3SFDC

Crystal structure of porcine mitochondrial respiratory complex ii bound with oxaloacetate and pentachlorophenol
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Thiabendazole inhibits ubiquinone reduction activity of mitochondrial respiratory complex II via a water molecule mediated binding feature.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
total genus 49
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2011-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3sfdC01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3sfdC02
2WU5C 1YQ3C 3AEGD 4YSXC 2WP9D 1YQ4C 3AECC 3P4PD 3VRAC 4YTNC 5C2TD 2ACZC 4KX6D 3AE1C 3SFEC 3AEGC 4YSXD 3AEEC 2WDVD 3AE7D 3S9OA 3AEDD 2H89C 1ZOYD 1NEKD 3VR9C 3AEBD 2WU2C 3P4SC 3AEED 3VRBD 2WDQD 3AE7C 2WQYC 4YXDC 1NEKC 3VR9D 3SFDC 5C3JD 2WU5D 2WP9C 2G3AA 3AECD 3VR8D 2ACZD 3P4QD 1KTMA 2BS2C 2H88D 2FBWC 3ABVD 2B76C 4YT0C 3AE8C 1L0VD 2WU2D 3VRBC 3AEAD 4YTMD 2WDVC 3P4RD 3AE5D 3VR8C 3AE2C 3AE3C 1PV3A 1YQ3D 1KF6C 1NENC 2FBWD 3P4PC 4KX6C 3SFDD 1KF6D 2BS4C 4YTPC 4YSZC 1QLBC 3AE4D 2WDQC 1K04A 3B71A 1YQ4D 2WS3D 3VRAD 4YT0D 3AE3D 2BS3C 2WDRC 1ZOYC 2H89D 1OW8A 3AE9D 1ZP0D 1K05A 3P4SD 3P4RC 2B76D 5C3JC 1L0VC 3AE8D 1ZP0C 3AE4C 1NEND 1OW7A 4YSYD 1KFYD 3AEDC 3CIRD 3AEFD 2H88C 1E7PC 3ABVC 1KFYC 4YTND 5C2TC 2WQYD 3AE2D 4YXDD 3AEFC 3AE1D 3AE9C 4YSZD 3SFED 3AE6D 3AEAC 2WS3C 3P4QC 3AEBC 3AE6C 4YTMC 4YSYC 3AE5C 2WDRD 3CIRC 1OW6A 4YTPD
chains in the Genus database with same CATH superfamily
1X9VA 5BU5A 2WMMA 1S4XA 1GL2C 3S9OA 3TDKA 3AEDD 3CCEP 1VQ6P 2K9JA 5KLVE 1NTZK 4ZMDA 5APWA 5C3JD 2KK7A 2G3AA 2LXBA 4H13D 2RKLA 3JSVC 3BCCD 3JCUH 2E5TA 2WPQA 1FJPA 2YKQA 1LWUC 4I7ZB 4L75A 2W6BA 3TSIA 1URQB 2O1KA 4KT0J 4I6LA 2BCCJ 2Q3IA 1KYOD 3K5BA 2E42A 5K5GB 2M5AB 1YTZT 2WITA 2HPCB 2ZYDA 5B5EH 4I7ZC 1S9KE 2P10A 1M56D 1YIJP 1N73C 4PD4I 2GUVA 1ZP0D 3CCMP 4U3FE 1R5SA 3L73D 2GUSA 1NTKJ 2K9JB 2CPSA 3WUVA 2OYIB 1SQXJ 1OMIA 3WUTA 1KFNA 3AEGD 2WP9D 2W27A 2Q9IA 2E75D 4AUWA 2K88A 1N73A 1L0LJ 2OYIC 1A02J 1NKNA 2KNCB 4PV1B 1VQLP 3D6YA 1Y9BA 2WP9C 4L73A 1IFDA 1U7JA 1FE6A 1VL2A 2BS2C 1FZGA 2KZJA 1EDJA 1IZNB 5AVRB 5AVWB 4NPDA 5APVA 1JOCA 3EFGA 3V4QA 2IZ1A 2JEEA 1VQMP 2H7HA 1KF6C 3WU2H 4HYTB 1NYHA 4Y99B 3GG2A 4W7YA 1NTMG 1PGPA 1NO4A 4JBZA 1MKMA 2ZVOB 5E79E 1L4AD 3U1AA 1K04A 3W67A 2I1KA 3M0DA 3CCUP 3H1IE 2HODB 3O6QB 2OYHA 3A0BE 1SQQG 1JTHB 3CCVP 3S4RA 3HUSB 1JEKA 3VMZA 4WY4D 3P4RC 3GW6A 3E1RA 2LXCB 3O8ZA 4YSYD 