3SFDC

Crystal structure of porcine mitochondrial respiratory complex ii bound with oxaloacetate and pentachlorophenol
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Thiabendazole inhibits ubiquinone reduction activity of mitochondrial respiratory complex II via a water molecule mediated binding feature.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
total genus 49
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2011-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3sfdC01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3sfdC02
2FBWC 3P4SC 3AEAC 3P4QC 3AE2C 5C3JD 5C2TD 3AECC 2WDVD 2H88D 3AE1C 3AEGD 3AEDD 4YT0C 4YTMC 3AE5C 1KF6D 1L0VC 3AE9C 3CIRD 3VRAD 3AE7C 1KFYD 1E7PC 4YTMD 1YQ3C 3AEDC 1ZP0D 3ABVC 4YTPD 2H89D 2B76D 4YTND 2H88C 4YTPC 3ABVD 2WS3D 1YQ3D 3S9OA 3AEAD 3P4SD 1YQ4D 3AE2D 5C3JC 2B76C 3VR8D 3AEEC 3SFDD 2WQYD 3VRAC 3AE9D 3AEBC 4YSZC 4KX6D 3AE6C 3P4PC 3AE5D 2WQYC 4YXDC 3AEED 3VR9D 2WP9C 2WDRD 3AEGC 3CIRC 2WU2D 3AECD 2BS3C 2WDQD 1QLBC 1ZP0C 2FBWD 2H89C 3P4RD 3B71A 5C2TC 3AE3C 4YSXD 3P4QD 3SFEC 2ACZC 2WU5D 1ZOYD 3P4PD 2WU2C 3AE7D 3AE8D 3AEFD 1NENC 1K05A 1KTMA 3VR9C 1NEND 1ZOYC 2WU5C 1K04A 3AE8C 3AEFC 1YQ4C 3AE6D 4KX6C 1KF6C 1L0VD 3AEBD 4YSZD 3P4RC 2WS3C 1NEKC 3VRBD 3AE1D 2G3AA 3AE3D 4YSXC 4YTNC 3VR8C 1OW8A 1PV3A 3AE4C 4YSYC 2BS2C 3VRBC 1NEKD 2WDVC 2BS4C 2WDQC 3AE4D 4YSYD 1KFYC 2WP9D 1OW7A 2WDRC 1OW6A 4YXDD 2ACZD 3SFED 3SFDC 4YT0D
chains in the Genus database with same CATH superfamily
1FZAA 3MD0A 2FFDB 3L37A 4NPEA 2CK3H 3AE2C 3H1KE 3TGUD 5C2TD 3AECC 3L73D 1OX3A 2NPSA 1VQMP 2H88D 2K88A 5APYA 1LJ2A 2P67A 2OQQA 1SLQA 3CIRD 3VRAD 3B5NC 3WMM0 1MZ9A 1E7PC 4ZNCA 1P84H 1ZP0D 2IZ0A 2KNCA 3TGUE 2Z4EA 4YTND 2H88C 2K37A 2O3JA 2FY8A 4H44D 1JY2N 3BASA 4GOFA 4EYYQ 1HWTC 3FWLA 1CI6A 4GT1A 1T2KD 4W7ZA 5KTBA 1AA0A 3AEGC 5AW6B 4IFMA 2MKVA 3L75D 1OIPA 1MFZA 1ZLLA 5H2FE 1FZCC 1VDFA 2FFDA 1J1EB 2ACZC 1FJKA 4WY4A 5GTHH 1H0TA 3G3ZA 2Y9ZA 3MTUE 2QJKC 2C0XA 3M9HA 2FYZA 3H1IJ 2W6BA 3A2AA 4KX6C 1NEKC 3A5TA 3AE1D 3P32A 1NKNA 3AE4D 2L91A 1OMIA 1E79H 1SQBG 1BCCJ 1KB9H 1NU1E 3RK2B 1FS0E 4EDFA 5TISE 1RE4A 1KFMA 3RL0g 3BCCG 1PFIA 1GK4A 3CI9A 5APTA 1RH5B 1S5LE 5CBOA 4BRYB 2M5AB 1L0VC 1PPJG 5AW3B 3VP9A 4RESB 1SQVG 3CCUP 2A06D 3ABVC 4W7YA 4ZKPA 3WUUA 1EDLA 4I7ZB 2IBZG 5E79H 3CWBG 2ZJSE 2IPPA 2N9BA 1N73C 3L71J 2KXPB 3L74E 1NYHA 1M7LA 1MKMA 3HUSA 1VQ5P 1JTHB 3IAOA 2FXOA 1S3JA 1OVRA 1U7JA 3LIEA 5GTIH 1KQSO 1NWQA 2AEJA 2JWAA 1FC2C 3SWFA 4RKUJ 1SQPD 3AE8D 4U3FJ 1NTZG 2P10A 2FKWB 3G6EP 1CI6B 3G4SP 2XU6A 3TDKA 3IF4A 1JNMA 1SQQD 4KHXA 3E1RA 4YSYD 2HLOA 3IN6A 4Y28J 4HYTB 1VQ7P 1KILB 5KAIE 4GDOA 1KILD 1NTKE 3H1HD 1URQA 3I55P 1Q86Q 1IFPA 1RF0C 1CZQA 3H1HJ 2Z5HA 1OVVA 3CC4P 2WSEH 2QRXA 1KILA 1H8AA 2V7QH 2WSEJ 1SFCC 1LWUC 2W8ZA 1Q81Q 3AEDC 1KD1Q 5CJ0A 1OWAA 1VQNP 1YYCA 3S4RA 4OGQD 4N3YB 3O6QA 1LTJC 3Q5RA 3RBZA 1KILE 1SVFA 3M91A 1FBMA 3PJSK 3AE5D 3QH9A 4LDTA 2KS1B 2LKMA 3V2PA 3U59A 2YIUC 1ZXGA 1X8YA 1N7SC 3U1AA 2R44A 3H1LJ 3B5NB 1D7MA 4YSXD 4XE5B 3H1LD 1K05A 1VQ4P 3VR9C 2WPRA 2ZXEB 3H1JG 2MJZA 3C1LA 4PD4D 1M56D 1K73Q 3I5CA 2RN0A 2CPSA 4EOTA 4CPGA 2WDVC 1PGQA 1NAYA 4D6TG 2WT7B 4D6TE 2WVRA 1UIIA 3NTNA 4UB8E 1X9VA 2YIUB 1NTKD 4EIJA 2FYUE 1JEKA 4DJGA 2KIKA 2FYUG 5APQA 5AVQB 1SQQE 1LTJB 2A06E 4LC1A 4YT0C 1EZVD 3CCQP 1JCDA 2E75D 4YTMD 1G2CA 3CC7P 1AV1A 1SQPE 2OTLP 3R2PA 4I2LC 5KLVJ 2B76D 1BGYD 1SQPK 1W2BO 1AVYA 2V7QJ 5CCGA 3SFDD 2B9BA 2JP3A 3M0DA 2P58A 2O1JA 1BCCG 1FDOA 2ZYDA 1IFIA 5AW4B 2BCCG 4U3FD 4HH2A 2BS3C 3L36A 3FWNA 1JM0A 3K5BA 5M1BA 4PD4E 2K1AA 3L71E 1T8ZA 4O9BA 5AVTB 2OYHA 3CD6P 4HJGH 4WBAA 1W5CE 4ASVA 1RE4C 3D71A 4MN4C 3A0HH 5AVRB 2HFED 5APVA 4U3FE 3A3YB 1NHLA 4UB8H 1SQBK 1LP1B 1KFYC 2WDRC 3BATA 3A7OA 1VQ9P 