3SFDC

Crystal structure of porcine mitochondrial respiratory complex ii bound with oxaloacetate and pentachlorophenol
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
138
structure length
138
Chain Sequence
b'TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Thiabendazole inhibits ubiquinone reduction activity of mitochondrial respiratory complex II via a water molecule mediated binding feature.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 49
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2011-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3sfdC01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3sfdC02
2G3AA 2WS3D 3P4SD 2WS3C 3P4SC 4YT0C 3AEED 3AE3D 3AEEC 3AE3C 1PV3A 4YSXD 1OW8A 2WDQD 4YSXC 2WDQC 3AECD 3CIRD 1ZOYD 2H88D 3CIRC 1ZOYC 2H88C 4KX6D 3B71A 2BS4C 4KX6C 4YTPD 2BS3C 4YTPC 3AE2D 2ACZD 3AE2C 1L0VD 2ACZC 5C3JD 1KTMA 1E7PC 1L0VC 2WP9D 4YT0D 3SFDD 3SFDC 1KFYD 2WP9C 5C3JC 1KFYC 4YSYD 4YSYC 3AEAD 3AEAC 3VR9D 3AEDD 3VR9C 3AEDC 2BS2C 3AE1C 3S9OA 3AE7D 1YQ4D 3AE7C 4YXDC 1YQ4C 3AEGD 3AEGC 3AEFD 3AEFC 2WDVC 1OW7A 3AE5D 3VRAD 3AE5C 3VRAC 3AE6D 4YTMD 4YTND 3AE6C 4YTMC 4YTNC 3VRBD 3VRBC 2H89D 1K04A 3AE4D 2H89C 1NENC 3AE9D 3AE4C 3AE9C 2FBWD 3P4QD 2FBWC 2WDRC 3P4QC 3SFED 3AE1D 3VR8D 3SFEC 1KF6C 1YQ3D 3VR8C 1YQ3C 4YXDD 1NEKD 5C2TD 1NEKC 3ABVC 5C2TC 2WDVD 4YSZD 3AE8D 2WU5D 4YSZC 3AE8C 2WU5C 1OW6A 3P4PD 3P4PC 2B76D 1NEND 1QLBC 2B76C 2WDRD 1K05A 3AEBD 3AEBC 1KF6D 3AECC 2WU2D 3P4RD 2WQYD 1ZP0D 2WU2C 3P4RC 2WQYC 1ZP0C 3ABVD
chains in the Genus database with same CATH superfamily
1GD2E 1T2KD 1FS0E 1OIPA 3BCCD 1BE3G 3O6QA 5CCGD 2M5AB 3D71A 4HYTB 1X22A 1D7MA 1YI2P 3C1LA 2WSFJ 4QMAA 1SLQA 1KMIZ 3CC4P 1LP1A 2QIWA 3QWOC 1JY3P 3FGAD 5CCGA 1VQLP 3P7KA 2A06D 3L4FA 5AVTB 1W2BO 2IX7C 3HTKA 2XNXA 3AEAC 3NTNA 4R4MA 1EDIA 1MFTA 2IBZG 1XTGB 4H44D 4ZMDA 2NPSC 4KT0J 2OYHC 1AFOA 1SQPJ 3USSA 3MUDC 2Y9ZA 4Y99B 1S9KD 1SQQJ 2FBWC 1YJNP 2Q1KA 3Q1MA 2A45G 1AA0A 4IL6H 1IFMA 1MZ9A 3TSIA 2ZJSE 1SQBE 1N73C 1L4AB 5AVRB 3I56P 2Q3EA 3V2NA 1VF5B 1NAYA 2P1JA 1DX7A 1ZV8A 4NPDA 2J59M 4XA4A 1KQGB 1NU1D 4ZKPA 1GL2B 2KK7A 3L71E 3V2PA 1T2KC 2AXCA 2KXPB 1Q82Q 3R2PA 4U3FJ 2KB7P 3TK1A 4DHIB 1PGQA 2MJZA 2V7QH 3H1IG 4UB6H 2FXPA 3H1KJ 1PPJE 1HJ0A 2BCCG 2WP9D 3CMEP 1RF1B 1FAVA 1MUUA 3PP5A 3AEDD 3H1LJ 1Q86Q 2OARA 3E7KA 2RN0A 3RK3B 2MKVA 3CWBJ 1EXIA 4H44C 4PD4E 3VN0A 1PIXA 2O1KA 4RESB 3KZIE 3TGUJ 1DEEG 3EFFK 2KS1B 3E1IA 3L72E 3VR8D 2Y9YA 2WT7A 5KKZB 4YSZD 1GK4A 3TYYA 1SQPG 2FYNB 1SQQG 4JQ0D 2B76D 1BSHA 1QLBC 4WY4A 2BASA 2O01H 1X8YA 2B9BA 1KF6D 3KDPB 3LW5H 1ZRTD 1VL2A 2CPSA 1G1JA 1PP9D 3L74D 1K9MQ 1L0LE 1M1KQ 1NHLA 3A0BH 1NTMK 2AEJA 4TT3H 1DEBA 1Y47A 5AW8B 2XV5A 1OW8A 3AECD 2YIUC 2YMYA 2OTJP 5E79H 1JCCA 2J5UA 1NO4A 2WP9C 4HKZH 4C7NB 1SQBJ 3P8CE 4L76A 1P84I 3FXEA 3AEDC 2BEZF 4I6LA 2A06G 4I1LA 3EWKA 5GTHE 2B89A 2QJKC 2QJYB 3AE5D 3VRAD 3JC22 5APVA 1JUNA 1N8RQ 1BGYD 4N78D 5APXA 4DDIA 1NENC 3L71J 3H1LG 2GA1A 3VR8C 5KLVK 3CWBG 1WT6A 4LC1A 2LKMA 2WSCH 4YSZC 3CCMP 2HYNA 1KILB 1URQD 2G8YA 2O01N 2YKPA 1JMBA 4IOIH 2B76C 1LTGC 1A02J 1GZLA 2N1TB 1L0ND 2GUVA 1MV8A 5APWA 1N7SA 1TU3F 4BRYA 1PFIA 3ABVD 1LWUB 4EDFA 5CHXA 3QH9A 5APYA 1EQ7A 3HUSC 1KN7A 2WVRA 1BE3D 1JCDA 2KUBA 1P84E 1FZCB 1GU4A 3K5BA 2KLVA 3Q5RA 2JR8A 3RK2D 2BS3C 1RHZB 3L72J 1GMJA 3EFGA 1G2CB 1SQXG 3L75G 5AW5B 2K37A 1T8ZA 3CCJP 1YIJP 4DZOA 1T3UA 2P10A 4GOFA 4DT0A 3U59A 1Q90D 3AE5C 3VRAC 2Q3IA 3GF7A 2E75C 1M56D 3CPWO 3GW6A 1NTZK 2IBZD 4FJVA 1RE3A 1SQBG 3WMM0 1L0LJ 4I6MC 1LT9A 1RY3A 1HH0A 2KYVA 3GMAA 4YXDD 4Z1MH 1L4AD 4PV1D 2AEFA 3U1AA 1URQC 4MN4C 2I8DA 1GW3A 2ZYDA 3L71G 1K05A 3RBZA 2VRSA 1M7LA 1BCCE 1L4AA 1AVYA 1YITP 3S1KA 1ZR4A 3MP7B 3CCRP 1CI6B 2NZ2A 1GL2D 3G3ZA 2QEXP 1JMMA 3P32A 2WS3D 