44 D;  3O8Z A;  2V4H A;  2FYU J;  4EIJ A;  1SQV E;  3WU2 E;  3AEG D;  3KXD A;  4EI2 A;  2ZYA A;  1OWA A;  2KS1 B;  3AE2 D;  5AVS B;  3Q5S A;  2A45 H;  3F89 A;  2WWW A;  1VQ8 P;  3AE5 C;  3JCU H;  3HRN A;  1BGY G;  1OFC X;  1M56 D;  1USE A;  2HYN A;  3R4Y A;  3ABV C;  1KIL A;  1DIP A;  4W80 A;  3EFF K;  1G2C B;  1NU1 K;  5B66 E;  1S72 P;  1IC2 A;  5AW2 B;  4ZMD A;  3VR8 D;  3L73 G;  2ZVN B;  4XE5 B;  2YMK A;  3P4R C;  1URQ C;  4NPE A;  2WIT A;  1DH3 A;  3VMX A;  1FJP A;  4GOE A;  3VMZ A;  2W6J H;  1L0N K;  1M7L A;  3B71 A;  4QMA A;  1OIP A;  4FJV A;  2ZFY A;  1BE3 E;  3HD7 A;  4H44 B;  3B5N A;  1RF1 A;  1LWU C;  2QVA A;  1CI6 A;  1IFM A;  4IFM A;  3VOP A;  2J5U A;  4Y28 J;  1HGZ A;  1FZC C;  1JY3 O;  3V6I A;  1DEB A;  1NJI Q;  4JQ0 D;  3V2Q A;  1RH5 B;  3EQ2 A;  3MIW A;  1KYO H;  2OQQ A;  1USD A;  2WQY D;  3CWB G;  2RH0 A;  5AVY B;  3BRT B;  2XKM A;  5E79 H;  2KUB A;  1BDD A;  2J58 A;  1NYH A;  2BCC J;  4WBA A;  5KAI E;  4U3F E;  1SQB J;  1NKZ B;  1P84 E;  5KJ7 A;  1XTG B;  1L0L E;  1NTZ D;  3L75 D;  1X8Y A;  1FDO A;  2XND H;  1EXI A;  4NPD A;  4UB8 H;  2GUV A;  1NOH A;  2NPS A;  2BCC G;  3RK3 D;  1JO5 A;  3N7N A;  1KV4 A;  3K5B A;  1FDM A;  4HKZ H;  1EZV E;  1FBM A;  1WT6 A;  3L70 E;  4C7N A;  2N1T D;  2H88 C;  2WPQ A;  1JCC A;  4DHJ A;  3H1L E;  1SFC A;  1JMB A;  3Q1M A;  3HE5 A;  3FXE A;  2W27 A;  1GL2 C;  2KZJ A;  2JJL A;  2IPP A;  2CK3 H;  2M5A A;  5AW1 B;  1S5L E;  1HGV A;  1W5C E;  4PJ0 H;  2H89 D;  3H32 A;  3B5N C;  2E42 A;  3PHL A;  3H1K J;  5CBN A;  4YTN C;  1G1I A;  1OVU A;  1R5S A;  3CX5 D;  1NU1 E;  2YO3 A;  2H7H A;  1L2P A;  3P32 A;  1PP9 J;  1SQV D;  4L75 A;  3PTZ A;  1XTC C;  1S5L X;  1LGH B;  3TYY A;  4IOI H;  2WPR A;  2B87 A;  3BAT A;  3LW5 J;  1FZB A;  3Q5P A;  1OMI A;  3ZDM A;  1JMM A;  3RK3 B;  3RL0 C;  3PRJ A;  4WB4 A;  1GD2 E;  3VRB D;  1L0N E;  5KJ7 C;  2BS4 C;  2N9B A;  1RE4 A;  4YSX D;  2AXT H;  1SQB K;  5APQ A;  1A02 J;  1KIL E;  2Z5H