3NFQA 1JY2O 1FOSE 3HE5B 4DDGA 1VF5C 4Y99C 1SQXD 1U7MA 3RK3C 1EDKA 1VF5D 2J58A 2Y0EA 4I7ZC 1S5LX 1QL2A 1L0NE 4FJVA 5KJ7C 3HD7B 3F89A 3NXSA 1KFYD 1AFOA 4R4MA 2M8RA 3CXHE 3WU2H 2HPCA 1BSHA 1GDTA 3WU2E 4EI2A 4JYCA 1Y9BA 2QJPB 3HD7D 3N4XA 2JDIH 3P4SD 2JWDA 1HJ0A 4QMAA 2B87B 2K9JA 2E43A 3HD7C 1L0LJ 1T2KC 1GMJA 3A0BH 4LGDE 1JOCA 3AEBC 2NZ2A 2KSJA 1URQC 1M1JB 1UIXA 4C7RA 1ZP0C 2OYOA 3D70A 2CPBA 1IK9A 3L35A 1M1JA 4Z1MH 3H1LE 1YI2P 1OFCX 2WU5C 2D2CC 2LR2A 3AE8C 1PP9G 1SQQK 2KOGA 4YSZD 1R8EA 2E42A 1PV3A 2YNYA 2ZYGA 1NTMK 3E7KA 1RF1A 2WTYA 4IFFA 2WP9D 2E5TA 3IFMA 1L0NK 1JUNA 2GM4A 4YT0D 3C8VA 3LW5J 1VQPP 1ZW0A 2KZJA 3FGAD 3L72J 1VQKP 5AVSB 3RL0D 4R4LA 3V6IA 2YMYA 1A02J 5KLVD 4KT0J 5CCHD 1LT9C 1T3JA 2KNCB 4JBZA 1KB9I 1SQBD 3C9IA 1N73A 5AVXB 2H89D 3H1ID 2UWJE 3ABVD 2WS3D 4K3AA 1KYOI 3HE5A 1OZHA 3L72G 1L0NG 1KC8Q 3L71G 2QJKB 1Q2NA 1RE3A 1BGYJ 3CWBJ 4WWIA 2KSEA 2NRGA 2AXTH 5BU5A 3MGNA 3VMYA 1MUUA 1SQVD 1NO4A 3P4PD 3H1JJ 1EDIA 1ZRTE 2BEZF 1LT1A 3VTPC 3AE6D 2IBZD 3CWBD 3AE3D 1FOSF 1GL2D 1GW3A 1JY3O 2JJLA 1KORA 3WUTA 4PJ0H 4RO0A 5KAIH 3H1KG 2ACZD 3MUDC 4DZOA 5AW1B 2I1KA 4H44C 1NTZE 1HGVA 1SQPG 1P84D 3GHGB 4GODA 5APSA 3AEGD 3GHGC 2AEMA 1GTWA 3SWYA 3V4QA 3FXDA 1BDDA 2E75B 1XTGB 1LTSC 1SQQG 1PGOA 1USEA 2YKOA 4A7PA 2PFXA 2WSCH 3AE2D 3H1HG 1WMKA 1S4XA 1SFCB 1RQUA 3AEEC 3VRAC 5H2FH 4JYBA 3GF7A 3CCMP 4KJMA 1KQGB 2WQYC 2KLVA 1L0LG 1L0LE 2ZVNB 5BVZA 2C0WA 1IZNB 3CCSP 3CX5H 3MHVA 5CCHA 1HVVA 3CCVP 1Q7YQ 3P4RD 1HH0A 1BSNA 4N78E 1ZN5A 1MFTA 3CXHD 3EFFK 4L74A 3AEFD 3HRNA 3SWKA 1JMBA 2SPZA 1RQVA 2FXMA 1KB9E 3KPEA 4IL6H 3Q5PA 1GK6A 1L0VD 3L70J 2B88A 1EQ7A 5KKZB 2WSFH 5EFWB 2A45G 2E76C 1M1KQ 3MZWB 1U57A 2WDQC 1EZVI 5AW0B 2KLUA 1KFNA 1YBKA 1QL1A 4HB1A 1QVFO 2R3CA 4DCKA 2VRSA 3H1JD 2GUSA 3A0HE 2J59M 4H0LD 4UB6H 1SQVJ 3GF3A 3L72E 1A02F 3AE7C 4GOEA 5CJ4A 2N1TA 4ASWA 5AW8B 1EZVE 5AVZB 3BCCE 1AQ5A 1YQ3C 1LTAC 5AW2B 2E76D 4YTPC 3TSIA 2YXQB 1LTJA 3VR8D 4I6LA 1BE3G 4H13B 2FYUD 3AE6C 1VQ6P 1YJWP 4XA4A 1LNQA 2IYPA 1LT9B 1E5WA 5TJHA 2KZIA 1EZVG 3B5NA 1VL2A 1DEEG 2WSSH 3CWBE 1FZEA 3CXHH 1Q82Q 1PGPA 2KB7P 3AE7D 1S1CX 2IYOA 2E74B 1ZMEC 4DT0A 4K35A 1ZOYC 3M0AA 1J1DC 3G9RA 1KF6C 1PIXA 2M3BA 3RGUA 5CHXA 5KLIB 2P7JA 3M9BA 1L0LK 3AE4C 1RHZB 3HE4B 2D2CD 3B8EB 1H88A 1HUCA 1J1EC 5CCHC 2QG4A 3SFED 3CMEP 1JB0J 4D6TJ 2KYVA 3JC22 1AJYA 2XNDH 2ZXXA 2M5AA 1IC2A 2H7HA 3BRVB 1PP9J 2P2UA 1NU1K 3JCUH 1SQQJ 1YTZT 3JCUE 2M0BA 3GMAA 3L75J 3VN0A 1N73B 2XKMA 1FZFA 4I6MC 1QVGO 5AVWB 1JY2P 1IO4A 2ITAA 5C3JC 1SQPJ 4IOIH 4YSZC 3P4PC 3VP8A 3OW2O 3RK2D 3MIWA 2ZFYA 2HODA 4YXDC 2C9NY 1ZV8A 4L73A 3CIRC 1FZCB 2O01H 2N1TD 4TLFA 4WB4A 1NU1G 2D2CB 5C2TC 2WU5D 1NOHA 2NPSB 1URQD 2ZT9B 3QWOC 3WUVA 4JQ0D 1X79B 1BDCA 1SQXJ 2WSFJ 3CX5D 2BCCE 3AEBD 2OGUA 2WS3C 4PV1C 4WY4D 2QE7H 2LXBA 1P84E 3JSVC 2R32A 3L70E 3ITKA 2V4HA 4OWFA 2JR8A 2K9YA 4AQRD 1HF9A 3W67A 2W83C 2Z5IA 2HODB 1KYOD 3SSUA 1DH3A 3RK3D 1PP9D 3W68A 3B4SA 3HD7A 5APXA 2KUBA 2WSCJ 3Q2YA 3AE9C 3PP5A 2XNXA 3P8CE 2QIWA 2QEXP 1SQVE 2HPCB 5APUA 4IFDK 3Q3DA 2XZRA 2LXCB 1KQLA 1SFCA 2KP8A 3BCCJ 5K5GB 1S9KE 3TYYA 2Q3IA 2YKPA 1RF0A 1IFMA 1PL5A 3M9QA 1M8OB 5APWA 2WDQD 5KLVG 2IX7C 2JEEA 1R5SA 4TT3H 3H32A 3A0BE 1DD4A 3P4QD 3HE4A 1KV4A 3H1IG 5CBNA 3L72D 3AEFC 2Y9YA 3RL0C 5CCGD 2K3RA 1L0ND 2IZ1A 3L71D 3MUDA 2A45I 2R3SA 3I56P 2YKQA 1H89A 3VRBC 4B86A 3CCJP 1RF1C 4NPDA 4U7JA 3VMZA 1QGKB 2FYNC 1SQBJ 4DHJA 4H13D 3GLMA 3V2RA 3D6ZA 3HUSC 1L4AA 3EFGA 3L70G 5AW9B 2JO1A 4YTMC 3AE5C 2C9LY 1KF6D 2E75C 1NTZK 1N7SA 3TK1A 4AYCA 1PP9E 5TISH 4H0LB 4N78D 1JMMA 1KYOE 1G1IA 3H1KD 4GKGA 2O1KA 1M90Q 4BWNA 5KJ7A 2PRRA 1DIPA 2WPQA 3V2QA 1DD3A 2OYIB 1IFDA 3VR9D 4UB6E 3KDPB 3CCRP 1BGYE 3CMAP 4I1LA 1FZBA 3KHUA 2O01J 3B71A 3AE3C 1KQFB 3S1KA 1LTIC 5KLIC 1TU3F 3N7NA 1NEND 