2IYPA 3UIAA 3BVHA 2JWDA 3GLMA 3NXSA 1KYOE 2XNDH 2W90A 1HTLC 3Q3DA 1TFFA 3BATA 3VYIA 2NRGA 1S3JA 4IL6E 1FZEA 3RK2C 2FYUE 3H25A 3H1ID 1J1DB 4ASVA 2K9JA 2BCCD 2OTKE 5B66H 1LTBC 1NTKK 1RE3C 1JY2N 3RK3D 4B86A 2QG4A 1JY2P 3AEFD 1RF1A 3V2QA 2E74B 4Y99C 2Q9IA 1M1JB 1XTCC 1IFPA 1YQ3D 3L73E 1GTWA 2M3BA 2ZYAA 1L4AC 1ZXGA 1M90Q 4UB6E 4PV1C 2KS1A 3L70E 3M0DC 2KLUA 3VONA 1L0LG 2YKOA 5B5EH 1SQPD 2NPSA 1JOCA 3CLQA 1QVGO 3V6IA 2Z5IA 2QE7H 1SQQD 5AVUB 2A45H 3MUDA 2R5DA 1GL2C 2E42A 1E5WA 2WS3C 2PGDA 1Q81Q 1LT1A 1J2JB 3PLNA 3WU2E 1W5CE 1UIIA 1FZBA 2YXQB 4A7PA 3RL0D 5C39A 4WBAA 2FXMA 2CK3H 2BS4C 2JEEA 1GU5A 2D2CB 1L0VD 4AYCA 1NTME 1S9KE 1RF1C 4HJGH 4H0LB 1J1EC 4Y28J 1JNMA 2LR2A 2Z5HA 4WWIA 2P67A 1YTZI 3RK3C 3ITKA 3MD0A 3AEFC 2WDVC 1OW7A 1S72P 1LGHB 3CCVP 1BCCJ 5K5GB 3WUTA 3H1HG 1K04A 3A0BE 1GDTA 1EZVE 2HPCA 3L36A 2W6AA 1OXZA 2KNCA 1YQ3C 2QJPB 1RH5B 5AW0B 5C2TD 5KKZC 3H1LD 2Y0DA 2WSFH 2K1AA 3MGNA 5AW1B 4N3YB 1BDDA 2QSIA 3TDKA 3P4PD 5E79E 1OVVA 4L73A 4AQRD 3CWBD 1LTJA 3OJAB 3N4XA 1EDKA 5CCHC 2WQYD 5KLVE 3TNUA 1KB9E 3A0HE 2FFDB 2R5BA 3FX0A 1JM0A 1IFIA 2HR3A 3RL0C 1A02F 2ZAEB 2WPRA 1SFCD 1LWUA 1YYCA 2OYIB 1VPCA 1ZOYD 4PJ0H 3CI9A 1DD4A 3CXHD 3L73J 4OWFA 4JYBA 1L0VC 2FYUK 1LTSC 4UB8E 4YSYD 1SFCA 1ZW0A 1X0TA 1EXJA 2XKMA 3BASA 3L70J 1SVFA 1IZNB 5AVVB 1SQXD 2YO3A 2H43A 2IPPA 2ZFYA 3L75D 2OTLP 1M8OB 3VTPC 1FZFA 4L75A 2WMMA 1EC5A 1N2DC 3IFMA 1SQVK 2HLOA 2L91A 4DHZA 2I1JA 3IAOA 1HJBA 1LTJC 1IC2A 4C7RA 1SQBD 3P8MC 5APSA 3RL0g 5C2TC 1ZRTE 1NH4A 1PP9E 1BCCG 2CPBA 2W6BA 1NKNA 1NTZE 1T6AA 3P4PC 3A2AA 1NEND 4IFFA 3M9HA 1RF0A 2N1TC 1NTMJ 2KSEA 2WQYC 1NJIQ 2LXBA 4IFDK 3N7NA 3L71D 2K88A 3HE5B 1LWUC 2ZXEB 1NKZB 2O01J 1AQTA 3H32A 2PP6A 3LW5J 1YHQP 1SFCC 5KJ7C 2OYHB 4OGQB 3T97A 1ZOYC 1FZCC 1KQFB 2E43A 2Y0EA 1KFYD 3A7OA 4DHJA 4YSYC 1FE6A 4YPCA 3HD7B 2BS2C 1YQ4D 2E76B 3TF5A 1NGMB 4PD4D 1BDCA 2IBZI 3CXHH 3KHUA 2IFMA 3O8ZA 4YTMD 5KLVJ 1RQUA 2ZVNB 1SP4A 1PL5A 2E74D 3HUSA 4U3FG 4DCKA 3O6QB 3L70G 1VQMP 4D6TE 1NTKE 2WSEJ 5BVZA 2JJLA 2UWJE 2A45I 1NU1K 1AVOA 1G1IA 1RF0C 3H1KG 1LP1B 1KV4A 2E75D 1M1JA 3VMZA 3HTKB 3HE4A 2W83C 2WSCJ 2N9BA 3H1JE 2HFED 5B66E 1KFMA 2JO1A 1L0LD 4BXLA 1U7JA 2LXCB 3L35A 3V4WA 2B87A 3AE3D 3TGUG 1DD3A 3MTUE 2WPSA 2ZT9B 1NTMG 4RKUJ 4OH8B 1FDIA 5AVWB 1NWQA 2L5GB 2H88D 5KTBA 4ZKUA 3B71A 1URQA 2C0WA 2C9NY 2IBZE 1KFYC 1J1DC 4H0LD 1VQ5P 5M1BA 5BU5A 1NTZJ 2YMKA 1YQ4C 2POHA 5B5EE 1EZVG 3GF3A 1LTAC 4IFMA 2M5AA 1ZLLA 4GODA 4YTMC 4K35A 1LTTC 2E74C 1VQPP 5GTIH 3M9QA 5KAFH 2WDRC 1M1JC 5CBNA 4PD4H 4XE5B 3H1HD 3PTZA 2KIKA 1HGVA 2WU5D 5AVZB 2I1KA 2KZJA 1S5LX 2FYZA 4HH2A 1FBMA 1H88A 3SSUA 3P4RD 5AVQB 4GIFA 2ITAA 5DJTB 5L8RJ 1H8AA 1YBKA 1K8AQ 3WUUA 2Z4EA 3H1IE 1QVFO 3AE3C 1VF5D 1QLED 1S4XA 2BCCE 1FC2C 1JTHB 2AXTH 2XZRA 3M0DA 2H88C 2WT7B 3B5NB 4D6TJ 1NTKJ 1IFDA 2K9YA 1IK7A 3JSVC 1VQ7P 1FOSF 1HF9A 1IJDB 1LNQA 4JYCA 3PH0A 1PPJG 4H0LC 1R8EA 4RO0A 4WY4B 1GL2A 1GK6A 3G9RA 4HB1A 3M91A 2H8PD 3CC2P 3AEGD 2E5TA 1QGKB 4C46A 3SWFA 3MZWB 4WB4A 3FWLA 3H1JJ 1W2EA 3LIDA 1Y9BA 1U57A 2QRXA 5DJUB 1L0NK 1NTZG 1SQQE 2QJPC 1FOSE 3WUVA 3M9BA 1VQNP 1NEKD 2WDVD 4I2LC 2WU5C 3L72G 4KJMA 1JEKA 4PJ0E 2OYOA 1SQVE 2XDJA 1PGJA 3NMDA 1BCCD 1RQVA 2AEMA 3SWKA 1KQSO 2WWWA 3P4RC 1YJWP 1ZR2A 5AW9B 3CCSP 3BCCE 1HGZA 1KYOD 4GT1A 1Z56A 2WPVB 1S5LH 4ZNCA 1VF5C 2WZ7A 1PV3A 3Q5PA 3D70A 3PJSK 2O3JA 1JY3O 3C8VA 2WDQD 5CCHD 4DDGA 3CX5D 3CXHI 1VQ6P 4OGQD 2OYIC 1H0TB 4H13B 2A06E 3JCUH 5KAIH 3Q2YA 1IFNA 3GHGB 1H89A 5CCHA 3F5HA 3HD7D 2O1JA 2E76D 3FXDA 1KQLA 2FKWB 3AEGC 5TISH 3CCEP 1WRGA 1N7SB 1CZQA 2R3CA 4D6TG 1NTKG 2P2UA 4BRYB 4YTND 3NFQA 2WITA 2R3SA 1OX3A 1QEXA 3HD7A 3CCLP 3P4QD 3V5BA 3SFED 4NPEA 3H1IJ 4U3FD 1NEKC 4GOEA 3AE8D 2RMZA 2BCCJ 3KQGA 3L70D 5APTA 4C7NA 3H1JG 1K73Q 4NPFX 3H1KD 2GUSA 1OMIA 