A;  4IFD K;  4DOJ A;  2N1T B;  1LT9 B;  3VMA A;  2ACZ D;  1KF6 D;  2ZT9 D;  4Y99 B;  3CXH H;  4HH2 A;  3A2A A;  3MD0 A;  3HTK B;  4UB6 H;  1BCC J;  1VQP P;  3CC2 P;  3AEF C;  2WS3 D;  2Y9Z A;  1IFI A;  1FZE A;  2H43 A;  3LW5 H;  2YIU C;  5K5G B;  2ZAE B;  4Z1M H;  3D70 A;  2FYU E;  1KQF B;  5GTH H;  3OAK A;  3L71 G;  1SFC C;  4OGQ B;  3KZI E;  5AVV B;  1OXZ A;  2WSE J;  1K05 A;  3RK2 D;  1BE3 D;  5CCH D;  3USS A;  2Q3E A;  2WSF J;  4YT0 C;  1IJD B;  1SQQ G;  2I1K A;  4PD4 D;  1QLE D;  2A06 D;  1K73 Q;  1L4A C;  1LP1 A;  2QSI A;  2WP9 D;  2B88 A;  1JCD A;  2QJK B;  2QM8 A;  1N73 B;  3L36 A;  1M1J B;  3L72 D;  4IL6 E;  4B86 A;  5APU A;  3SFD D;  2KNC A;  2HOD B;  4H0L C;  1VQL P;  2ZJS E;  2O3J A;  3EWK A;  1EDK A;  2IDB A;  3JSV C;  1LTG C;  2ZT9 B;  3BCC J;  2WSF H;  2DW3 A;  3VR8 C;  1NKN A;  3SWF A;  4GDO A;  2OYH A;  2C0W A;  3WU2 H;  4WWI A;  3FXD A;  2K1A A;  3GHG C;  2WU2 C;  1N7S D;  3VTP C;  2YKP A;  4IL6 X;  3BCC G;  3F5H A;  3FX0 A;  1YJN P;  1KB9 D;  4LDT A;  3CD6 P;  3VP9 A;  3V4Q A;  1GK6 A;  2LKM A;  4I7Z C;  1NO4 A;  1OZH A;  4DJG A;  1NTM D;  2XNX A;  3CIR C;  4M3L A;  1J1E C;  3JC2 2;  5KKZ C;  2IZ1 A;  2M3E A;  1HF9 A;  1TFF A;  2ZVO B;  3VP8 A;  4KX6 C;  3OJA B;  3SFE C;  1AFO A;  4RES B;  1NTK D;  4DT0 A;  2M3B A;  5B66 H;  1J1D B;  1Y8A A;  1FOS F;  3TSI A;  2IYO A;  2BCC E;  3HE4 B;  1SQB E;  1SQP D;  1EXJ A;  1VDF A;  3CX5 I;  1LJ2 A;  3QH9 A;  1NU1 D;  3E1R A;  3VYI A;  2P10 A;  1X0T A;  2ZXE B;  3CCE P;  1LTJ A;  1MV8 A;  4PJ0 E;  3AE9 D;  4IFF A;  1JY2 P;  4GOF A;  3AEE D;  2JWD A;  4WY4 A;  1BSH A;  3Q3D A;  1QL1 A;  1Q7Y Q;  3AE6 D;  2HFE D;  3AED D;  3IR9 A;  1N7S B;  3H1J D;  2LXB A;  1HVV A;  1M1K Q;  2FBW D;  2JDI H;  4U3F G;  3KQG A;  1L0L G;  3P4S C;  2Q7C A;  4JYB A;  1LNQ A;  3CCQ P;  5C3J C;  2GA1 A;  1WMK A;  2R5B A;  1HJB A;  1DX7 A;  4DCK A;  3MHV A;  2P58 A;  2R5D A;  3TK1 A;  4HJG H;  3H1K E;  3A0H H;  3NTN A;  1KMI Z;  