1J1DB 1VQ8P 1Z56A 1T6AA 3H1JE 1GU5A 3R4YA 4W80A 3FX0A 1SQXE 1L0LD 4L76A 2BCCJ 2WZ7A 4ZKUA 3ZDMA 3VOPA 3H1KJ 3T97B 5BU8B 2W27A 5AVUB 2J5UA 2Y0CA 1GL2B 1SFCD 2WWWA 2XV5A 4C7NB 3L74G 1AQTA 1S72P 2KS1A 2RMZA 2Q9IA 3CC2P 2OYIA 3IR9A 3AEDD 2E74C 2OYHC 1NTKK 2QJYC 4PJ0E 5CCGC 1NTZJ 2YO2A 3TGUJ 4XFJA 2NPSD 1KYOH 1Q90D 1JO5A 4LLHA 4RJTA 1LT9A 2PP6A 1NTMD 3H6PA 5B66H 4GIFA 1N2DC 2B76C 1KN7A 1KILC 1NVOA 3KZIE 2RH0A 1SP4A 2QJPC 2GUVA 1N7SD 3L4FA 2M3EA 5KAFE 1ZOYD 1ZRTD 5KKZC 1DX7A 4WY4B 3TGUG 3L73G 2A45H 1NENC 4N6JA 1JY3P 1KTMA 3CL3D 1YIJP 1BE3D 2QM8A 2G3AA 1BCCE 1S2EA 1VF5B 1NU1J 4Y99B 2BS2C 1G2CB 1M1JC 1URQB 1W2EA 1NEKD 2BS4C 1YJ9P 2P1JA 3OAKA 2KK7A 1YITP 1R5LA 2POHA 1LTGC 1DEBA 3PH0A 1JCCA 1NJIQ 1NGMB 3KYQA 4PV1D 1MV8A 2JKVA 4OVNF 4C7NA 1VPCA 2OARA 3F5HA 5AW5B 1JY3N 3CLQA 5KLVK 2FYNB 1AVOA 1IJDB 3L75G 2PGDA 4PD4H 1N8RQ 2N1TB 1Y8AA 4DOJA 1GW4A 3RK3B 2G8YA 3M0DC 2W90A 1RE3C 2H8PD 2IDBA 2N1TC 2WPSA 3S9OA 4IL6X 1RY3A 3UIAA 3RK2C 4YXWH 4KX6D 1QLED 3CX5I 2WDRD 3CCLP 3AECD 1X0TA 3PHLA 1QLBC 2L5GB 4L75A 2H89C 4DDIA 2Q6QA 1KB9D 1NTME 1YTZI 2W6AA 3M06A 3BCCD 4PV1B 1GD2E 1SS1A 3L73J 3EWKA 3P4RC 2Q3EA 3VRBD 3Q1MA 2ZT9C 2E74D 1XTCC 1PPJD 4YSYC 2YXRB 2FYUK 1N7LA 1GU4A 1USDA 1OW7A 2A06G 3GW6A 1EC5A 1X22A 2Q5UA 1FZGA 1S9KD 3V5BA 1NU1D 1BE3J 1SQVK 3TF5A 2ZAEB 4AUWA 2IBZI 4WVZA 1QX8A 3RBXA 1KMIZ 3TNUA 1TFFA 4OH8B 2Q1KA 3E1IA 1N7SB 2QVAA 2Y0DA 1HTLC 1JTHA 1NTZD 3USSA 3O6QB 1N86A 3L75E 1QEXA 2QM7A 4JPZB 4BRYA 1P84I 3AE9D 3H32B 5AVYB 2NPSC 2GA1A 1HJBA 2AEFA 3II6A 4IL6E 3BRTB 2WU2D 3NMDA 5L8RJ 2RKLA 1LWUA 1G1JA 1GL2C 1M57D 2OTKE 3CPWO 2AXTE 2HYNA 1PGJA 2B89A 1WRGA 1ZR2A 1L4AC 3U1CA 5CMZA 1HBWA 1NH4A 1K8AQ 3V2NA 4YSXC 4YTNC 1OXZA 3KQGA 1FDIA 3VONA 2R5BA 3EQ2A 2FYUJ 2WMMA 1L4AB 2ZYAA 3B5ND 5AVVB 5B5EE 1WT6A 1FZCA 4YXDD 1GL2A 1EXJA 1FE6A 2FBWC 2Q7CA 2ZVOB 3P8MC 4OGQC 5C3JD 1OVUA 4M3LA 1YJNP 2YO3A 4H13C 3AE1C 1PPJE 2E76B 4OGQB 1Y47A 3VMXA 1PZQA 3LW5H 1LWUB 3KXDA 2B87A 2K9JB 3GG2A 5KLVE 1L2PA 3MP7B 3RK3E 2ZFCA 3O8ZA 3H1LG 3HTKA 2IFNA 3AEAD 5E79E 1H0TB 1IFJA 1ZR4A 2WQYD 2BASA 3BVHA 3AEED 3L70D 1HGZA 2WP9C 3FXEA 4D6TD 5DJUB 3PTZA 2E5YA 3KZIH 3HUSB 3TNUB 1NAFA 1NKZB 4C46A 1NTKG 2QJYB 2IBZE 2FBWD 3H1IE 2OYHB 1SQXK 1T3UA 1CSBA 3SFEC 3GHGA 2OYIC 2HG5D 2WT7A 2BEQD 3P8CD 4DHZA 4NPFX 1FDMA 4YPCA 5AW7B 1K04A 2R5DA 1YQ4C 1NTMJ 1EDJA 2PAJA 5GTIE 2QSIA 3L73E 3CCEP 1LP1A 4DHIB 4JF7A 3HTKB 1FAVA 1L4AD 2QA4P 1OW6A 1IFNA 2I8DA 1BGYG 1VQLP 2YMKA 2WPVB 3P4SC 3AEAC 1YHQP 1L0NJ 4PD4I 3P4QC 2WDVD 3H25A 1SQBE 4HKZH 5GTHE 1FU1A 2WITA 1BCCD 3Q5SA 2FFDC 1BE3E 1CW5A 2BCCD 4U3FG 3CX5E 4ZMDA 5KJ7D 3T97A 2O01N 3PRJA 2AXCA 1VQOP 2OTJP 4YTPD 3D6YA 1S5LH 3CXHI 3P7KA 5B66E 1IK7A 2KI7B 1GZLA 1YQ3D 3OA7A 2IFMA 1YQ4D 3L74J 3RL0B 1LTTC 2W6JH 2H43A 5C39A 3L74D 4H0LC 4H44B 4BXLA 3VMAA 2I1JA 1K9MQ 3OJAB 2HR3A 2DW3A 2XDJA 5KAFH 1EXIA 1NTMG 1LGHB 2WU2C 1SQXG 5DJTB 5B5EH 2ZT9D 1KZUB 1RF1B 1OW8A 3VR8C 2N9YB 3LIDA 1NTKJ 3PLNA 2FXPA 4WY4C 3V4WA 1LTBC 3H1HE 3VYIA 3G71P 1FJPA 1J2JB 3SFDC
chains in the Genus database with same CATH topology
2FBWC 4H44C 2YMKA 1VF5C 3C8VA 3GLMA 3LW5J 4H13D 3D6ZA 2WPVB 3P4SC 3AEAC 1AJYA 2K9YA 1HF9A 3FGAD 3P4QC 4OGQC 3AE2C 5C3JD 3RL0g 5C2TD 3AECC 2WDVD 3H25A 1NGMB 1VF5D 4H13C 4I7ZC 3AE1C 4PV1D 2H88D 3AEGD 3AEDD 1S5LX 2E74C 2E76B 4YT0C 2QJYC 4OGQB 4H0LD 2JO1A 4YTMC 2WSEJ 3AE5C 3GF3A 2OQQA 3Q5SA 1KF6D 2E75C 1L0VC 4R4LA 2WSCJ 3Q2YA 1KMIZ 3AE9C 3CIRD 3VRAD 2E75B 3AE7C 4KT0J 2E75D 3GMAA 4XFJA 1KFYD 1E7PC 4YTMD 2QIWA 4R4MA 3RK3E 1Q90D 1YQ3C 3AEDC 4H0LB 1ZP0D 3ABVC 4YTPD 1Y9BA 2E76D 3D6YA 2G8YA 2H89D 3Q3DA 1IK7A 2B76D 2IDBA 4YTND 2H88C 4YTPC 3ABVD 2WS3D 1YQ3D 3S9OA 3AEAD 3P4SD 4KX6C 1HJ0A 1YQ4D 3AE2D 4IL6X 1WMKA 4OGQD 1DIPA 5C3JC 2B76C 3VR8D 3O6QA 2V7QJ 