2RH0A 1X9VA 4YXWH 1NU1E 1JY3N 5AW7B 2P58A 3BRVB 3RK2B 2G3AA 3F89A 2KI7B 3CXHE 3RGUA 4YT0C 1KILD 2WSSH 3E1RA 5BU8B 2YO2A 2Q7CA 2FYNC 2N1TD 2WDQC 2FYUJ 1RE4A 2ZT9D 1SQXE 3TGUD 1LT9B 3L75E 1MFZA 2B88A 4OGQC 1GW4A 2C0XA 1KILA 1KYOH 3V4QA 3VMXA 1NTMD 1KTMA 4I7ZB 3A5TA 1VDFA 2KOGA 2N1TA 2SPZA 3CX5H 4PD4I 1USDA 3M0AA 3AE1C 3IR9A 1IO4A 3HD7C 5KJ7D 1SQVJ 2E76C 2WTYA 4PV1B 1KFNA 3AE6D 1E79H 4YTNC 2H89D 1EZVD 3KXDA 1ZMEC 5KJ7A 3MIWA 3P4QC 2V7QJ 2PAJA 1N86A 3SFEC 1FZCA 3BCCJ 2QA4P 1SQPK 3ZDMA 2W8ZA 1SQQK 3IN6A 1G2CA 3AE8C 3VMYA 2QJYC 1OZHA 5CJ4A 3U1CA 3CC7P 5CCGC 3II6A 5AVXB 1HBWA 2K9JB 2HODB 5KLVD 1KB9D 1ZP0D 5KLIB 1VQOP 3OW2O 4EIJA 1RE4C 3L74E 1EDJA 4N6JA 5H2FH 1UIXA 1FZGA 1J1EB 1KILC 5APUA 5AW3B 5CMZA 1VQ9P 5GTIE 2KP8A 4TLFA 5KAFE 2ZT9C 3G71P 1FU1A 2OQQA 3WU2H 3VOPA 2Q6QA 3B5ND 3KPEA 2E5YA 5C3JD 3BRTB 1JTHA 5CJ0A 3W68A 1CI6A 4WY4D 2FYUG 4OVNF 3B5NA 1VQ8P 3A3YB 2NPSB 3OA7A 2QM8A 2WPQA 1PPJD 2ZYGA 4BWNA 3AE6C 1NU1J 4DJGA 3VRBD 1USEA 2H89C 3G4SP 1BGYE 3AE9D 4N78E 1U7MA 2ZVOB 2ZFCA 1PGPA 2FY8A 1Q2NA 1SQVG 1N73B 1PGOA 2AXTE 2YXRB 1T3JA 1NTZD 3L73G 1SQXJ 1LTIC 3L75J 1QL1A 1KD1Q 3RL0B 2WDRD 4R4LA 3L72D 2V4HA 3BCCG 1L0NE 2W27A 4LLHA 5AW4B 5AW6B 1ZP0C 4LDTA 3LIEA 3D6ZA 3HRNA 3P4SD 1R5LA 1YTZT 4JF7A 1Q7YQ 3AEED 3M06A 1NVOA 2JWAA 1X79B 1SS1A 3I5CA 1KB9H 3VMAA 3A0HH 2HPCB 1M57D 3PHLA 1BE3E 2IZ1A 1SQXK 2KNCB 2WSEH 1HWTC 1OVRA 4H13D 3AE2D 3B5NC 2ACZD 2JKVA 3SFDD 5C3JC 1MKMA 3VR9D 4W7ZA 1LTJB 3B4SA 3S9OA 3AE7D 1Y8AA 1KC8Q 4WY4C 4U7JA 1H0TA 4H44B 3H1HE 1SQBK 3W67A 3TNUB 4UB8H 4KHXA 3D6YA 1N7SD 3GHGA 1IK9A 2D2CD 3VRBC 3P8CD 1QL2A 3AE9C 2JDIH 1KORA 4D6TD 1NTKD 1PP9J 3L74J 1VQKP 2Q5UA 2R32A 1KF6C 1S5LE 4ASWA 3VP8A 3PRJA 4LGDE 4DOJA 2ZXXA 1YJ9P 1OW6A 4AUWA 1NU1G 2IYOA 2XU6A 3Q5SA 1NOHA 1VQ4P 3JCUE 4WVZA 5KAIE 3AEBD 1SFCB 3AECC 3H1JD 2WU2D 1CSBA 3KYQA 1WMKA 1KYOI 3VP9A 3KZIH 2HG5D 4W7YA 1N7LA 3P4SC 3B8EB 1S1CX 5TISE 4GKGA 2KZIA 5KLVG 1S2EA 1IFJA 3AEEC 4EI2A 2KSJA 3CX5I 4GDOA 4W80A 2DW3A 4YSXD 2YIUB 2JP3A 2IZ0A 3CIRD 1BGYJ 4KX6D 2J58A 1R5SA 4YTPD 4H13C 3AE2C 2ACZC 1E7PC 1FJPA 3SFDC 1EDLA 3GHGC 2H7HA 1NYHA 1JY2O 3VR9C 2FFDA 5TJHA 1DH3A 3CMAP 3AE7C 3FWNA 1AV1A 2IDBA 1P84D 2QJKB 3CCQP 1FZAA 3RK3E 1FJKA 1N7SC 1L0NJ 2D2CC 2QM7A 3AE4D 3H32B 2OYIA 3IF4A 1QX8A 3ABVC 3T97B 1L0LK 1ZN5A 1HVVA 1BE3J 1DIPA 1CW5A 3G6EP 1FDMA 5GTHH 4CPGA 1PP9G 3AEBC 3L74G 4O9BA 2PRRA 1KZUB 1L2PA 4L74A 1AJYA 1SQPE 3R4YA 5AVSB 3CX5E 2WU2C 1HUCA 3OAKA 5EFWB 3L37A 3EQ2A 1AQ5A 2PFXA 2BEQD 3H6PA 3H1HJ 5AW2B 5APQA 2K3RA 2HODA 4RJTA 5AVYB 3RBXA 3HUSB 2YKQA 4JPZB 2IFNA 4YSXC 1OVUA 3SWYA 4EOTA 3CIRC 1LT9C 2FFDC 1LJ2A 4XFJA 4KX6C 4YTPC 2R44A 4YT0D 2FXOA 4I7ZC 3MHVA 3AEAD 2RKLA 2C9LY 4IL6X 1JO5A 4EYYQ 2GM4A 4YXDC 4JBZA 1OFCX 4U3FE 1BGYG 3HE4B 3HE5A 2NPSD 1BSNA 1EZVI 2E75B 5CBOA 2M8RA 2FYUD 2M0BA 1FDOA 3S4RA 3AE4C 2B87B 3C9IA 5H2FE 2FBWD 3H1KE 1OWAA 3CD6P 1P84H 2OYHA 3AE1D 2W6JH 1NAFA 3CCUP 4M3LA 1PZQA 2Y0CA 2P7JA 3H1LE 1L0NG 1URQB 2OGUA 2QVAA 1SQVD 1KILE 3I55P 1KB9I 3CL3D 3CWBE 4K3AA 2M3EA 3GG2A 1N73A 2YNYA 3L73D 2N9YB 3TGUE 5KLIC 3V2RA 1JB0J
chains in the Genus database with same CATH topology
1VL2A 5L8RJ 2JO1A 2G3AA 3D6ZA 2WS3D 3P4SD 2BEQD 2WS3C 3P4SC 1S1CX 1UIXA 4YT0C 2O01J 3AEED 4TT3H 3ABVD 3AE3D 3AEEC 3O6QA 3GLMA 3AE3C 2WPVB 3D71A 4GDOA 1DD3A 1VF5D 2FYNC 1VF5C 3Q3DA 1PV3A 3Q5PA 3LW5J 4YSXD 3D70A 1OW8A 2WDQD 3C8VA 4YSXC 2WDQC 2ZT9B 2JP3A 3AECD 2ZT9D 4RKUJ 2YIUC 2ZT9C 1FDIA 2WSFJ 4OGQB 3CIRD 1ZOYD 2H88D 1KMIZ 4OGQD 2FXPA 1ZOYC 2OQQA 2H88C 4OGQC 3CIRC 4KX6D 3B71A 4XFJA 2QIWA 1KQFB 3Q5RA 2BS4C 4KX6C 2J5UA 4H13B 4YTPD 1HJ0A 2BS3C 3FGAD 1DD4A 1GMJA 4H13D 4YTPC 2D2CB 4H13C 3AE2D 2ACZD 3AE2C 2K9YA 1L0VD 2ACZC 1IK7A 1KTMA 1E7PC 4I7ZB 1L0VC 2WP9D 3H25A 3SFDC 3Q2YA 1KFYD 2WP9C 4YT0D 