1YQ3 C;  3WUV A;  4KJM A;  2HPC B;  5KAI H;  1ZN5 A;  4YSZ D;  5BU5 A;  1EZV G;  1P84 H;  2QRX A;  4I6L A;  1T2K D;  3VR9 D;  1PP9 E;  2OAR A;  1BGY D;  3L70 G;  3AEC C;  4BRY A;  2GM4 A;  4UB6 E;  2WDR D;  1PFI A;  2Y0D A;  3H1L G;  4XFJ A;  3A5T A;  5EFW B;  2FXO A;  5KLV J;  1YHQ P;  1M57 D;  2QJP C;  4PD4 I;  5CCG C;  2KK7 A;  5GTH E;  3GG2 A;  2IX7 C;  3QWO C;  1TU3 F;  3L73 D;  4YXD D;  2BEZ F;  3CC4 P;  4ZNC A;  2WT7 A;  1CSB A;  5L8R J;  1JNM A;  1NEK D;  1RHZ B;  1URQ A;  5KLI B;  1BCC E;  1S5L H;  2VRS A;  2FYN C;  4WY4 C;  2KLV A;  1KFY C;  3M0D A;  3M9H A;  1Y9B A;  1P84 I;  2I8D A;  4N6J A;  4KT0 J;  2P67 A;  1YQ4 C;  1KYO D;  5TJH A;  1BDC A;  2WS3 C;  1LWU A;  1L0N G;  2NPS D;  1ZP0 D;  2FFD B;  2Q9I A;  1KB9 I;  5CJ0 A;  1U57 A;  3CL3 D;  1FZC A;  2J59 M;  2WDV D;  3V4W A;  2B76 D;  3CWB D;  3RK2 C;  5CCH C;  1LTA C;  2NRG A;  2D2C C;  2O1K A;  1RF1 B;  1SS1 A;  3M06 A;  5AW6 B;  2FYU G;  1M90 Q;  2FXP A;  4LC1 A;  1SQX J;  2OGU A;  1GW3 A;  2BCC D;  4N78 E;  1FE6 A;  3BCC E;  3CCV P;  1ZXG A;  5KLV K;  4EYY Q;  1JEK A;  5B5E E;  2LR2 A;  3IF4 A;  2Y9Y A;  2E74 C;  1CW5 A;  3GW6 A;  3KZI H;  4ASV A;  2JR8 A;  3O6Q A;  1VQM P;  3FWL A;  1FU1 A;  2C0X A;  5C2T D;  1JTH B;  3EFG A;  1GL2 A;  1N7S C;  2NPS B;  1GU5 A;  3M0D C;  1YJ9 P;  3P8C D;  2A45 I;  1S1C X;  4RO0 A;  1NEN C;  4C7N B;  4I1L A;  4IL6 H;  3CME P;  4GKG A;  3HE5 B;  1NVO A;  1EDL A;  2KS1 A;  3C1L A;  4DZO A;  2M5A B;  4H13 D;  2R3C A;  2LXC B;  2OYI C;  1QEX A;  2E76 C;  3TDK A;  1FDI A;  2P2U A;  3CXH D;  1H8A A;  2FYU K;  3CCU P;  2QEX P;  4YTP C;  5KAF E;  3G4S P;  1OW8 A;  4R4M A;  3A0H E;  1S9K D;  4KHX A;  3G9R A;  3P4P D;  3AE9 C;  2ZYG A;  3U1A A;  1SQX K;  3AE4 D;  2P7J A;  2OTK E;  1SQB G;  2B87 B;  2R3S A;  3BVH A;  2E75 C;  3CCM P;  1FAV A;  3H25 A;  1JY2 O;  2E5Y A;  2C9N Y;  1OW7 A;  3L71 D;  1ZOY C;  5AVX B;  1YJW P;  4JYC A;  4R4L A;  1GW4 A;  1VQN P;  1KYO I;  3I55 