4H13B 4I7ZB 3Q5RA 1RQUA 3AEEC 3SFDD 2WQYD 1GMJA 4H44D 3VRAC 1DD3A 3AE9D 1KILE 3AEBC 4YSZC 4KX6D 3AE6C 3P4PC 2NZ2A 3AE5D 3GF7A 2JP3A 4H0LC 2WQYC 1KQGB 4YXDC 4H44B 3AEED 3VR9D 2WP9C 2WDRD 1NYHA 3AEGC 3CIRC 2QJPC 1MKMA 1FDOA 2WU2D 3IAOA 2MKVA 5L8RJ 1PL5A 3AECD 2YIUC 2BS3C 2WDQD 1UIXA 1VL2A 1QLBC 5M1BA 4TT3H 1ZP0C 2FBWD 2H89C 3P4RD 2O01J 3B71A 3D70A 2D2CB 5C2TC 3AE3C 4YSXD 1DD4A 3P4QD 3SFEC 2ACZC 2WU5D 1KQFB 1EXIA 1ZOYD 3P4PD 4RKUJ 2WU2C 3AE7D 3AE8D 5KLIC 5KKZC 2BEQD 3AEFD 2ZT9B 1S1CX 1TU3F 2E74B 2QJKC 1K05A 4PV1B 4Z1MH 1ZRTE 2BEZF 1ZMEC 1KTMA 1NENC 1NEND 1ZOYC 3VR9C 1RQVA 2WU5C 2D2CC 2WSFJ 3D71A 1K04A 3AE8C 3AEFC 1YQ4C 3G9RA 3Q5PA 3AE6D 1KF6C 3EWKA 1L0VD 1PIXA 3AEBD 1R8EA 3P4RC 2WS3C 1NEKC 2P10A 4YSZD 3VRBD 3AE1D 2G3AA 4PV1C 3Q1MA 3AE3D 4YSXC 2ZT9C 4YTNC 1VF5B 2E74D 2ZT9D 3VR8C 1OW8A 1PV3A 1FDIA 2E76C 3AE4C 3R4YA 2BS2C 3VRBC 4YSYC 1NEKD 2QSIA 2WDVC 2BS4C 1U57A 2WDQC 3AE4D 4YSYD 2D2CD 2FXPA 1KORA 1KFYC 2WP9D 1OMIA 1OW7A 3IN6A 4Y28J 2WDRC 4U7JA 1OW6A 3T97B 4YXDD 4GDOA 2FYNC 2ACZD 3SFED 3SFDC 4YT0D 1EXJA 2J5UA 1JB0J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FBW C;  3P4S C;  3AEA C;  3P4Q C;  3AE2 C;  5C3J D;  5C2T D;  3AEC C;  2WDV D;  2H88 D;  3AE1 C;  3AEG D;  3AED D;  4YT0 C;  4YTM C;  3AE5 C;  1KF6 D;  1L0V C;  3AE9 C;  3CIR D;  3VRA D;  3AE7 C;  1KFY D;  1E7P C;  4YTM D;  1YQ3 C;  3AED C;  1ZP0 D;  3ABV C;  4YTP D;  2H89 D;  2B76 D;  4YTN D;  2H88 C;  4YTP C;  3ABV D;  2WS3 D;  1YQ3 D;  3S9O A;  3AEA D;  3P4S D;  1YQ4 D;  3AE2 D;  5C3J C;  2B76 C;  3VR8 D;  3AEE C;  3SFD D;  2WQY D;  3VRA C;  3AE9 D;  3AEB C;  4YSZ C;  4KX6 D;  3AE6 C;  3P4P C;  3AE5 D;  2WQY C;  4YXD C;  3AEE D;  3VR9 D;  2WP9 C;  2WDR D;  3AEG C;  3CIR C;  2WU2 D;  3AEC D;  2BS3 C;  2WDQ D;  1QLB C;  1ZP0 C;  2FBW D;  2H89 C;  3P4R D;  3B71 A;  5C2T C;  3AE3 C;  4YSX D;  3P4Q D;  3SFE C;  2ACZ C;  2WU5 D;  1ZOY D;  3P4P D;  2WU2 C;  3AE7 D;  3AE8 D;  3AEF D;  1NEN C;  1K05 A;  1KTM A;  3VR9 C;  1NEN D;  1ZOY C;  2WU5 C;  1K04 A;  3AE8 C;  3AEF C;  1YQ4 C;  3AE6 D;  4KX6 C;  1KF6 C;  1L0V D;  3AEB D;  4YSZ D;  3P4R C;  2WS3 C;  1NEK C;  3VRB D;  3AE1 D;  2G3A A;  3AE3 D;  4YSX C;  4YTN C;  3VR8 C;  1OW8 A;  1PV3 A;  3AE4 C;  4YSY C;  2BS2 C;  3VRB C;  1NEK D;  2WDV C;  2BS4 C;  2WDQ C;  3AE4 D;  4YSY D;  1KFY C;  2WP9 D;  1OW7 A;  2WDR C;  1OW6 A;  4YXD D;  2ACZ D;  3SFE D;  3SFD C;  4YT0 D; 
#chains in the Genus database with same CATH topology
 1FZA A;  3MD0 A;  2FFD B;  3L37 A;  4NPE A;  2CK3 H;  3AE2 C;  3H1K E;  3TGU D;  5C2T D;  3AEC C;  3L73 D;  1OX3 A;  2NPS A;  1VQM P;  2H88 D;  2K88 A;  5APY A;  1LJ2 A;  2P67 A;  2OQQ A;  1SLQ A;  3CIR D;  3VRA D;  3B5N C;  3WMM 0;  1MZ9 A;  1E7P C;  4ZNC A;  1P84 H;  1ZP0 D;  2IZ0 A;  2KNC A;  3TGU E;  2Z4E A;  4YTN D;  2H88 C;  2K37 A;  2O3J A;  2FY8 A;  4H44 D;  1JY2 N;  3BAS A;  4GOF A;  4EYY Q;  1HWT C;  3FWL A;  1CI6 A;  4GT1 A;  1T2K D;  4W7Z A;  5KTB A;  1AA0 A;  3AEG C;  5AW6 B;  4IFM A;  2MKV A;  3L75 D;  1OIP A;  1MFZ A;  1ZLL A;  5H2F E;  1FZC C;  1VDF A;  2FFD A;  1J1E B;  2ACZ C;  1FJK A;  4WY4 A;  5GTH H;  1H0T A;  3G3Z A;  2Y9Z A;  3MTU E;  2QJK C;  2C0X A;  3M9H A;  2FYZ A;  3H1I J;  2W6B A;  3A2A A;  4KX6 C;  1NEK C;  3A5T A;  3AE1 D;  3P32 A;  1NKN A;  3AE4 D;  2L91 A;  1OMI A;  1E79 H;  1SQB G;  1BCC J;  1KB9 H;  1NU1 E;  3RK2 B;  1FS0 E;  4EDF A;  5TIS E;  1RE4 A;  1KFM A;  3RL0 g;  3BCC G;  1PFI A;  1GK4 A;  3CI9 A;  5APT A;  1RH5 B;  1S5L E;  5CBO A;  4BRY B;  2M5A B;  1L0V C;  1PPJ G;  5AW3 B;  3VP9 A;  4RES B;  1SQV G;  3CCU P;  2A06 D;  3ABV C;  4W7Y A;  4ZKP A;  3WUU A;  1EDL A;  4I7Z B;  2IBZ G;  5E79 H;  3CWB G;  2ZJS E;  2IPP A;  2N9B A;  