5C3JC 1KFYC 4I7ZC 4YSYD 1MKMA 4YSYC 3AEAD 1HF9A 1NYHA 3AEAC 4H0LB 3VR9D 4H0LD 3AEDD 4Y28J 1EXJA 1R8EA 4H0LC 3AEDC 4IL6X 3VR9C 4R4MA 2BEZF 5M1BA 2BS2C 3AE1C 3S9OA 3AE7D 1JB0J 3G9RA 1YQ4D 3AE7C 4YXDC 2YMKA 3EWKA 1YQ4C 2E76B 4U7JA 2P10A 2IDBA 2MKVA 2E76D 3AEGD 1NGMB 4H44B 2E76C 3AEGC 1EXIA 4H44D 3AEFD 3RK3E 2QJKC 4H44C 3AEFC 4PV1B 4KT0J 2WDVC 1OW7A 3GF3A 1PIXA 1Q90D 3D6YA 2E75B 3AE5D 3VRAD 3AE5C 3VRAC 3GF7A 2E75C 3AE6D 4YTMD 2D2CD 4YTND 3AE6C 4YTMC 1RQUA 2D2CC 1FDOA 2E74B 4YTNC 1PL5A 3VRBD 2E74D 3VRBC 2H89D 1K04A 1Y9BA 2E74C 1U57A 3AE4D 2H89C 1NENC 3AE9D 3AE4C 3AE9C 1ZMEC 2FBWD 3P4QD 2FBWC 1KORA 2WDRC 3P4QC 2V7QJ 3IAOA 3Q1MA 3AE1D 3SFED 3VR8D 2WSEJ 3SFEC 1KF6C 1YQ3D 3VR8C 1YQ3C 3GMAA 4YXDD 4Z1MH 2QJPC 3RL0g 1NEKD 5C2TD 5KKZC 3ABVC 1NEKC 1ZRTE 2WDVD 5C2TC 4YSZD 3AE8D 3IN6A 4PV1D 3T97B 2WU5D 3AE8C 4YSZC 4PV1C 2QJYC 2WU5C 2QSIA 2E75D 1OW6A 3P4PD 2G8YA 1S5LX 1DIPA 3P4PC 1KILE 1VF5B 3Q5SA 2B76D 1NEND 1QLBC 2B76C 2WDRD 1K05A 3AEBD 1OMIA 3AEBC 4R4LA 1RQVA 5C3JD 1AJYA 1KF6D 1KQGB 3AECC 2WU2D 2WSCJ 3P4RD 3R4YA 2WQYD 1ZP0D 2WU2C 3P4RC 2WQYC 1ZP0C 3SFDD 5KLIC 1TU3F 2NZ2A 1WMKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G3A A;  2WS3 D;  3P4S D;  2WS3 C;  3P4S C;  4YT0 C;  3AEE D;  3AE3 D;  3AEE C;  3AE3 C;  1PV3 A;  4YSX D;  1OW8 A;  2WDQ D;  4YSX C;  2WDQ C;  3AEC D;  3CIR D;  1ZOY D;  2H88 D;  3CIR C;  1ZOY C;  2H88 C;  4KX6 D;  3B71 A;  2BS4 C;  4KX6 C;  4YTP D;  2BS3 C;  4YTP C;  3AE2 D;  2ACZ D;  3AE2 C;  1L0V D;  2ACZ C;  5C3J D;  1KTM A;  1E7P C;  1L0V C;  2WP9 D;  4YT0 D;  3SFD D;  3SFD C;  1KFY D;  2WP9 C;  5C3J C;  1KFY C;  4YSY D;  4YSY C;  3AEA D;  3AEA C;  3VR9 D;  3AED D;  3VR9 C;  3AED C;  2BS2 C;  3AE1 C;  3S9O A;  3AE7 D;  1YQ4 D;  3AE7 C;  4YXD C;  1YQ4 C;  3AEG D;  3AEG C;  3AEF D;  3AEF C;  2WDV C;  1OW7 A;  3AE5 D;  3VRA D;  3AE5 C;  3VRA C;  3AE6 D;  4YTM D;  4YTN D;  3AE6 C;  4YTM C;  4YTN C;  3VRB D;  3VRB C;  2H89 D;  1K04 A;  3AE4 D;  2H89 C;  1NEN C;  3AE9 D;  3AE4 C;  3AE9 C;  2FBW D;  3P4Q D;  2FBW C;  2WDR C;  3P4Q C;  3SFE D;  3AE1 D;  3VR8 D;  3SFE C;  1KF6 C;  1YQ3 D;  3VR8 C;  1YQ3 C;  4YXD D;  1NEK D;  5C2T D;  1NEK C;  3ABV C;  5C2T C;  2WDV D;  4YSZ D;  3AE8 D;  2WU5 D;  4YSZ C;  3AE8 C;  2WU5 C;  1OW6 A;  3P4P D;  3P4P C;  2B76 D;  1NEN D;  1QLB C;  2B76 C;  2WDR D;  1K05 A;  3AEB D;  3AEB C;  1KF6 D;  3AEC C;  2WU2 D;  3P4R D;  2WQY D;  1ZP0 D;  2WU2 C;  3P4R C;  2WQY C;  1ZP0 C;  3ABV D; 
#chains in the Genus database with same CATH topology
 1GD2 E;  1T2K D;  1FS0 E;  1OIP A;  3BCC D;  1BE3 G;  3O6Q A;  5CCG D;  2M5A B;  3D71 A;  4HYT B;  1X22 A;  1D7M A;  1YI2 P;  3C1L A;  2WSF J;  4QMA A;  1SLQ A;  1KMI Z;  3CC4 P;  1LP1 A;  2QIW A;  3QWO C;  1JY3 P;  3FGA D;  5CCG A;  1VQL P;  3P7K A;  2A06 D;  3L4F A;  5AVT B;  1W2B O;  2IX7 C;  3HTK A;  2XNX A;  3AEA C;  3NTN A;  4R4M A;  1EDI A;  1MFT A;  2IBZ G;  1XTG B;  4H44 D;  4ZMD A;  2NPS C;  4KT0 J;  2OYH C;  1AFO A;  1SQP J;  3USS A;  3MUD C;  2Y9Z A;  4Y99 B;  1S9K D;  1SQQ J;  2FBW C;  1YJN P;  2Q1K A;  3Q1M A;  2A45 G;  1AA0 A;  4IL6 H;  1IFM A;  1MZ9 A;  3TSI A;  2ZJS E;  1SQB E;  1N73 C;  1L4A B;  5AVR B;  3I56 P;  2Q3E A;  3V2N A;  1VF5 B;  1NAY A;  2P1J A;  1DX7 A;  1ZV8 A;  4NPD A;  2J59 M;  4XA4 A;  1KQG B;  1NU1 D;  4ZKP A;  1GL2 B;  2KK7 A;  3L71 E;  3V2P A;  1T2K C;  2AXC A;  2KXP B;  1Q82 Q;  3R2P A;  4U3F J;  2KB7 P;  3TK1 A;  4DHI B;  1PGQ A;  2MJZ A;  2V7Q H;  3H1I G;  4UB6 H;  2FXP A;  3H1K J;  1PPJ E;  1HJ0 A;  2BCC G;  2WP9 D;  3CME P;  1RF1 B;  1FAV A;  1MUU A;  3PP5 A;  3AED D;  3H1L J;  1Q86 Q;  2OAR A;  3E7K A;  2RN0 A;  3RK3 B;  2MKV A;  3CWB J;  1EXI A;  4H44 C;  4PD4 E;  3VN0 A;  1PIX A;  2O1K