3CIRD 3T97A 1M1JA 2B9BA 2YO2A 5DJUB 4R4LA 1Q2NA 1X79B 3PP5A 2IBZI 4DZOA 3LIEA 4WVZA 3AE9C 5KAIE 2I8DA 1KQSO 3SWFA 3AEBC 1ZW0A 1LP1B 2XDJA 3VRAC 3USSA 1NTZG 1RY3A 1JMBA 1P84H 2IBZE 1XTGB 1RQVA 2ZAEB 5APTA 3AEED 3AE7C 1OVVA 4WWIA 2ZYGA 1M1KQ 3RBXA 3H1LJ 2P58A 3ITKA 1LTSC 5KJ7C 4C7RA 3N7NA 2N1TD 2B76C 1BSNA 1RF0C 2ZT9C 4GIFA 1NTKD 2L5GB 4CPGA 2HG5D 3H1LG 1ZR2A 1FDMA 1QEXA 2KLUA 3L37A 3BRVB 2YO3A 2OARA 2C9LY 1WT6A 1NENC 1PZQA 1GK4A 1BGYJ 2FYUG 1NJIQ 4DHIB 1IFIA 1S1CX 3B71A 3HE5A 1BDCA 3TNUA 4YPCA 2FYUJ 2BS3C 3LIDA 3P8CE 4OGQB 3H32B 4RKUJ 4R4MA 1QLED 1TU3F 4N6JA 1NTKE 3RK2C 4YTND 1HJ0A 2C9NY 3AE6D 1L4AC 3TGUD 3IAOA 2ZXXA 5AW9B 2E75B 3CLQA 3AE5C 1OW6A 3H32A 4YTPD 5KAIH 5TISH 3IF4A 1OFCX 1SQPE 1EC5A 1VQPP 2WDVD 1UIIA 3VR9C 2IYOA 1A02F 2QJKB 3MGNA 2BCCE 3LW5H 1URQC 2JKVA 2E76B 4K3AA 1XTCC 5B5EE 3P4QD 2Q7CA 5KLIB 3Q3DA 1LT1A 3CWBE 1MFTA 3HD7C 5H2FE 3CD6P 4LGDE 1PP9D 2BEQD 4H44D 2FYUE 1NTZD 1KB9I 1URQD 1EDIA 2V7QJ 3B5NB 1L0ND 1AFOA 3CCLP 3PLNA 2FBWD 2J59M 2QG4A 2XKMA 1GL2D 1T3JA 1ZRTE 1BE3J 3KPEA 1KQFB 1IFNA 4GKGA 4ASVA 1ZOYC 1RE3C 5CCGC 5CJ0A 1K05A 3P4SD 1GTWA 1CI6B 3QH9A 5B66H 1LP1A 1FZCC 4D6TG 1Y8AA 1BDDA 2KZIA 1JUNA 2NPSA 1J1DB 4PD4D 2FYUD 3ABVC 1MFZA 3KZIH 4I6MC 5AW3B 1FOSF 3O6QA 2OYHB 3G4SP 3L73J 1QVGO 3OJAB 2N1TA 1YHQP 2XNDH 1KV4A 1HVVA 4XE5B 3MUDC 1KILA 2QJKC 1OVRA 1LTAC 5AVYB 4KX6D 2WSEJ 4U3FG 5DJTB 2D2CB 2UWJE 3L4FA 1MZ9A 2QM7A 3H1JJ 1U7MA 2YXRB 5TISE 2WU2C 1FZFA 1H0TA 1JY2N 3B8EB 2JJLA 4K35A 3L74J 3SFDC 3Q5RA 3PTZA 1KD1Q 1KQLA 3A7OA 3GHGB 4H0LD 1RQUA 2WU2D 2M5AA 2JP3A 3AEAD 2WDVC 1SQPD 2DW3A 3M06A 4YXWH 1P84I 1SQQK 2J58A 1M57D 4Y99C 2IX7C 2B88A 4UB6E 1LWUA 3AE4D 2FYZA 2WSFH 4DCKA 1G1JA 3H1LD 2WSEH 2E74B 3Q1MA 2WDRC 3A2AA 3L71D 1K8AQ 1PPJD 3L71G 3AE4C 4EYYQ 2E76D 1JMMA 3SSUA 1SQVK 2BASA 1KFYC 4YXDD 2HODA 3M9QA 1J1EB 3HE4B 3MIWA 1M8OB 2M3BA 1EZVI 3KZIE 2ZFCA 1YJNP 3IFMA 1YQ4C 2FXOA 2H8PD 2PFXA 1Q90D 3SFEC 1SFCB 4IFMA 3CC7P 2ZXEB 1T2KC 1EQ7A 2IBZG 2J5UA 2N9BA 1PPJE 1AVOA 1FZAA 2BCCG 3FWLA 1HWTC 4GT1A 5KLVD 1G2CB 3H1KJ 1N73B 2RH0A 1CSBA 4DDIA 5KKZB 5AW4B 3VR8C 3L35A 3NTNA 1N7SC 3OAKA 1QL2A 3SFDD 1AA0A 4C7NB 1FAVA 3I55P 3G71P 3GHGA 1E5WA 4YSZC 3Q2YA 4W80A 1NTKG 4H0LC 4WY4B 2C0XA 3L72G 2AEJA 1PGOA 1N7SD 1EZVE 1SLQA 1OW8A 1ZR4A 3AE9D 2N1TB 3L73E 2WPVB 1YI2P 3G6EP 2N1TC 3RK3D 2B76D 5M1BA 1VQ5P 1JY2O 3RK3B 3AEFD 2H88C 4PD4H 5KTBA 3H1KD 5KLVJ 2MKVA 1YJ9P 1GU4A 3L72D 4YTMC 1HGVA 4A7PA 1RF1B 1H88A 3TK1A 2GM4A 