1N73 C;  3L71 J;  2KXP B;  3L74 E;  1NYH A;  1M7L A;  1MKM A;  3HUS A;  1VQ5 P;  1JTH B;  3IAO A;  2FXO A;  1S3J A;  1OVR A;  1U7J A;  3LIE A;  5GTI H;  1KQS O;  1NWQ A;  2AEJ A;  2JWA A;  1FC2 C;  3SWF A;  4RKU J;  1SQP D;  3AE8 D;  4U3F J;  1NTZ G;  2P10 A;  2FKW B;  3G6E P;  1CI6 B;  3G4S P;  2XU6 A;  3TDK A;  3IF4 A;  1JNM A;  1SQQ D;  4KHX A;  3E1R A;  4YSY D;  2HLO A;  3IN6 A;  4Y28 J;  4HYT B;  1VQ7 P;  1KIL B;  5KAI E;  4GDO A;  1KIL D;  1NTK E;  3H1H D;  1URQ A;  3I55 P;  1Q86 Q;  1IFP A;  1RF0 C;  1CZQ A;  3H1H J;  2Z5H A;  1OVV A;  3CC4 P;  2WSE H;  2QRX A;  1KIL A;  1H8A A;  2V7Q H;  2WSE J;  1SFC C;  1LWU C;  2W8Z A;  1Q81 Q;  3AED C;  1KD1 Q;  5CJ0 A;  1OWA A;  1VQN P;  1YYC A;  3S4R A;  4OGQ D;  4N3Y B;  3O6Q A;  1LTJ C;  3Q5R A;  3RBZ A;  1KIL E;  1SVF A;  3M91 A;  1FBM A;  3PJS K;  3AE5 D;  3QH9 A;  4LDT A;  2KS1 B;  2LKM A;  3V2P A;  3U59 A;  2YIU C;  1ZXG A;  1X8Y A;  1N7S C;  3U1A A;  2R44 A;  3H1L J;  3B5N B;  1D7M A;  4YSX D;  4XE5 B;  3H1L D;  1K05 A;  1VQ4 P;  3VR9 C;  2WPR A;  2ZXE B;  3H1J G;  2MJZ A;  3C1L A;  4PD4 D;  1M56 D;  1K73 Q;  3I5C A;  2RN0 A;  2CPS A;  4EOT A;  4CPG A;  2WDV C;  1PGQ A;  1NAY A;  4D6T G;  2WT7 B;  4D6T E;  2WVR A;  1UII A;  3NTN A;  4UB8 E;  1X9V A;  2YIU B;  1NTK D;  4EIJ A;  2FYU E;  1JEK A;  4DJG A;  2KIK A;  2FYU G;  5APQ A;  5AVQ B;  1SQQ E;  1LTJ B;  2A06 E;  4LC1 A;  4YT0 C;  1EZV D;  3CCQ P;  1JCD A;  2E75 D;  4YTM D;  1G2C A;  3CC7 P;  1AV1 A;  1SQP E;  2OTL P;  3R2P A;  4I2L C;  5KLV J;  2B76 D;  1BGY D;  1SQP K;  1W2B O;  1AVY A;  2V7Q J;  5CCG A;  3SFD D;  2B9B A;  2JP3 A;  3M0D A;  2P58 A;  2O1J A;  1BCC G;  1FDO A;  2ZYD A;  1IFI A;  5AW4 B;  2BCC G;  4U3F D;  4HH2 A;  2BS3 C;  3L36 A;  3FWN A;  1JM0 A;  3K5B A;  5M1B A;  4PD4 E;  2K1A A;  3L71 E;  1T8Z A;  4O9B A;  5AVT B;  2OYH A;  3CD6 P;  4HJG H;  4WBA A;  1W5C E;  4ASV A;  1RE4 C;  3D71 A;  4MN4 C;  3A0H H;  5AVR B;  2HFE D;  5APV A;  4U3F E;  3A3Y B;  1NHL A;  4UB8 H;  1SQB K;  1LP1 B;  1KFY C;  2WDR C;  3BAT A;  3A7O A;  1VQ9 P;  3NFQ A;  1JY2 O;  1FOS E;  3HE5 B;  4DDG A;  1VF5 C;  4Y99 C;  1SQX D;  1U7M A;  3RK3 C;  1EDK A;  1VF5 D;  2J58 A;  2Y0E A;  4I7Z C;  1S5L X;  1QL2 A;  1L0N E;  4FJV A;  5KJ7 C;  3HD7 B;  3F89 A;  3NXS A;  1KFY D;  1AFO A;  4R4M A;  2M8R A;  3CXH E;  3WU2 H;  2HPC A;  1BSH A;  1GDT A;  3WU2 E;  4EI2 A;  4JYC A;  1Y9B A;  2QJP B;  3HD7 D;  3N4X A;  2JDI H;  3P4S D;  2JWD A;  1HJ0 A;  4QMA A;  2B87 B;  2K9J A;  2E43 A;  3HD7 C;  1L0L J;  1T2K C;  1GMJ A;  3A0B H;  4LGD E;  1JOC A;  3AEB C;  2NZ2 A;  2KSJ A;  1URQ C;  1M1J B;  1UIX A;  4C7R A;  1ZP0 C;  2OYO A;  3D70 A;  2CPB A;  1IK9 A;  3L35 A;  1M1J A;  4Z1M H;  3H1L E;  1YI2 P;  1OFC X;  2WU5 C;  2D2C C;  2LR2 A;  3AE8 C;  1PP9 G;  1SQQ K;  2KOG A;  4YSZ D;  1R8E A;  2E42 A;  1PV3 A;  2YNY A;  2ZYG A;  1NTM K;  3E7K A;  1RF1 A;  2WTY A;  4IFF A;  2WP9 D;  2E5T A;  3IFM A;  1L0N K;  1JUN A;  2GM4 A;  4YT0 D;  3C8V A;  3LW5 J;  1VQP P;  1ZW0 A;  2KZJ A;  3FGA D;  3L72 J;  1VQK P;  5AVS B;  3RL0 D;  4R4L A;  3V6I A;  2YMY A;  1A02 J;  5KLV D;  4KT0 J;  5CCH D;  1LT9 C;  1T3J A;  2KNC B;  4JBZ A;  1KB9 I;  1SQB D;  3C9I A;  1N73 A;  5AVX B;  2H89 D;  3H1I D;  2UWJ E;  3ABV D;  2WS3 D;  4K3A A;  1KYO I;  3HE5 A;  1OZH A;  3L72 G;  1L0N G;  1KC8 Q;  3L71 G;  2QJK B;  1Q2N A;  1RE3 A;  1BGY J;  3CWB J;  4WWI A;  2KSE A;  2NRG A;  2AXT H;  5BU5 A;  3MGN A;  3VMY A;  1MUU A;  1SQV D;  1NO4 A;  3P4P D;  3H1J J;  1EDI A;  1ZRT E;  2BEZ F;  1LT1 A;  3VTP C;  3AE6 D;  2IBZ D;  3CWB D;  3AE3 D;  1FOS F;  1GL2 D;  1GW3 A;  1JY3 O;  2JJL A;  1KOR A;  3WUT A;  4PJ0 H;  4RO0 A;  5KAI H;  3H1K G;  2ACZ D;  3MUD