A;  4RES B;  3KZI E;  3TGU J;  1DEE G;  3EFF K;  2KS1 B;  3E1I A;  3L72 E;  3VR8 D;  2Y9Y A;  2WT7 A;  5KKZ B;  4YSZ D;  1GK4 A;  3TYY A;  1SQP G;  2FYN B;  1SQQ G;  4JQ0 D;  2B76 D;  1BSH A;  1QLB C;  4WY4 A;  2BAS A;  2O01 H;  1X8Y A;  2B9B A;  1KF6 D;  3KDP B;  3LW5 H;  1ZRT D;  1VL2 A;  2CPS A;  1G1J A;  1PP9 D;  3L74 D;  1K9M Q;  1L0L E;  1M1K Q;  1NHL A;  3A0B H;  1NTM K;  2AEJ A;  4TT3 H;  1DEB A;  1Y47 A;  5AW8 B;  2XV5 A;  1OW8 A;  3AEC D;  2YIU C;  2YMY A;  2OTJ P;  5E79 H;  1JCC A;  2J5U A;  1NO4 A;  2WP9 C;  4HKZ H;  4C7N B;  1SQB J;  3P8C E;  4L76 A;  1P84 I;  3FXE A;  3AED C;  2BEZ F;  4I6L A;  2A06 G;  4I1L A;  3EWK A;  5GTH E;  2B89 A;  2QJK C;  2QJY B;  3AE5 D;  3VRA D;  3JC2 2;  5APV A;  1JUN A;  1N8R Q;  1BGY D;  4N78 D;  5APX A;  4DDI A;  1NEN C;  3L71 J;  3H1L G;  2GA1 A;  3VR8 C;  5KLV K;  3CWB G;  1WT6 A;  4LC1 A;  2LKM A;  2WSC H;  4YSZ C;  3CCM P;  2HYN A;  1KIL B;  1URQ D;  2G8Y A;  2O01 N;  2YKP A;  1JMB A;  4IOI H;  2B76 C;  1LTG C;  1A02 J;  1GZL A;  2N1T B;  1L0N D;  2GUV A;  1MV8 A;  5APW A;  1N7S A;  1TU3 F;  4BRY A;  1PFI A;  3ABV D;  1LWU B;  4EDF A;  5CHX A;  3QH9 A;  5APY A;  1EQ7 A;  3HUS C;  1KN7 A;  2WVR A;  1BE3 D;  1JCD A;  2KUB A;  1P84 E;  1FZC B;  1GU4 A;  3K5B A;  2KLV A;  3Q5R A;  2JR8 A;  3RK2 D;  2BS3 C;  1RHZ B;  3L72 J;  1GMJ A;  3EFG A;  1G2C B;  1SQX G;  3L75 G;  5AW5 B;  2K37 A;  1T8Z A;  3CCJ P;  1YIJ P;  4DZO A;  1T3U A;  2P10 A;  4GOF A;  4DT0 A;  3U59 A;  1Q90 D;  3AE5 C;  3VRA C;  2Q3I A;  3GF7 A;  2E75 C;  1M56 D;  3CPW O;  3GW6 A;  1NTZ K;  2IBZ D;  4FJV A;  1RE3 A;  1SQB G;  3WMM 0;  1L0L J;  4I6M C;  1LT9 A;  1RY3 A;  1HH0 A;  2KYV A;  3GMA A;  4YXD D;  4Z1M H;  1L4A D;  4PV1 D;  2AEF A;  3U1A A;  1URQ C;  4MN4 C;  2I8D A;  1GW3 A;  2ZYD A;  3L71 G;  1K05 A;  3RBZ A;  2VRS A;  1M7L A;  1BCC E;  1L4A A;  1AVY A;  1YIT P;  3S1K A;  1ZR4 A;  3MP7 B;  3CCR P;  1CI6 B;  2NZ2 A;  1GL2 D;  3G3Z A;  2QEX P;  1JMM A;  3P32 A;  2WS3 D;  2IYP A;  3UIA A;  3BVH A;  2JWD A;  3GLM A;  3NXS A;  1KYO E;  2XND H;  2W90 A;  1HTL C;  3Q3D A;  1TFF A;  3BAT A;  3VYI A;  2NRG A;  1S3J A;  4IL6 E;  1FZE A;  3RK2 C;  2FYU E;  3H25 A;  3H1I D;  1J1D B;  4ASV A;  2K9J A;  2BCC D;  2OTK E;  5B66 H;  1LTB C;  1NTK K;  1RE3 C;  1JY2 N;  3RK3 D;  4B86 A;  2QG4 A;  1JY2 P;  3AEF D;  1RF1 A;  3V2Q A;  2E74 B;  4Y99 C;  2Q9I A;  1M1J B;  1XTC C;  1IFP A;  1YQ3 D;  3L73 E;  1GTW A;  2M3B A;  2ZYA A;  1L4A C;  1ZXG A;  1M90 Q;  4UB6 E;  4PV1 C;  2KS1 A;  3L70 E;  3M0D C;  2KLU A;  3VON A;  1L0L G;  2YKO A;  5B5E H;  1SQP D;  2NPS A;  1JOC A;  3CLQ A;  1QVG O;  3V6I A;  2Z5I A;  2QE7 H;  1SQQ D;  5AVU B;  2A45 H;  3MUD A;  2R5D A;  1GL2 C;  2E42 A;  1E5W A;  2WS3 C;  2PGD A;  1Q81 Q;  1LT1 A;  1J2J B;  3PLN A;  3WU2 E;  1W5C E;  1UII A;  1FZB A;  2YXQ B;  4A7P A;  3RL0 D;  5C39 A;  4WBA A;  2FXM A;  2CK3 H;  2BS4 C;  2JEE A;  1GU5 A;  2D2C B;  1L0V D;  4AYC A;  1NTM E;  1S9K E;  1RF1 C;  4HJG H;  4H0L B;  1J1E C;  4Y28 J;  1JNM A;  2LR2 A;  2Z5H A;  4WWI A;  2P67 A;  1YTZ I;  3RK3 C;  3ITK A;  3MD0 A;  3AEF C;  2WDV C;  1OW7 A;  1S72 P;  1LGH B;  3CCV P;  1BCC J;  5K5G B;  3WUT A;  3H1H G;  1K04 A;  3A0B E;  1GDT A;  1EZV E;  2HPC A;  3L36 A;  2W6A A;  1OXZ A;  2KNC A;  1YQ3 C;  2QJP B;  1RH5 B;  5AW0 B;  5C2T D;  5KKZ C;  3H1L D;  2Y0D A;  2WSF H;  2K1A A;  3MGN A;  5AW1 B;  4N3Y B;  1BDD A;  2QSI A;  3TDK A;  3P4P D;  5E79 E;  1OVV A;  4L73 A;  4AQR D;  3CWB D;  1LTJ A;  3OJA B;  3N4X A;  1EDK A;  5CCH C;  2WQY D;  5KLV E;  3TNU A;  1KB9 E;  3A0H E;  2FFD B;  2R5B A;  3FX0 A;  1JM0 A;  1IFI A;  2HR3 A;  3RL0 C;  1A02 F;  2ZAE B;  2WPR A;  1SFC D;  1LWU A;  1YYC A;  2OYI B;  