1YQ3C 3HD7B 1W5CE 3P4PD 1VQKP 1NU1G 1BE3E 1JY3N 1KQGB 1S2EA 1KB9H 4YXDC 1NEKC 3HRNA 4WBAA 2IFMA 1N7LA 2K9YA 4JQ0D 4DOJA 3FXDA 3RL0C 4RO0A 4ASWA 1M90Q 1LTJA 3VYIA 3W68A 2A06G 2IFNA 3QWOC 1YYCA 1RHZB 3V2NA 2HYNA 1ZRTD 3AE5D 1AJYA 3CXHI 1Q86Q 1KYOH 2KOGA 1FZCB 1L0LK 3WU2E 5C39A 3CX5D 2E5YA 3FXEA 4GODA 4M3LA 5E79H 3OW2O 2ZT9B 1WRGA 2H89D 3C9IA 3RL0g 3RBZA 1RF1A 3H25A 3SWKA 5APSA 2WT7B 1L0VC 3A3YB 3HD7A 1JCDA 5CCGA 3II6A 1Y47A 1E7PC 1J1DC 1SQXK 2PP6A 3KXDA 3CXHH 2AXCA 2R44A 2NPSC 3C8VA 1NU1E 2R5DA 3HUSA 3MHVA 4BRYA 2I1JA 5TJHA 4PD4E 2KYVA 3AECC 1IFJA 1LTJB 1VF5B 4JF7A 4OGQC 3AE7D 1ZOYD 5GTIH 1DEEG 2W83C 2YKOA 2XU6A 5AW5B 1LT9B 4N78E 4D6TD 2B89A 3JC22 3AECD 2MJZA 2KP8A 1RE4A 1KTMA 4OGQD 2FBWC 1SQBK 3ABVD 1JB0J 1KB9E 3L72E 5CBNA 1BSHA 2R3SA 4N3YB 4C46A 2OTJP 1SQPG 4KX6C 4H0LB 1L0NK 4NPFX 1BCCJ 2WWWA 1IJDB 1M1JB 1NHLA 5KJ7D 3U1CA 1BE3D 2KS1B 4DHJA 2C0WA 1QX8A 3RK2B 2Q6QA 3BASA 1FOSE 5AW8B 1ZP0C 4C7NA 1L4AB 1NEND 1EDKA 3M0AA 3VMAA 1PPJG 2O01J 2R32A 1NOHA 2IYPA 1M7LA 5KLVK 4JYCA 2G8YA 2D2CD 2P1JA 2W6JH 1SQVD 2QJYB 2P67A 2JWDA 2K37A 3CXHE 2QJYC 1VPCA 1LT9C 5AVXB 1G2CA 4Z1MH 3AEGC 1SQQD 2Z5HA 2R5BA 2D2CC 2WPSA 3V2QA 1NTMJ 1KN7A 2QRXA 2WDQD 2QSIA 1DH3A 1R8EA 1UIXA 5CJ4A 1MV8A 3CCJP 1Q81Q 4DHZA 5GTIE 2Y0DA 4OH8B 2V4HA 3MD0A 4H44C 1VF5D 2R3CA 1LTIC 1SQPK 4EDFA 2FKWB 1KORA 2W90A 1DIPA 3ZDMA 5KJ7A 1PP9E 2IDBA 3Q5SA 1J2JB 1N2DC 3L75J 4U3FJ 3EQ2A 1CZQA 2WS3D 3V5BA 1YJWP 1HGZA 3HE4A 1OWAA 3D71A 1KFMA 2WSCH 1GZLA 1N86A 2P7JA 4ZKPA 3RGUA 1OW7A 5B66E 1CW5A 1IO4A 1NTMD 4PV1D 1TFFA 3SFED 4RJTA 2O3JA 2FXPA 3E7KA 2QE7H 2WU5C 3P32A 1T6AA 2ZFYA 1EZVD 5AW0B 2NPSB 4KHXA 1AQ5A 4JPZB 4TLFA 1L0NG 1BGYG 1RH5B 3C1LA 3VRBD 1FBMA 3OA7A 2KB7P 1GDTA 3B5NA 1K9MQ 1N8RQ 2WU5D 1IC2A 3VR8D 2QM8A 2PGDA 1Q7YQ 1L0NJ 1DX7A 2H88D 2Y0CA 4IFDK 3VRBC 2HPCA 3L71E 3H1HG 5AVVB 3CCRP 4XA4A 4YTMD 1OXZA 1HH0A 4B86A 1M1JC 4BXLA 1EDLA 1IFMA 2YMKA 2Z5IA 3P8MC 3H1LE 1GW3A 3M0DC 4XFJA 4I2LC 3L71J 1J1EC 2Y9YA 3RK3C 3CC4P 2PAJA 3FWNA 2LR2A 5KAFH 3R4YA 2WVRA 4UB6H 5CBOA 2ZVNB 4ZNCA 2WSFJ 1YBKA 2Z4EA 3D6ZA 1USEA 4IOIH 1NU1D 3H1KG 1KFYD 2KXPB 3BCCE 1KYOI 1GU5A 5C2TC 3IR9A 3CX5E 3H1HD 3UIAA 3VOPA 2YXQB 1SQBG 3AE6C 1S5LE 4IL6E 1CI6A 1SFCC 2POHA 1NKZB 2WDRD 2E75C 4FJVA 1U57A 1VDFA 4L76A 2JO1A 5APXA 5CCHC 5C2TD 1KYOE 3AE1C 4YSXD 1SQBJ 1LTJC 2YNYA 3MUDA 4PV1C 1S9KD 3VR9D 1USDA 1VQNP 2N9YB 2A06E 5L8RJ 2M8RA 2GA1A 1SQXG 5BU8B 3RK2D 4WY4C 1PL5A 3F5HA 3HTKB 3RL0B 3R2PA 3AE8C 