P;  1CZQ A;  2KB7 P;  3HUS B;  1SQQ D;  2FY8 A;  2ITA A;  1LTT C;  1ZR2 A;  4H13 B;  2FFD C;  4OH8 B;  5M1B A;  4OGQ D;  1PL5 A;  2JKV A;  5KLV E;  1L4A A;  3AE1 D;  3G6E P;  3W68 A;  3H1K G;  1MFZ A;  4PV1 B;  1PPJ E;  2KOG A;  2P1J A;  2K88 A;  3SWK A;  4YXD C;  1PP9 G;  1PV3 A;  5AVW B;  1ZME C;  1NEK C;  1E7P C;  2MKV A;  1PGJ A;  5KTB A;  4I6M C;  3BCC D;  3CPW O;  3GHG A;  3P8M C;  2QJY B;  1NTZ J;  3L75 J;  4RJT A;  1S4X A;  2KNC B;  3CCJ P;  2PRR A;  4D6T E;  1PGP A;  3KPE A;  2YNY A;  2FYZ A;  2BAS A;  1DD3 A;  1KD1 Q;  2OYH B;  2YKO A;  3TGU J;  1T3J A;  1BCC G;  1JB0 J;  1Z56 A;  5AW7 B;  2WDQ D;  4GT1 A;  4ASW A;  4H44 C;  4LLH A;  2O01 N;  1JUN A;  3AEG C;  2CPB A;  1AVO A;  3TGU G;  1KFM A;  2K9J B;  4AUW A;  1KFN A;  3AE2 C;  1SQX E;  5TIS E;  2W83 C;  1NHL A;  2KSE A;  3AE8 D;  3C9I A;  3VN0 A;  1R5L A;  3H1I J;  4BXL A;  2JP3 A;  3CXH I;  2QA4 P;  1H88 A;  3AE5 D;  3CMA P;  1KQS O;  2WSE H;  2YMY A;  2G3A A;  1KQL A;  4YTM D;  4U3F D;  1PIX A;  2R32 A;  1QLB C;  3H1I G;  1P84 D;  1L0L D;  1ZW0 A;  1L0V D;  2YKQ A;  3ABV D;  1LTJ B;  2N1T A;  1X22 A;  1LT9 A;  3T97 B;  2QIW A;  1GU4 A;  3Q5R A;  1IFN A;  1EZV D;  1Q86 Q;  5AW0 B;  1NTZ K; 
#chains in the Genus database with same CATH homology
 3P4R D;  1NGM B;  2QJP C;  2WSE J;  3D6Y A;  4YSY C;  1K05 A;  3VRA C;  3SFE D;  1KOR A;  2BEQ D;  2H89 C;  2BS2 C;  2E75 C;  2QJY C;  1TU3 F;  3H25 A;  4OGQ C;  4YXD D;  2E74 C;  2BEZ F;  1EXJ A;  2WSC J;  2WSF J;  3B71 A;  3AE7 C;  4YT0 C;  1DD3 A;  5L8R J;  1OW7 A;  1MKM A;  2H89 D;  2WP9 C;  1NEK D;  2E75 D;  3AE8 D;  2WDQ C;  5C2T C;  4PV1 D;  4H44 B;  1ZOY C;  3O6Q A;  1K04 A;  3AEE C;  3GF7 A;  2E74 D;  1KTM A;  2P10 A;  1JB0 J;  2NZ2 A;  4YT0 D;  4YTN C;  2QSI A;  1VL2 A;  4R4L A;  2WP9 D;  5C2T D;  2WDQ D;  3AE9 D;  1ZOY D;  4H0L B;  3AE6 C;  3AEE D;  3AE3 D;  2FYN C;  3AEA D;  3Q2Y A;  2WU5 C;  1ZRT E;  3AED C;  1KFY C;  4YTN D;  3SFD C;  2JO1 A;  2J5U A;  3Q3D A;  4H44 C;  1Y9B A;  4Y28 J;  3AEG C;  3P4Q C;  3AE8 C;  2FBW C;  3AE6 D;  4YTM C;  3C8V A;  2WQY C;  4KT0 J;  1S1C X;  4YSY D;  5KLI C;  3AE2 C;  3RL0 g;  1KFY D;  3AED D;  3SFD D;  2O01 J;  3VRA D;  4H44 D;  4H0L C;  1S5L X;  3GLM A;  1R8E A;  4H13 B;  1GMJ A;  1YQ4 C;  3EWK A;  2OQQ A;  3AEG D;  5M1B A;  1L0V C;  2QJK C;  2IDB A;  4OGQ D;  2FBW D;  3AE1 C;  1PL5 A;  1ZP0 C;  3LW5 J;  1NEN C;  2WQY D;  2WS3 C;  3VRB C;  3AE2 D;  3AE7 D;  2H88 D;  3Q5S A;  2ZT9 B;  3Q5P A;  1VF5 C;  2V7Q J;  4H0L D;  1OMI A;  1KQG B;  3AEB C;  1YQ4 D;  4YSX C;  3VR8 C;  2WPV B;  1NEN D;  1ZP0 D;  3AE1 D;  4GDO A;  1NYH A;  2K9Y A;  3AE5 C;  3P4S C;  3VRB D;  2WDV C;  3FGA D;  4H13 C;  2E76 B;  2BS3 C;  2JP3 A;  1U57 A;  1OW6 A;  2G8Y A;  2B76 C;  3GF3 A;  2BS4 C;  4YSX D;  4I7Z B;  1Q90 D;  1WMK A;  1VF5 B;  2D2C B;  1KF6 C;  2ACZ C;  4YSZ C;  2ZT9 C;  5C3J C;  1FDO A;  1HJ0 A;  1DD4 A;  1KIL E;  2WU5 D;  3AE5 D;  2WDV D;  2WU2 C;  3P4S D;  4H13 D;  4RKU J;  1EXI A;  4IL6 X;  2B76 D;  4PV1 B;  2ACZ D;  1KF6 D;  5C3J D;  3P4Q D;  4YSZ D;  1KMI Z;  1YQ3 C;  2E76 C;  2G3A A;  2ZT9 D;  3R4Y A;  1FDI A;  3D71 A;  1PIX A;  3ABV C;  4YTM D;  3VR9 C;  2WU2 D;  1QLB C;  4I7Z C;  1RQV A;  4YXD C;  2D2C C;  3AEF C;  1PV3 A;  4YTP C;  1ZME C;  1UIX A;  1DIP A;  3D6Z A;  1L0V D;  2WDR C;  1YQ3 D;  2E76 D;  2WS3 D;  1OW8 A;  4R4M A;  1NEK C;  1E7P C;  3ABV D;  3CIR C;  3P4P C;  3VR9 D;  2MKV A;  4PV1 C;  3AEC C;  5KKZ C;  1VF5 D;  2D2C D;  3GMA A;  3RK3 E;  3AEF D;  4YTP D;  3T97 B;  3G9R A;  3AEB D;  2YIU C;  4U7J A;  3VR8 D;  2FXP A;  3AE4 C;  2QIW A;  3IN6 A;  1HF9 A;  2WDR D;  3CIR D;  2YMK A;  3P4P D;  2H88 C;  1IK7 A;  3AE9 C;  4Z1M H;  3S9O A;  3D70 A;  4KX6 C;  3P4R C;  3AE3 C;  3AEA C;  1KQF B;  2E75 B;  3Q5R A;  3AEC D;  4XFJ A;  1RQU A;  4OGQ B;  3SFE C;  2E74 B;  3AE4 D;  4TT3 H;  3Q1M A;  1AJY A;  4KX6 D;  3IAO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...