1VPC A;  1ZOY D;  4PJ0 H;  3CI9 A;  1DD4 A;  3CXH D;  3L73 J;  4OWF A;  4JYB A;  1L0V C;  2FYU K;  1LTS C;  4UB8 E;  4YSY D;  1SFC A;  1ZW0 A;  1X0T A;  1EXJ A;  2XKM A;  3BAS A;  3L70 J;  1SVF A;  1IZN B;  5AVV B;  1SQX D;  2YO3 A;  2H43 A;  2IPP A;  2ZFY A;  3L75 D;  2OTL P;  1M8O B;  3VTP C;  1FZF A;  4L75 A;  2WMM A;  1EC5 A;  1N2D C;  3IFM A;  1SQV K;  2HLO A;  2L91 A;  4DHZ A;  2I1J A;  3IAO A;  1HJB A;  1LTJ C;  1IC2 A;  4C7R A;  1SQB D;  3P8M C;  5APS A;  3RL0 g;  5C2T C;  1ZRT E;  1NH4 A;  1PP9 E;  1BCC G;  2CPB A;  2W6B A;  1NKN A;  1NTZ E;  1T6A A;  3P4P C;  3A2A A;  1NEN D;  4IFF A;  3M9H A;  1RF0 A;  2N1T C;  1NTM J;  2KSE A;  2WQY C;  1NJI Q;  2LXB A;  4IFD K;  3N7N A;  3L71 D;  2K88 A;  3HE5 B;  1LWU C;  2ZXE B;  1NKZ B;  2O01 J;  1AQT A;  3H32 A;  2PP6 A;  3LW5 J;  1YHQ P;  1SFC C;  5KJ7 C;  2OYH B;  4OGQ B;  3T97 A;  1ZOY C;  1FZC C;  1KQF B;  2E43 A;  2Y0E A;  1KFY D;  3A7O A;  4DHJ A;  4YSY C;  1FE6 A;  4YPC A;  3HD7 B;  2BS2 C;  1YQ4 D;  2E76 B;  3TF5 A;  1NGM B;  4PD4 D;  1BDC A;  2IBZ I;  3CXH H;  3KHU A;  2IFM A;  3O8Z A;  4YTM D;  5KLV J;  1RQU A;  2ZVN B;  1SP4 A;  1PL5 A;  2E74 D;  3HUS A;  4U3F G;  4DCK A;  3O6Q B;  3L70 G;  1VQM P;  4D6T E;  1NTK E;  2WSE J;  5BVZ A;  2JJL A;  2UWJ E;  2A45 I;  1NU1 K;  1AVO A;  1G1I A;  1RF0 C;  3H1K G;  1LP1 B;  1KV4 A;  2E75 D;  1M1J A;  3VMZ A;  3HTK B;  3HE4 A;  2W83 C;  2WSC J;  2N9B A;  3H1J E;  2HFE D;  5B66 E;  1KFM A;  2JO1 A;  1L0L D;  4BXL A;  1U7J A;  2LXC B;  3L35 A;  3V4W A;  2B87 A;  3AE3 D;  3TGU G;  1DD3 A;  3MTU E;  2WPS A;  2ZT9 B;  1NTM G;  4RKU J;  4OH8 B;  1FDI A;  5AVW B;  1NWQ A;  2L5G B;  2H88 D;  5KTB A;  4ZKU A;  3B71 A;  1URQ A;  2C0W A;  2C9N Y;  2IBZ E;  1KFY C;  1J1D C;  4H0L D;  1VQ5 P;  5M1B A;  5BU5 A;  1NTZ J;  2YMK A;  1YQ4 C;  2POH A;  5B5E E;  1EZV G;  3GF3 A;  1LTA C;  4IFM A;  2M5A A;  1ZLL A;  4GOD A;  4YTM C;  4K35 A;  1LTT C;  2E74 C;  1VQP P;  5GTI H;  3M9Q A;  5KAF H;  2WDR C;  1M1J C;  5CBN A;  4PD4 H;  4XE5 B;  3H1H D;  3PTZ A;  2KIK A;  1HGV A;  2WU5 D;  5AVZ B;  2I1K A;  2KZJ A;  1S5L X;  2FYZ A;  4HH2 A;  1FBM A;  1H88 A;  3SSU A;  3P4R D;  5AVQ B;  4GIF A;  2ITA A;  5DJT B;  5L8R J;  1H8A A;  1YBK A;  1K8A Q;  3WUU A;  2Z4E A;  3H1I E;  1QVF O;  3AE3 C;  1VF5 D;  1QLE D;  1S4X A;  2BCC E;  1FC2 C;  1JTH B;  2AXT H;  2XZR A;  3M0D A;  2H88 C;  2WT7 B;  3B5N B;  4D6T J;  1NTK J;  1IFD A;  2K9Y A;  1IK7 A;  3JSV C;  1VQ7 P;  1FOS F;  1HF9 A;  1IJD B;  1LNQ A;  4JYC A;  3PH0 A;  1PPJ G;  4H0L C;  1R8E A;  4RO0 A;  4WY4 B;  1GL2 A;  1GK6 A;  3G9R A;  4HB1 A;  3M91 A;  2H8P D;  3CC2 P;  3AEG D;  2E5T A;  1QGK B;  4C46 A;  3SWF A;  3MZW B;  4WB4 A;  3FWL A;  3H1J J;  1W2E A;  3LID A;  1Y9B A;  1U57 A;  2QRX A;  5DJU B;  1L0N K;  1NTZ G;  1SQQ E;  2QJP C;  1FOS E;  3WUV A;  3M9B A;  1VQN P;  1NEK D;  2WDV D;  4I2L C;  2WU5 C;  3L72 G;  4KJM A;  1JEK A;  4PJ0 E;  2OYO A;  1SQV E;  2XDJ A;  1PGJ A;  3NMD A;  1BCC D;  1RQV A;  2AEM A;  3SWK A;  1KQS O;  2WWW A;  3P4R C;  1YJW P;  1ZR2 A;  5AW9 B;  3CCS P;  3BCC E;  1HGZ A;  1KYO D;  4GT1 A;  1Z56 A;  2WPV B;  1S5L H;  4ZNC A;  1VF5 C;  2WZ7 A;  1PV3 A;  3Q5P A;  3D70 A;  3PJS K;  2O3J A;  1JY3 O;  3C8V A;  2WDQ D;  5CCH D;  4DDG A;  3CX5 D;  3CXH I;  1VQ6 P;  4OGQ D;  2OYI C;  1H0T B;  4H13 B;  2A06 E;  3JCU H;  5KAI H;  3Q2Y A;  1IFN A;  3GHG B;  1H89 A;  5CCH A;  3F5H A;  3HD7 D;  2O1J A;  2E76 D;  3FXD A;  1KQL A;  2FKW B;  3AEG C;  5TIS H;  3CCE P;  1WRG A;  1N7S B;  1CZQ A;  2R3C A;  4D6T G;  1NTK G;  2P2U A;  4BRY B;  4YTN D;  3NFQ A;  2WIT A;  2R3S A;  1OX3 A;  1QEX A;  3HD7 A;  3CCL P;  3P4Q D;  3V5B A;  3SFE D;  4NPE A;  3H1I J;  4U3F D;  1NEK C;  4GOE A;  3AE8 D;  2RMZ A;  2BCC J;  3KQG A;  3L70 D;  5APT A;  4C7N A;  3H1J G;  1K73 Q;  4NPF X;  3H1K D;  2GUS A;  1OMI A;  2RH0 A;  1X9V A;  4YXW H;  1NU1 E;  1JY3 N;  5AW7 B;  2P58 A;  3BRV B;  3RK2 B;  2G3A A;  3F89 A;  2KI7 B;  3CXH E;  3RGU A;  4YT0 C;  1KIL D;  2WSS H;  3E1R A;  5BU8 B;  2YO2 A;  2Q7C A;  2FYN C;  2N1T D;  2WDQ C;  2FYU J;  1RE4 A;  2ZT9 D;  1SQX E;  3TGU D;  1LT9 B;  3L75 E;  1MFZ A;  2B88 A;  4OGQ C;  1GW4 A;  2C0X A;  1KIL A;  1KYO H;  3V4Q A;  3VMX A;  1NTM D;  1KTM A;  4I7Z B;  3A5T A;  1VDF A;  2KOG A;  2N1T A;  2SPZ A;  3CX5 H;  4PD4 I;  1USD A;  3M0A A;  3AE1 C;  3IR9 A;  1IO4 A;  3HD7 C;  5KJ7 D;  1SQV J;  2E76 C;  2WTY A;  4PV1 B;  1KFN A;  3AE6 D;  1E79 H;  4YTN C;  2H89 D;  1EZV D;  3KXD A;  1ZME C;  5KJ7 A;  3MIW A;  3P4Q C;  2V7Q J;  2PAJ A;  1N86 A;  3SFE C;  1FZC A;  3BCC J;  2QA4 P;  1SQP K;  3ZDM A;  2W8Z A;  1SQQ K;  3IN6 A;  1G2C A;  3AE8 C;  3VMY A;  2QJY C;  1OZH A;  5CJ4 A;  3U1C A;  3CC7 P;  5CCG C;  3II6 A;  5AVX B;  1HBW A;  2K9J B;  2HOD B;  5KLV D;  1KB9 D;  1ZP0 D;  5KLI B;  1VQO P;  3OW2 O;  4EIJ A;  1RE4 C;  3L74 E;  1EDJ A;  4N6J A;  5H2F H;  1UIX A;  1FZG A;  1J1E B;  1KIL C;  5APU A;  5AW3 B;  5CMZ A;  1VQ9 P;  5GTI E;  2KP8 A;  4TLF A;  5KAF E;  2ZT9 C;  3G71 P;  1FU1 A;  2OQQ A;  3WU2 H;  3VOP A;  2Q6Q A;  3B5N D;  3KPE A;  2E5Y A;  5C3J D;  3BRT B;  1JTH A;  5CJ0 A;  3W68 A;  1CI6 A;  4WY4 D;  2FYU G;  4OVN F;  3B5N A;  1VQ8 P;  3A3Y B;  2NPS B;  3OA7 A;  2QM8 A;  2WPQ A;  1PPJ D;  2ZYG A;  4BWN A;  3AE6 C;  1NU1 J;  4DJG A;  3VRB D;  1USE A;  2H89 C;  3G4S P;  1BGY E;  3AE9 D;  4N78 E;  1U7M A;  2ZVO B;  2ZFC A;  1PGP A;  2FY8 A;  1Q2N A;  1SQV G;  1N73 B;  1PGO A;  2AXT E;  2YXR B;  1T3J A;  1NTZ D;  3L73 G;  1SQX J;  1LTI C;  3L75 J;  1QL1 A;  1KD1 Q;  3RL0 B;  2WDR D;  4R4L A;  3L72 D;  2V4H A;  3BCC G;  1L0N E;  2W27 A;  4LLH A;  5AW4 B;  5AW6 B;  1ZP0 C;  4LDT A;  3LIE A;  3D6Z A;  3HRN A;  3P4S D;  1R5L A;  1YTZ T;  4JF7 A;  1Q7Y Q;  3AEE D;  3M06 A;  1NVO A;  2JWA A;  1X79 B;  1SS1 A;  3I5C A;  1KB9 H;  3VMA A;  3A0H H;  2HPC B;  1M57 D;  3PHL A;  1BE3 E;  2IZ1 A;  1SQX K;  2KNC B;  2WSE H;  1HWT C;  1OVR A;  4H13 D;  3AE2 D;  3B5N C;  2ACZ D;  2JKV A;  3SFD D;  5C3J C;  1MKM A;  3VR9 D;  4W7Z A;  1LTJ B;  3B4S A;  3S9O A;  3AE7 D;  1Y8A A;  1KC8 Q;  4WY4 C;  4U7J A;  1H0T A;  4H44 B;  3H1H E;  1SQB K;  3W67 A;  3TNU B;  4UB8 H;  4KHX A;  3D6Y A;  1N7S D;  3GHG A;  1IK9 A;  2D2C D;  3VRB C;  3P8C D;  1QL2 A;  3AE9 C;  2JDI H;  1KOR A;  4D6T D;  1NTK D;  1PP9 J;  3L74 J;  1VQK P;  2Q5U A;  2R32 A;  1KF6 C;  1S5L E;  4ASW A;  3VP8 A;  3PRJ A;  4LGD E;  4DOJ A;  2ZXX A;  1YJ9 P;  1OW6 A;  4AUW A;  1NU1 G;  2IYO A;  2XU6 A;  3Q5S A;  1NOH A;  1VQ4 P;  3JCU E;  4WVZ A;  5KAI E;  3AEB D;  1SFC B;  3AEC C;  3H1J D;  2WU2 D;  1CSB A;  3KYQ A;  1WMK A;  1KYO I;  3VP9 A;  3KZI H;  2HG5 D;  4W7Y A;  1N7L A;  3P4S C;  3B8E B;  1S1C X;  5TIS E;  4GKG A;  2KZI A;  5KLV G;  1S2E A;  1IFJ A;  3AEE C;  4EI2 A;  2KSJ A;  3CX5 I;  4GDO A;  4W80 A;  2DW3 A;  4YSX D;  2YIU B;  2JP3 A;  2IZ0 A;  3CIR D;  1BGY J;  4KX6 D;  2J58 A;  1R5S A;  4YTP D;  4H13 C;  3AE2 C;  2ACZ C;  1E7P C;  1FJP A;  3SFD C;  1EDL A;  3GHG C;  2H7H A;  1NYH A;  1JY2 O;  3VR9 C;  2FFD A;  5TJH A;  1DH3 A;  3CMA P;  3AE7 C;  3FWN A;  1AV1 A;  2IDB A;  1P84 D;  2QJK B;  3CCQ P;  1FZA A;  3RK3 E;  1FJK A;  1N7S C;  1L0N J;  2D2C C;  2QM7 A;  3AE4 D;  3H32 B;  2OYI A;  3IF4 A;  1QX8 A;  3ABV C;  3T97 B;  1L0L K;  1ZN5 A;  1HVV A;  1BE3 J;  1DIP A;  1CW5 A;  3G6E P;  1FDM A;  5GTH H;  4CPG A;  1PP9 G;  3AEB C;  3L74 G;  4O9B A;  2PRR A;  1KZU B;  1L2P A;  4L74 A;  1AJY A;  1SQP