4I1LA 1SFCA 1OZHA 1NTME 4D6TE 4HKZH 3MTUE 4WY4A 3L72J 1KC8Q 3H1IJ 1H8AA 1SS1A 2BS4C 1L4AA 1GW4A 3CCQP 3WMM0 1QLBC 1ZXGA 3CX5I 4PJ0H 3VRAD 1X8YA 5CMZA 3KYQA 4TT3H 1AV1A 3A0HE 2BCCD 2KSJA 2E74D 2L91A 3H1KE 2FY8A 2NPSD 2OTKE 3B5NC 1FU1A 3L74G 1PGQA 1FZEA 2AXTH 2LKMA 1JY3O 2K3RA 1VQ9P 2ZT9D 3I5CA 4YSZD 3VONA 1NTZE 2W8ZA 5AVZB 3L70J 2M0BA 1IFPA 1BCCE 3BCCG 2YIUB 1SQVG 4GOFA 3HTKA 4DDGA 1PFIA 1GL2A 2RN0A 2H43A 2CK3H 1KILD 3AEEC 2FYUK 2KLVA 1S72P 1IK7A 1NVOA 1T3UA 3L75E 3P4SC 3L74E 3MZWB 1PP9J 2HFED 3CI9A 3PHLA 3H1JE 1FJKA 4BRYB 3JCUE 2ACZD 1QVFO 3VMYA 2KIKA 1L0LD 4YT0C 1NAYA 2KSEA 1FC2C 4AYCA 1ZN5A 1G1IA 3AE2C 3H1HE 1PV3A 2A45H 4HH2A 3CMEP 2B87A 1NH4A 1LTTC 3VN0A 1YITP 1VQ8P 1LTGC 3CMAP 3M9BA 4YTPC 3V2RA 4H13B 2FFDB 4EOTA 3MP7B 1VF5C 5AVSB 5AVQB 1HJBA 1L0LE 3A0HH 3BRTB 2FFDA 1QGKB 3GLMA 4HB1A 1JO5A 4QMAA 1RF0A 2KNCA 5APQA 2CPBA 3GHGC 3VMXA 1JM0A 2E74C 2FXMA 4H44B 3CL3D 3H6PA 1DD4A 4WB4A 3KHUA 1KILE 2Y9ZA 3V2PA 3BVHA 3P8CD 3NMDA 5CCGD 1SQPJ 1BCCG 1D7MA 2HR3A 2KI7B 1GL2B 1LWUB 2XNXA 3HE5B 1VQ7P 1H89A 1KILC 1SQBD 3P4RD 1HUCA 5KKZC 4HJGH 4H13C 5BVZA 1JY3P 3L74D 2WZ7A 1Z56A 4BWNA 1KF6D 1JCCA 4JYBA 4LC1A 1LTBC 3A0BH 3M9HA 2OTLP 3CWBG 1LGHB 4YT0D 1L0LG 3H1ID 3V6IA 3P7KA 1NU1J 5C3JC 3CWBJ 1GMJA 1SQQE 1L0NE 1ZV8A 2WSSH 4OVNF 1IK9A 2QVAA 3L36A 2WQYD 2PRRA 3AEFC 1SQQJ 1VQ4P 3AEAC 1BE3G 5APUA 2A45G 2OYOA 1KMIZ 3VTPC 2Q5UA 1T8ZA 2FYNC 2IPPA 3T97B 3VP9A 3SWYA 1SQVE 2NZ2A 2QJPB 4EI2A 5KAFE 4OWFA 5AVUB 1AQTA 3D70A 2A06D 3L75G 3L73G 3GMAA 2M3EA 2OQQA 1EZVG 3HUSC 3KDPB 4U3FD 5GTHE 2ZYAA 1N7SA 3TNUB 3B4SA 3PRJA 4ZKUA 4Y28J 1S3JA 2AXTE 1YQ3D 2IZ0A 3TGUJ 3NXSA 2ITAA 3P4PC 2K1AA 5AW7B 1NTKK 1PGJA 2AEMA 2P2UA 3L70E 3IN6A 1S5LX 1NTZJ 4IL6X 1QL1A 4GDOA 1YQ4D 1SQXD 3E1IA 3TGUG 2O01N 2V7QH 3WUUA 2JR8A 4N78D 1DD3A 2YMYA 3V4WA 3RL0D 1T2KD 4LLHA 3AE8D 1KB9D 1KZUB 1GK6A 3CPWO 3H1HJ 2OGUA 3F89A 5CHXA 3AE1D 2KS1A 4O9BA 3EWKA 2WS3C 3KQGA 4LDTA 3P4QC 1JTHA 2QIWA 4YSYC 3HD7D 3L75D 3CIRC 3L70D 3H1JD 1E79H 5AW2B 4RESB 2A45I 1P84D 2YKPA 2H89C 2WPRA 3AEBD 1N7SB 2OYIA 1DEBA 4PJ0E 2WQYC 1K73Q 1NGMB 2ZJSE 1ZMEC 3GF3A 3Q5PA 5H2FH 1Q82Q 3TGUE 5CCHA 3A5TA 1LNQA 1KILB 3FGAD 4L74A 1RF1C 2VRSA 2WTYA 5AVTB 5AW6B 3S1KA 4UB8E 2RMZA 2QA4P 3PH0A 1LT9A 3AE3C 3CXHD 2JWAA 1HBWA 2Q3EA 1EXJA 2Q1KA 3I56P 3B5ND 1OVUA 3AE3D 3CC2P 2Y0EA 1NU1K 3M91A 1HTLC 1VQOP 2IBZD 3VP8A 2NRGA 1FZCA 1FZBA 4DJGA 5EFWB 3TF5A 4U7JA 1ZLLA 3AEDC 3CCSP 1RE3A 1MUUA 3G3ZA 3U59A 4W7ZA 2JDIH 1PIXA 