C;  4DZO A;  5AW1 B;  2I1K A;  4H44 C;  1NTZ E;  1HGV A;  1SQP G;  1P84 D;  3GHG B;  4GOD A;  5APS A;  3AEG D;  3GHG C;  2AEM A;  1GTW A;  3SWY A;  3V4Q A;  3FXD A;  1BDD A;  2E75 B;  1XTG B;  1LTS C;  1SQQ G;  1PGO A;  1USE A;  2YKO A;  4A7P A;  2PFX A;  2WSC H;  3AE2 D;  3H1H G;  1WMK A;  1S4X A;  1SFC B;  1RQU A;  3AEE C;  3VRA C;  5H2F H;  4JYB A;  3GF7 A;  3CCM P;  4KJM A;  1KQG B;  2WQY C;  2KLV A;  1L0L G;  1L0L E;  2ZVN B;  5BVZ A;  2C0W A;  1IZN B;  3CCS P;  3CX5 H;  3MHV A;  5CCH A;  1HVV A;  3CCV P;  1Q7Y Q;  3P4R D;  1HH0 A;  1BSN A;  4N78 E;  1ZN5 A;  1MFT A;  3CXH D;  3EFF K;  4L74 A;  3AEF D;  3HRN A;  3SWK A;  1JMB A;  2SPZ A;  1RQV A;  2FXM A;  1KB9 E;  3KPE A;  4IL6 H;  3Q5P A;  1GK6 A;  1L0V D;  3L70 J;  2B88 A;  1EQ7 A;  5KKZ B;  2WSF H;  5EFW B;  2A45 G;  2E76 C;  1M1K Q;  3MZW B;  1U57 A;  2WDQ C;  1EZV I;  5AW0 B;  2KLU A;  1KFN A;  1YBK A;  1QL1 A;  4HB1 A;  1QVF O;  2R3C A;  4DCK A;  2VRS A;  3H1J D;  2GUS A;  3A0H E;  2J59 M;  4H0L D;  4UB6 H;  1SQV J;  3GF3 A;  3L72 E;  1A02 F;  3AE7 C;  4GOE A;  5CJ4 A;  2N1T A;  4ASW A;  5AW8 B;  1EZV E;  5AVZ B;  3BCC E;  1AQ5 A;  1YQ3 C;  1LTA C;  5AW2 B;  2E76 D;  4YTP C;  3TSI A;  2YXQ B;  1LTJ A;  3VR8 D;  4I6L A;  1BE3 G;  4H13 B;  2FYU D;  3AE6 C;  1VQ6 P;  1YJW P;  4XA4 A;  1LNQ A;  2IYP A;  1LT9 B;  1E5W A;  5TJH A;  2KZI A;  1EZV G;  3B5N A;  1VL2 A;  1DEE G;  2WSS H;  3CWB E;  1FZE A;  3CXH H;  1Q82 Q;  1PGP A;  2KB7 P;  3AE7 D;  1S1C X;  2IYO A;  2E74 B;  1ZME C;  4DT0 A;  4K35 A;  1ZOY C;  3M0A A;  1J1D C;  3G9R A;  1KF6 C;  1PIX A;  2M3B A;  3RGU A;  5CHX A;  5KLI B;  2P7J A;  3M9B A;  1L0L K;  3AE4 C;  1RHZ B;  3HE4 B;  2D2C D;  3B8E B;  1H88 A;  1HUC A;  1J1E C;  5CCH C;  2QG4 A;  3SFE D;  3CME P;  1JB0 J;  4D6T J;  2KYV A;  3JC2 2;  1AJY A;  2XND H;  2ZXX A;  2M5A A;  1IC2 A;  2H7H A;  3BRV B;  1PP9 J;  2P2U A;  1NU1 K;  3JCU H;  1SQQ J;  1YTZ T;  3JCU E;  2M0B A;  3GMA A;  3L75 J;  3VN0 A;  1N73 B;  2XKM A;  1FZF A;  4I6M C;  1QVG O;  5AVW B;  1JY2 P;  1IO4 A;  2ITA A;  5C3J C;  1SQP J;  4IOI H;  4YSZ C;  3P4P C;  3VP8 A;  3OW2 O;  3RK2 D;  3MIW A;  2ZFY A;  2HOD A;  4YXD C;  2C9N Y;  1ZV8 A;  4L73 A;  3CIR C;  1FZC B;  2O01 H;  2N1T D;  4TLF A;  4WB4 A;  1NU1 G;  2D2C B;  5C2T C;  2WU5 D;  1NOH A;  2NPS B;  1URQ D;  2ZT9 B;  3QWO C;  3WUV A;  4JQ0 D;  1X79 B;  1BDC A;  1SQX J;  2WSF J;  3CX5 D;  2BCC E;  3AEB D;  2OGU A;  2WS3 C;  4PV1 C;  4WY4 D;  2QE7 H;  2LXB A;  1P84 E;  3JSV C;  2R32 A;  3L70 E;  3ITK A;  2V4H A;  4OWF A;  2JR8 A;  2K9Y A;  4AQR D;  1HF9 A;  3W67 A;  2W83 C;  2Z5I A;  2HOD B;  1KYO D;  3SSU A;  1DH3 A;  3RK3 D;  1PP9 D;  3W68 A;  3B4S A;  3HD7 A;  5APX A;  2KUB A;  2WSC J;  3Q2Y A;  3AE9 C;  3PP5 A;  2XNX A;  3P8C E;  2QIW A;  2QEX P;  1SQV E;  2HPC B;  5APU A;  4IFD K;  3Q3D A;  2XZR A;  2LXC B;  1KQL A;  1SFC A;  2KP8 A;  3BCC J;  5K5G B;  1S9K E;  3TYY A;  2Q3I A;  2YKP A;  1RF0 A;  1IFM A;  1PL5 A;  3M9Q A;  1M8O B;  5APW A;  2WDQ D;  5KLV G;  2IX7 C;  2JEE A;  1R5S A;  4TT3 H;  3H32 A;  3A0B E;  1DD4 A;  3P4Q D;  3HE4 A;  1KV4 A;  3H1I G;  5CBN A;  3L72 D;  3AEF C;  2Y9Y A;  3RL0 C;  5CCG D;  2K3R A;  1L0N D;  2IZ1 A;  3L71 D;  3MUD A;  2A45 I;  2R3S A;  3I56 P;  2YKQ A;  1H89 A;  3VRB C;  4B86 A;  3CCJ P;  1RF1 C;  4NPD A;  4U7J A;  3VMZ A;  1QGK B;  2FYN C;  1SQB J;  4DHJ A;  4H13 D;  3GLM A;  3V2R A;  3D6Z A;  3HUS C;  1L4A A;  3EFG A;  3L70 G;  5AW9 B;  2JO1 A;  4YTM C;  3AE5 C;  2C9L Y;  1KF6 D;  2E75 C;  1NTZ K;  1N7S A;  3TK1 A;  4AYC A;  1PP9 E;  5TIS H;  4H0L B;  4N78 D;  1JMM A;  1KYO E;  1G1I A;  3H1K D;  4GKG A;  2O1K A;  1M90 Q;  4BWN A;  5KJ7 A;  2PRR A;  1DIP A;  2WPQ A;  3V2Q A;  1DD3 A;  2OYI B;  1IFD A;  3VR9 D;  4UB6 E;  3KDP B;  3CCR P;  1BGY E;  3CMA P;  4I1L A;  1FZB A;  3KHU A;  2O01 J;  3B71 A;  3AE3 C;  1KQF B;  3S1K A;  1LTI C;  5KLI C;  1TU3 F;  3N7N A;  1NEN D;  1J1D B;  1VQ8 P;  1Z56 A;  1T6A A;  3H1J E;  1GU5 A;  3R4Y A;  4W80 A;  3FX0 A;  1SQX E;  1L0L D;  4L76 A;  2BCC J;  2WZ7 A;  4ZKU A;  3ZDM A;  3VOP A;  3H1K J;  3T97 B;  5BU8 B;  2W27 A;  5AVU B;  2J5U A;  2Y0C A;  1GL2 B;  1SFC D;  2WWW A;  2XV5 A;  4C7N B;  3L74 G;  1AQT A;  1S72 P;  2KS1 A;  2RMZ A;  2Q9I A;  3CC2 P;  2OYI A;  3IR9 A;  3AED D;  2E74 C;  2OYH C;  1NTK K;  2QJY C;  4PJ0 E;  5CCG C;  1NTZ J;  2YO2 A;  3TGU J;  4XFJ A;  2NPS D;  1KYO H;  1Q90 D;  1JO5 A;  4LLH A;  4RJT A;  1LT9 A;  2PP6 A;  1NTM D;  3H6P A;  5B66 H;  4GIF A;  1N2D C;  2B76 C;  1KN7 A;  1KIL C;  1NVO A;  3KZI E;  2RH0 A;  1SP4 A;  2QJP C;  2GUV A;  1N7S D;  3L4F A;  2M3E A;  5KAF E;  1ZOY D;  1ZRT D;  5KKZ C;  1DX7 A;  4WY4 B;  3TGU G;  3L73 G;  2A45 H;  1NEN C;  4N6J A;  1JY3 P;  1KTM A;  3CL3 D;  1YIJ P;  1BE3 D;  2QM8 A;  2G3A A;  1BCC E;  1S2E A;  1VF5 B;  1NU1 J;  4Y99 B;  2BS2 C;  1G2C B;  1M1J C;  1URQ B;  1W2E A;  1NEK D;  2BS4 C;  1YJ9 P;  2P1J A;  3OAK A;  2KK7 A;  1YIT P;  1R5L A;  2POH A;  1LTG C;  1DEB A;  3PH0 A;  1JCC A;  1NJI Q;  1NGM B;  3KYQ A;  4PV1 D;  1MV8 A;  2JKV A;  4OVN F;  4C7N A;  1VPC A;  2OAR A;  3F5H A;  5AW5 B;  1JY3 N;  3CLQ A;  5KLV K;  2FYN B;  1AVO A;  1IJD B;  3L75 G;  2PGD A;  4PD4 H;  1N8R Q;  2N1T B;  1Y8A A;  4DOJ A;  1GW4 A;  3RK3 B;  2G8Y A;  3M0D C;  2W90 A;  1RE3 C;  2H8P D;  2IDB A;  2N1T C;  2WPS A;  3S9O A;  4IL6 X;  1RY3 A;  3UIA A;  3RK2 C;  4YXW H;  4KX6 D;  1QLE D;  3CX5 I;  2WDR D;  3CCL P;  3AEC D;  1X0T A;  3PHL A;  1QLB C;  2L5G B;  4L75 A;  2H89 C;  4DDI A;  2Q6Q A;  1KB9 D;  1NTM E;  1YTZ I;  2W6A A;  3M06 A;  3BCC D;  4PV1 B;  1GD2 E;  1SS1 A;  3L73 J;  3EWK A;  3P4R C;  2Q3E A;  3VRB D;  3Q1M A;  2ZT9 C;  2E74 D;  1XTC C;  1PPJ D;  4YSY C;  2YXR B;  2FYU K;  1N7L A;  1GU4 A;  1USD A;  1OW7 A;  2A06 G;  3GW6 A;  1EC5 A;  1X22 A;  2Q5U A;  1FZG A;  1S9K D;  3V5B A;  1NU1 D;  1BE3 J;  1SQV K;  3TF5 A;  2ZAE B;  4AUW A;  2IBZ I;  4WVZ A;  1QX8 A;  3RBX A;  1KMI Z;  3TNU A;  1TFF A;  4OH8 B;  2Q1K A;  3E1I A;  1N7S B;  2QVA A;  2Y0D A;  1HTL C;  1JTH A;  1NTZ D;  3USS A;  3O6Q B;  1N86 A;  3L75 E;  1QEX A;  2QM7 A;  4JPZ B;  4BRY A;  1P84 I;  3AE9 D;  3H32 B;  5AVY B;  2NPS C;  2GA1 A;  1HJB A;  2AEF A;  3II6 A;  4IL6 E;  3BRT B;  2WU2 D;  3NMD A;  5L8R J;  2RKL A;  1LWU A;  1G1J A;  1GL2 C;  1M57 D;  2OTK E;  3CPW O;  2AXT E;  2HYN A;  1PGJ A;  2B89 A;  1WRG A;  1ZR2 A;  1L4A C;  3U1C A;  5CMZ A;  1HBW A;  1NH4 A;  1K8A Q;  3V2N A;  4YSX C;  4YTN C;  1OXZ A;  3KQG A;  1FDI A;  3VON A;  2R5B A;  3EQ2 A;  2FYU J;  2WMM A;  1L4A B;  2ZYA A;  3B5N D;  5AVV B;  5B5E E;  1WT6 A;  1FZC A;  4YXD D;  1GL2 A;  1EXJ A;  1FE6 A;  2FBW C;  2Q7C A;  2ZVO B;  3P8M C;  4OGQ C;  5C3J D;  1OVU A;  4M3L A;  1YJN P;  2YO3 A;  4H13 C;  3AE1 C;  1PPJ E;  2E76 B;  4OGQ B;  1Y47 A;  3VMX A;  1PZQ A;  3LW5 H;  1LWU B;  3KXD A;  2B87 A;  2K9J B;  3GG2 A;  5KLV E;  1L2P A;  3MP7 B;  3RK3 E;  2ZFC A;  3O8Z A;  3H1L G;  3HTK A;  2IFN A;  3AEA D;  5E79 E;  1H0T B;  1IFJ A;  1ZR4 A;  2WQY D;  2BAS A;  3BVH A;  3AEE D;  3L70 D;  1HGZ A;  2WP9 C;  3FXE A;  4D6T D;  5DJU B;  3PTZ A;  2E5Y A;  3KZI H;  3HUS B;  3TNU B;  1NAF A;  1NKZ B;  4C46 A;  1NTK G;  2QJY B;  2IBZ E;  2FBW D;  3H1I E;  2OYH B;  1SQX K;  1T3U A;  1CSB A;  3SFE C;  3GHG A;  2OYI C;  2HG5 D;  2WT7 A;  2BEQ D;  3P8C D;  4DHZ A;  4NPF X;  1FDM A;  4YPC A;  5AW7 B;  1K04 A;  2R5D A;  1YQ4 C;  1NTM J;  1EDJ A;  2PAJ A;  5GTI E;  2QSI A;  3L73 E;  3CCE P;  1LP1 A;  4DHI B;  4JF7 A;  3HTK B;  1FAV A;  1L4A D;  2QA4 P;  1OW6 A;  1IFN A;  2I8D A;  1BGY G;  1VQL P;  2YMK A;  2WPV B;  3P4S C;  3AEA C;  1YHQ P;  1L0N J;  4PD4 I;  3P4Q C;  2WDV D;  3H25 A;  1SQB E;  4HKZ H;  5GTH E;  1FU1 A;  2WIT A;  1BCC D;  3Q5S A;  2FFD C;  1BE3 E;  1CW5 A;  2BCC D;  4U3F G;  3CX5 E;  4ZMD A;  5KJ7 D;  3T97 A;  2O01 N;  3PRJ A;  2AXC A;  1VQO P;  2OTJ P;  4YTP D;  3D6Y A;  1S5L H;  3CXH I;  3P7K A;  5B66 E;  1IK7 A;  2KI7 B;  1GZL A;  1YQ3 D;  3OA7 A;  2IFM A;  1YQ4 D;  3L74 J;  3RL0 B;  1LTT C;  2W6J H;  2H43 A;  5C39 A;  3L74 D;  4H0L C;  4H44 B;  4BXL A;  3VMA A;  2I1J A;  1K9M Q;  3OJA B;  2HR3 A;  2DW3 A;  2XDJ A;  5KAF H;  1EXI A;  1NTM G;  1LGH B;  2WU2 C;  1SQX G;  5DJT B;  5B5E H;  2ZT9 D;  1KZU B;  1RF1 B;  1OW8 A;  3VR8 C;  2N9Y B;  3LID A;  1NTK J;  3PLN A;  2FXP A;  4WY4 C;  3V4W A;  1LTB C;  3H1H E;  3VYI A;  3G71 P;  1FJP A;  1J2J B;  3SFD C; 
#chains in the Genus database with same CATH homology
 2FBW C;  4H44 C;  2YMK A;  1VF5 C;  3C8V A;  3GLM A;  3LW5 J;  4H13 D;  3D6Z A;  2WPV B;  3P4S C;  3AEA C;  1AJY A;  2K9Y A;  1HF9 A;  3FGA D;  3P4Q C;  4OGQ C;  3AE2 C;  5C3J D;  3RL0 g;  5C2T D;  3AEC C;  2WDV D;  3H25 A;  1NGM B;  1VF5 D;  4H13 C;  4I7Z C;  3AE1 C;  4PV1 D;  2H88 D;  3AEG D;  3AED D;  1S5L X;  2E74 C;  2E76 B;  4YT0 C;  2QJY C;  4OGQ B;  4H0L D;  2JO1 A;  4YTM C;  2WSE J;  3AE5 C;  3GF3 A;  2OQQ A;  3Q5S A;  1KF6 D;  2E75 C;  1L0V C;  4R4L A;  2WSC J;  3Q2Y A;  1KMI Z;  3AE9 C;  3CIR D;  3VRA D;  2E75 B;  3AE7 C;  4KT0 J;  2E75 D;  3GMA A;  4XFJ A;  1KFY D;  1E7P C;  4YTM D;  2QIW A;  4R4M A;  3RK3 E;  1Q90 D;  1YQ3 C;  3AED C;  4H0L B;  1ZP0 D;  3ABV C;  4YTP D;  1Y9B A;  2E76 D;  3D6Y A;  2G8Y A;  2H89 D;  3Q3D A;  1IK7 A;  2B76 D;  2IDB A;  4YTN D;  2H88 C;  4YTP C;  3ABV D;  2WS3 D;  1YQ3 D;  3S9O A;  3AEA D;  3P4S D;  4KX6 C;  1HJ0 A;  1YQ4 D;  3AE2 D;  4IL6 X;  1WMK A;  4OGQ D;  1DIP A;  5C3J C;  2B76 C;  3VR8 D;  3O6Q A;  2V7Q J;  4H13 B;  4I7Z B;  3Q5R A;  1RQU A;  3AEE C;  3SFD D;  2WQY D;  1GMJ A;  4H44 D;  3VRA C;  1DD3 A;  3AE9 D;  1KIL E;  3AEB C;  4YSZ C;  4KX6 D;  3AE6 C;  3P4P C;  2NZ2 A;  3AE5 D;  3GF7 A;  2JP3 A;  4H0L C;  2WQY C;  1KQG B;  4YXD C;  4H44 B;  3AEE D;  3VR9 D;  2WP9 C;  2WDR D;  1NYH A;  3AEG C;  3CIR C;  2QJP C;  1MKM A;  1FDO A;  2WU2 D;  3IAO A;  2MKV A;  5L8R J;  1PL5 A;  3AEC D;  2YIU C;  2BS3 C;  2WDQ D;  1UIX A;  1VL2 A;  1QLB C;  5M1B A;  4TT3 H;  1ZP0 C;  2FBW D;  2H89 C;  3P4R D;  2O01 J;  3B71 A;  3D70 A;  2D2C B;  5C2T C;  3AE3 C;  4YSX D;  1DD4 A;  3P4Q D;  3SFE C;  2ACZ C;  2WU5 D;  1KQF B;  1EXI A;  1ZOY D;  3P4P D;  4RKU J;  2WU2 C;  3AE7 D;  3AE8 D;  5KLI C;  5KKZ C;  2BEQ D;  3AEF D;  2ZT9 B;  1S1C X;  1TU3 F;  2E74 B;  2QJK C;  1K05 A;  4PV1 B;  4Z1M H;  1ZRT E;  2BEZ F;  1ZME C;  1KTM A;  1NEN C;  1NEN D;  1ZOY C;  3VR9 C;  1RQV A;  2WU5 C;  2D2C C;  2WSF J;  3D71 A;  1K04 A;  3AE8 C;  3AEF C;  1YQ4 C;  3G9R A;  3Q5P A;  3AE6 D;  1KF6 C;  3EWK A;  1L0V D;  1PIX A;  3AEB D;  1R8E A;  3P4R C;  2WS3 C;  1NEK C;  2P10 A;  4YSZ D;  3VRB D;  3AE1 D;  2G3A A;  4PV1 C;  3Q1M A;  3AE3 D;  4YSX C;  2ZT9 C;  4YTN C;  1VF5 B;  2E74 D;  2ZT9 D;  3VR8 C;  1OW8 A;  1PV3 A;  1FDI A;  2E76 C;  3AE4 C;  3R4Y A;  2BS2 C;  3VRB C;  4YSY C;  1NEK D;  2QSI A;  2WDV C;  2BS4 C;  1U57 A;  2WDQ C;  3AE4 D;  4YSY D;  2D2C D;  2FXP A;  1KOR A;  1KFY C;  2WP9 D;  1OMI A;  1OW7 A;  3IN6 A;  4Y28 J;  2WDR C;  4U7J A;  1OW6 A;  3T97 B;  4YXD D;  4GDO A;  2FYN C;  2ACZ D;  3SFE D;  3SFD C;  4YT0 D;  1EXJ A;  2J5U A;  1JB0 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...