E;  3R4Y A;  5AVS B;  3CX5 E;  2WU2 C;  1HUC A;  3OAK A;  5EFW B;  3L37 A;  3EQ2 A;  1AQ5 A;  2PFX A;  2BEQ D;  3H6P A;  3H1H J;  5AW2 B;  5APQ A;  2K3R A;  2HOD A;  4RJT A;  5AVY B;  3RBX A;  3HUS B;  2YKQ A;  4JPZ B;  2IFN A;  4YSX C;  1OVU A;  3SWY A;  4EOT A;  3CIR C;  1LT9 C;  2FFD C;  1LJ2 A;  4XFJ A;  4KX6 C;  4YTP C;  2R44 A;  4YT0 D;  2FXO A;  4I7Z C;  3MHV A;  3AEA D;  2RKL A;  2C9L Y;  4IL6 X;  1JO5 A;  4EYY Q;  2GM4 A;  4YXD C;  4JBZ A;  1OFC X;  4U3F E;  1BGY G;  3HE4 B;  3HE5 A;  2NPS D;  1BSN A;  1EZV I;  2E75 B;  5CBO A;  2M8R A;  2FYU D;  2M0B A;  1FDO A;  3S4R A;  3AE4 C;  2B87 B;  3C9I A;  5H2F E;  2FBW D;  3H1K E;  1OWA A;  3CD6 P;  1P84 H;  2OYH A;  3AE1 D;  2W6J H;  1NAF A;  3CCU P;  4M3L A;  1PZQ A;  2Y0C A;  2P7J A;  3H1L E;  1L0N G;  1URQ B;  2OGU A;  2QVA A;  1SQV D;  1KIL E;  3I55 P;  1KB9 I;  3CL3 D;  3CWB E;  4K3A A;  2M3E A;  3GG2 A;  1N73 A;  2YNY A;  3L73 D;  2N9Y B;  3TGU E;  5KLI C;  3V2R A;  1JB0 J; 
#chains in the Genus database with same CATH homology
 1VL2 A;  5L8R J;  2JO1 A;  2G3A A;  3D6Z A;  2WS3 D;  3P4S D;  2BEQ D;  2WS3 C;  3P4S C;  1S1C X;  1UIX A;  4YT0 C;  2O01 J;  3AEE D;  4TT3 H;  3ABV D;  3AE3 D;  3AEE C;  3O6Q A;  3GLM A;  3AE3 C;  2WPV B;  3D71 A;  4GDO A;  1DD3 A;  1VF5 D;  2FYN C;  1VF5 C;  3Q3D A;  1PV3 A;  3Q5P A;  3LW5 J;  4YSX D;  3D70 A;  1OW8 A;  2WDQ D;  3C8V A;  4YSX C;  2WDQ C;  2ZT9 B;  2JP3 A;  3AEC D;  2ZT9 D;  4RKU J;  2YIU C;  2ZT9 C;  1FDI A;  2WSF J;  4OGQ B;  3CIR D;  1ZOY D;  2H88 D;  1KMI Z;  4OGQ D;  2FXP A;  1ZOY C;  2OQQ A;  2H88 C;  4OGQ C;  3CIR C;  4KX6 D;  3B71 A;  4XFJ A;  2QIW A;  1KQF B;  3Q5R A;  2BS4 C;  4KX6 C;  2J5U A;  4H13 B;  4YTP D;  1HJ0 A;  2BS3 C;  3FGA D;  1DD4 A;  1GMJ A;  4H13 D;  4YTP C;  2D2C B;  4H13 C;  3AE2 D;  2ACZ D;  3AE2 C;  2K9Y A;  1L0V D;  2ACZ C;  1IK7 A;  1KTM A;  1E7P C;  4I7Z B;  1L0V C;  2WP9 D;  3H25 A;  3SFD C;  3Q2Y A;  1KFY D;  2WP9 C;  4YT0 D;  5C3J C;  1KFY C;  4I7Z C;  4YSY D;  1MKM A;  4YSY C;  3AEA D;  1HF9 A;  1NYH A;  3AEA C;  4H0L B;  3VR9 D;  4H0L D;  3AED D;  4Y28 J;  1EXJ A;  1R8E A;  4H0L C;  3AED C;  4IL6 X;  3VR9 C;  4R4M A;  2BEZ F;  5M1B A;  2BS2 C;  3AE1 C;  3S9O A;  3AE7 D;  1JB0 J;  3G9R A;  1YQ4 D;  3AE7 C;  4YXD C;  2YMK A;  3EWK A;  1YQ4 C;  2E76 B;  4U7J A;  2P10 A;  2IDB A;  2MKV A;  2E76 D;  3AEG D;  1NGM B;  4H44 B;  2E76 C;  3AEG C;  1EXI A;  4H44 D;  3AEF D;  3RK3 E;  2QJK C;  4H44 C;  3AEF C;  4PV1 B;  4KT0 J;  2WDV C;  1OW7 A;  3GF3 A;  1PIX A;  1Q90 D;  3D6Y A;  2E75 B;  3AE5 D;  3VRA D;  3AE5 C;  3VRA C;  3GF7 A;  2E75 C;  3AE6 D;  4YTM D;  2D2C D;  4YTN D;  3AE6 C;  4YTM C;  1RQU A;  2D2C C;  1FDO A;  2E74 B;  4YTN C;  1PL5 A;  3VRB D;  2E74 D;  3VRB C;  2H89 D;  1K04 A;  1Y9B A;  2E74 C;  1U57 A;  3AE4 D;  2H89 C;  1NEN C;  3AE9 D;  3AE4 C;  3AE9 C;  1ZME C;  2FBW D;  3P4Q D;  2FBW C;  1KOR A;  2WDR C;  3P4Q C;  2V7Q J;  3IAO A;  3Q1M A;  3AE1 D;  3SFE D;  3VR8 D;  2WSE J;  3SFE C;  1KF6 C;  1YQ3 D;  3VR8 C;  1YQ3 C;  3GMA A;  4YXD D;  4Z1M H;  2QJP C;  3RL0 g;  1NEK D;  5C2T D;  5KKZ C;  3ABV C;  1NEK C;  1ZRT E;  2WDV D;  5C2T C;  4YSZ D;  3AE8 D;  3IN6 A;  4PV1 D;  3T97 B;  2WU5 D;  3AE8 C;  4YSZ C;  4PV1 C;  2QJY C;  2WU5 C;  2QSI A;  2E75 D;  1OW6 A;  3P4P D;  2G8Y A;  1S5L X;  1DIP A;  3P4P C;  1KIL E;  1VF5 B;  3Q5S A;  2B76 D;  1NEN D;  1QLB C;  2B76 C;  2WDR D;  1K05 A;  3AEB D;  1OMI A;  3AEB C;  4R4L A;  1RQV A;  5C3J D;  1AJY A;  1KF6 D;  1KQG B;  3AEC C;  2WU2 D;  2WSC J;  3P4R D;  3R4Y A;  2WQY D;  1ZP0 D;  2WU2 C;  3P4R C;  2WQY C;  1ZP0 C;  3SFD D;  5KLI C;  1TU3 F;  2NZ2 A;  1WMK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...