1SVFA 3AE2D 3TYYA 1SFCD 2XZRA 3EFFK 3H1IG 3CX5H 1OIPA 1R5LA 4YSXC 2BEZF 1FDIA 4IL6H 2QJPC 1S5LH 4YTNC 2ACZC 1FS0E 3RK3E 2E43A 1W2BO 3G9RA 1NEKD 1OX3A 1SQXE 4AQRD 1JY2P 1X0TA 2FYNB 4EIJA 1BGYE 5KLIC 2B87B 5KLVG 2O1JA 2HLOA 4D6TJ 2FFDC 1L0VD 5CCHD 1RE4C 4MN4C 3H1JG 3LW5J 4GOEA 2QEXP 2WSCJ 3N4XA 2O01H 3NFQA 4KJMA 1P84E 3BCCJ 1YTZI 2KUBA 2E76C 2WT7A 2W6AA 1WMKA 4UB8H 5APYA 1X22A 4IFFA 2AEFA 1SQBE 3GF7A 1NAFA 1AVYA 1FDOA 1L2PA 2WDQC 1NWQA 1GD2E 1BCCD 2XV5A 1NTMK 1PP9G 1W2EA 1BGYD 1URQA 3L70G 3FX0A 1LJ2A 4DT0A 1SQVJ 1JNMA 3BATA 2OYHC 2YIUC 1HF9A 2SPZA 1EXIA 1H0TB 3PJSK 3CWBD 4NPEA 5AW1B 1SP4A 5GTHH
chains in the Genus database with same CATH topology
1U57A 2WU5C 1YQ3C 2E74C 2QJYC 4H44B 3AEGD 2QJKC 2BEZF 1FDIA 1YQ4C 2FYNC 2QJPC 2JO1A 3AECC 2WP9D 3P4PD 3VRAC 4YTNC 5C2TD 2E75D 2ACZC 3T97B 4YSXC 4KX6D 3AE1C 2WSEJ 4Z1MH 1Q90D 1VF5B 1DD4A 2D2CB 3AEGC 4OGQC 1RQVA 3AEEC 3RK3E 3SFEC 2WDVD 4YSXD 3AE7D 3S9OA 3G9RA 2H89C 2D2CC 1NEKD 1ZOYD 1KQGB 1KILE 3AEDD 3VR9C 3AEBD 1IK7A 2WU2C 2NZ2A 4PV1C 3P4SC 3AEED 3VRBD 2WDQD 2QSIA 3AE7C 2WQYC 4PV1B 4YXDC 3D6YA 1NEKC 2J5UA 3Q5RA 3SFDC 1R8EA 1NGMB 2WU5D 5C3JD 1Y9BA 3VR9D 1UIXA 1ZMEC 3GF3A 2WP9C 2E76B 2G3AA 3Q5PA 3AECD 5KLIC 3VR8D 5L8RJ 2ACZD 3P4QD 1VL2A 2K9YA 4H13D 3D70A 1KTMA 3Q3DA 2BS2C 2H88D 4OGQD 2FBWC 4H44C 3ABVD 1VF5D 1JB0J 1PL5A 2B76C 3FGAD 4H0LD 2ZT9C 1RQUA 3AE8C 3GMAA 2OQQA 1L0VD 2WU2D 4YT0C 2BEQD 3VRBC 4H44D 2JP3A 3AEAD 4I7ZB 1KORA 3LW5J 2V7QJ 4YTMD 2WSCJ 1DIPA 2WDVC 3P4RD 3AE5D 3VR8C 5KKZC 3AE2C 1AJYA 4Y28J 4H13C 3AE3C 1PV3A 4KT0J 1YQ3D 1KF6C 1NENC 2FBWD 2E76C 3P4PC 1NYHA 2YMKA 2IDBA 3Q5SA 4KX6C 4H0LB 3SFDD 1WMKA 4XFJA 1KF6D 2BS4C 1MKMA 1EXJA 1ZRTE 3IN6A 4YTPC 1S1CX 3GF7A 4H13B 1KQFB 4YSZC 1FDOA 1S5LX 4IL6X 1QLBC 3AE4D 4GDOA 2WDQC 1K04A 3B71A 1YQ4D 3Q2YA 2WS3D 3VRAD 4I7ZC 4H0LC 4YT0D 3AE3D 3R4YA 2P10A 4TT3H 3Q1MA 2E74B 2BS3C 1DD3A 2ZT9B 1ZOYC 2H89D 2WDRC 1OW8A 3AE9D 3RL0g 1K05A 2E74D 3D71A 1ZP0D 3P4SD 2WSFJ 3P4RC 1VF5C 2WPVB 3H25A 4OGQB 2B76D 4RKUJ 5C3JC 1GMJA 4R4MA 5M1BA 1ZP0C 3D6ZA 1TU3F 1L0VC 3AE8D 3AE4C 1NEND 1OW7A 4YSYD 2E76D 4U7JA 1KFYD 3AEDC 3CIRD 3AEFD 2O01J 4PV1D 3GLMA 2H88C 1E7PC 3ABVC 1PIXA 4R4LA 1KFYC 4YTND 5C2TC 2WQYD 1HJ0A 3AE2D 4YXDD 2MKVA 2YIUC 3AEFC 2ZT9D 1HF9A 3AE1D 3AE9C 3O6QA 4YSZD 3SFED 1EXIA 3AE6D 3EWKA 2G8YA 3IAOA 3AEAC 2WS3C 2D2CD 3P4QC 2FXPA 1OMIA 3C8VA 3AEBC 2QIWA 2E75B 3AE6C 4YTMC 4YSYC 1KMIZ 3AE5C 2WDRD 3CIRC 2E75C 1OW6A 4YTPD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WU5 C;  1YQ3 C;  3AEG D;  4YSX C;  2WP9 D;  1YQ4 C;  3AEC C;  3P4P D;  3VRA C;  4YTN C;  5C2T D;  2ACZ C;  4KX6 D;  3AE1 C;  3SFE C;  3AEG C;  4YSX D;  3AEE C;  2WDV D;  3AE7 D;  3S9O A;  3AED D;  2H89 C;  1ZOY D;  1NEK D;  3VR9 C;  3AEB D;  2WU2 C;  3P4S C;  3AEE D;  3VRB D;  2WDQ D;  3AE7 C;  2WQY C;  4YXD C;  1NEK C;  3VR9 D;  3SFD C;  5C3J D;  2WU5 D;  2WP9 C;  2G3A A;  3AEC D;  3VR8 D;  2ACZ D;  3P4Q D;  1KTM A;  2BS2 C;  2H88 D;  2FBW C;  3ABV D;  2B76 C;  4YT0 C;  3AE8 C;  1L0V D;  2WU2 D;  3VRB C;  3AEA D;  4YTM D;  2WDV C;  3P4R D;  3AE5 D;  3VR8 C;  3AE2 C;  3AE3 C;  1PV3 A;  1YQ3 D;  1KF6 C;  1NEN C;  2FBW D;  3P4P C;  4KX6 C;  3SFD D;  1KF6 D;  2BS4 C;  4YTP C;  4YSZ C;  1QLB C;  3AE4 D;  2WDQ C;  1K04 A;  3B71 A;  1YQ4 D;  2WS3 D;  3VRA D;  4YT0 D;  3AE3 D;  2BS3 C;  2WDR C;  1ZOY C;  2H89 D;  1OW8 A;  3AE9 D;  1ZP0 D;  1K05 A;  3P4S D;  3P4R C;  2B76 D;  5C3J C;  1L0V C;  3AE8 D;  1ZP0 C;  3AE4 C;  1NEN D;  1OW7 A;  4YSY D;  1KFY D;  3AED C;  3CIR D;  3AEF D;  2H88 C;  1E7P C;  3ABV C;  1KFY C;  4YTN D;  5C2T C;  2WQY D;  3AE2 D;  4YXD D;  3AEF C;  3AE1 D;  3AE9 C;  4YSZ D;  3SFE D;  3AE6 D;  3AEA C;  2WS3 C;  3P4Q C;  3AEB C;  3AE6 C;  4YTM C;  4YSY C;  3AE5 C;  2WDR D;  3CIR C;  1OW6 A;  4YTP D; 
#chains in the Genus database with same CATH topology
 1X9V A;  5BU5 A;  2WMM A;  1S4X A;  1GL2 C;  3S9O A;  3TDK A;  3AED D;  3CCE P;  1VQ6 P;  2K9J A;  5KLV E;  1NTZ K;  4ZMD A;  5APW A;  5C3J D;  2KK7 A;  2G3A A;  2LXB A;  4H13 D;  2RKL A;  3JSV C;  3BCC D;  3JCU H;  2E5T A;  2WPQ A;  1FJP A;  2YKQ A;  1LWU C;  4I7Z B;  4L75 A;  2W6B A;  3TSI A;  1URQ B;  2O1K A;  4KT0 J;  4I6L A;  2BCC J;  2Q3I A;  1KYO D;  3K5B A;  2E42 A;  5K5G B;  2M5A B;  1YTZ T;  2WIT A;  2HPC B;  2ZYD A;  5B5E H;  4I7Z C;  1S9K E;  2P10 A;  1M56 D;  1YIJ P;  1N73 C;  4PD4 I;  2GUV A;  1ZP0 D;  3CCM P;  4U3F E;  1R5S A;  3L73 D;  2GUS A;  1NTK J;  2K9J B;  2CPS A;  3WUV A;  2OYI B;  1SQX J;  1OMI A;  3WUT A;  1KFN A;  3AEG D;  2WP9 D;  2W27 A;  2Q9I A;  2E75 D;  4AUW A;  2K88 A;  1N73 A;  1L0L J;  2OYI C;  1A02 J;  1NKN A;  2KNC B;  4PV1 B;  1VQL P;  3D6Y A;  1Y9B A;  2WP9 C;  4L73 A;  1IFD A;  1U7J A;  1FE6 A;  1VL2 A;  2BS2 C;  1FZG A;  2KZJ A;  1EDJ A;  1IZN B;  5AVR B;  5AVW B;  4NPD A;  5APV A;  1JOC A;  3EFG A;  3V4Q A;  2IZ1 A;  2JEE A;  1VQM P;  2H7H A;  1KF6 C;  3WU2 H;  4HYT B;  1NYH A;  4Y99 B;  3GG2 A;  4W7Y A;  1NTM G;  1PGP A;  1NO4 A;  4JBZ A;  1MKM A;  2ZVO B;  5E79 E;  1L4A D;  3U1A A;  1K04 A;  3W67 A;  2I1K A;  3M0D A;  3CCU P;  3H1I E;  2HOD B;  3O6Q B;  2OYH A;  3A0B E;  1SQQ G;  1JTH B;  3CCV P;  3S4R A;  3HUS B;  1JEK A;  3VMZ A;  4WY4 D;  3P4R C;  3GW6 A;  3E1R A;  2LXC B;  3O8Z A;  4YSY D;  3CIR D;  3T97 A;  1M1J A;  2B9B A;  2YO2 A;  5DJU B;  4R4L A;  1Q2N A;  1X79 B;  3PP5 A;  2IBZ I;  4DZO A;  3LIE A;  4WVZ A;  3AE9 C;  5KAI E;  2I8D A;  1KQS O;  3SWF A;  3AEB C;  1ZW0 A;  1LP1 B;  2XDJ A;  3VRA C;  3USS A;  1NTZ G;  1RY3 A;  1JMB A;  1P84 H;  2IBZ E;  1XTG B;  1RQV A;  2ZAE B;  5APT A;  3AEE D;  3AE7 C;  1OVV A;  4WWI A;  2ZYG A;  1M1K Q;  3RBX A;  3H1L J;  2P58 A;  3ITK A;  1LTS C;  5KJ7 C;  4C7R A;  3N7N A;  2N1T D;  2B76 C;  1BSN A;  1RF0 C;  2ZT9 C;  4GIF A;  1NTK D;  2L5G B;  4CPG A;  2HG5 D;  3H1L G;  1ZR2 A;  1FDM A;  1QEX A;  2KLU A;  3L37 A;  3BRV B;  2YO3 A;  2OAR A;  2C9L Y;  1WT6 A;  1NEN C;  1PZQ A;  1GK4 A;  1BGY J;  2FYU G;  1NJI Q;  4DHI B;  1IFI A;  1S1C X;  3B71 A;  3HE5 A;  1BDC A;  3TNU A;  4YPC A;  2FYU J;  2BS3 C;  3LID A;  3P8C E;  4OGQ B;  3H32 B;  4RKU J;  4R4M A;  1QLE D;  1TU3 F;  4N6J A;  1NTK E;  3RK2 C;  4YTN D;  1HJ0 A;  2C9N Y;  3AE6 D;  1L4A C;  3TGU D;  3IAO A;  2ZXX A;  5AW9 B;  2E75 B;  3CLQ A;  3AE5 C;  1OW6 A;  3H32 A;  4YTP D;  5KAI H;  5TIS H;  3IF4 A;  1OFC X;  1SQP E;  1EC5 A;  1VQP P;  2WDV D;  1UII A;  3VR9 C;  2IYO A;  1A02 F;  2QJK B;  3MGN A;  2BCC E;  3LW5 H;  1URQ C;  2JKV A;  2E76 B;  4K3A A;  1XTC C;  5B5E E;  3P4Q D;  2Q7C A;  5KLI B;  3Q3D A;  1LT1 A;  3CWB E;  1MFT A;  3HD7 C;  5H2F E;  3CD6 P;  4LGD E;  1PP9 D;  2BEQ D;  4H44 D;  2FYU E;  1NTZ D;  1KB9 I;  1URQ D;  1EDI A;  2V7Q J;  3B5N B;  1L0N D;  1AFO A;  3CCL P;  3PLN A;  2FBW D;  2J59 M;  2QG4 A;  2XKM A;  1GL2 D;  1T3J A;  1ZRT E;  1BE3 J;  3KPE A;  1KQF B;  1IFN A;  4GKG A;  4ASV A;  1ZOY C;  1RE3 C;  5CCG C;  5CJ0 A;  1K05 A;  3P4S D;  1GTW A;  1CI6 B;  3QH9 A;  5B66 H;  1LP1 A;  1FZC C;  4D6T G;  1Y8A A;  1BDD A;  2KZI A;  1JUN A;  2NPS A;  1J1D B;  4PD4 D;  2FYU D;  3ABV C;  1MFZ A;  3KZI H;  4I6M C;  5AW3 B;  1FOS F;  3O6Q A;  2OYH B;  3G4S P;  3L73 J;  1QVG O;  3OJA B;  2N1T A;  1YHQ P;  2XND H;  1KV4 A;  1HVV A;  4XE5 B;  3MUD C;  1KIL A;  2QJK C;  1OVR A;  1LTA C;  5AVY B;  4KX6 D;  2WSE J;  4U3F G;  5DJT B;  2D2C B;  2UWJ E;  3L4F A;  1MZ9 A;  2QM7 A;  3H1J J;  1U7M A;  2YXR B;  5TIS E;  2WU2 C;  1FZF A;  1H0T A;  1JY2 N;  3B8E B;  2JJL A;  4K35 A;  3L74 J;  3SFD C;  3Q5R A;  3PTZ A;  1KD1 Q;  1KQL A;  3A7O A;  3GHG B;  4H0L D;  1RQU A;  2WU2 D;  2M5A A;  2JP3 A;  3AEA D;  2WDV C;  1SQP D;  2DW3 A;  3M06 A;  4YXW H;  1P84 I;  1SQQ K;  2J58 A;  1M57 D;  4Y99 C;  2IX7 C;  2B88 A;  4UB6 E;  1LWU A;  3AE4 D;  2FYZ A;  2WSF H;  4DCK A;  1G1J A;  3H1L D;  2WSE H;  2E74 B;  3Q1M A;  2WDR C;  3A2A A;  3L71 D;  1K8A Q;  1PPJ D;  3L71 G;  3AE4 C;  4EYY Q;  2E76 D;  1JMM A;  3SSU A;  1SQV K;  2BAS A;  1KFY C;  4YXD D;  2HOD A;  3M9Q A;  1J1E B;  3HE4 B;  3MIW A;  1M8O B;  2M3B A;  1EZV I;  3KZI E;  2ZFC A;  1YJN P;  3IFM A;  1YQ4 C;  2FXO A;  2H8P D;  2PFX A;  1Q90 D;  3SFE C;  1SFC B;  4IFM A;  3CC7 P;  2ZXE B;  1T2K C;  1EQ7 A;  2IBZ G;  2J5U A;  2N9B A;  1PPJ E;  1AVO A;  1FZA A;  2BCC G;  3FWL A;  1HWT C;  4GT1 A;  5KLV D;  1G2C B;  3H1K J;  1N73 B;  2RH0 A;  1CSB A;  4DDI A;  5KKZ B;  5AW4 B;  3VR8 C;  3L35 A;  3NTN A;  1N7S C;  3OAK A;  1QL2 A;  3SFD D;  1AA0 A;  4C7N B;  1FAV A;  3I55 P;  3G71 P;  3GHG A;  1E5W A;  4YSZ C;  3Q2Y A;  4W80 A;  1NTK G;  4H0L C;  4WY4 B;  2C0X A;  3L72 G;  2AEJ A;  1PGO A;  1N7S D;  1EZV E;  1SLQ A;  1OW8 A;  1ZR4 A;  3AE9 D;  2N1T B;  3L73 E;  2WPV B;  1YI2 P;  3G6E P;  2N1T C;  3RK3 D;  2B76 D;  5M1B A;  1VQ5 P;  1JY2 O;  3RK3 B;  3AEF D;  2H88 C;  4PD4 H;  5KTB A;  3H1K D;  5KLV J;  2MKV A;  1YJ9 P;  1GU4 A;  3L72 D;  4YTM C;  1HGV A;  4A7P A;  1RF1 B;  1H88 A;  3TK1 A;  2GM4 A;  1YQ3 C;  3HD7 B;  1W5C E;  3P4P D;  1VQK P;  1NU1 G;  1BE3 E;  1JY3 N;  1KQG B;  1S2E A;  1KB9 H;  4YXD C;  1NEK C;  3HRN A;  4WBA A;  2IFM A;  1N7L A;  2K9Y A;  4JQ0 D;  4DOJ A;  3FXD A;  3RL0 C;  4RO0 A;  4ASW A;  1M90 Q;  1LTJ A;  3VYI A;  3W68 A;  2A06 G;  2IFN A;  3QWO C;  1YYC A;  1RHZ B;  3V2N A;  2HYN A;  1ZRT D;  3AE5 D;  1AJY A;  3CXH I;  1Q86 Q;  1KYO H;  2KOG A;  1FZC B;  1L0L K;  3WU2 E;  5C39 A;  3CX5 D;  2E5Y A;  3FXE A;  4GOD A;  4M3L A;  5E79 H;  3OW2 O;  2ZT9 B;  1WRG A;  2H89 D;  3C9I A;  3RL0 g;  3RBZ A;  1RF1 A;  3H25 A;  3SWK A;  5APS A;  2WT7 B;  1L0V C;  3A3Y B;  3HD7 A;  1JCD A;  5CCG A;  3II6 A;  1Y47 A;  1E7P C;  1J1D C;  1SQX K;  2PP6 A;  3KXD A;  3CXH H;  2AXC A;  2R44 A;  2NPS C;  3C8V A;  1NU1 E;  2R5D A;  3HUS A;  3MHV A;  4BRY A;  2I1J A;  5TJH A;  4PD4 E;  2KYV A;  3AEC C;  1IFJ A;  1LTJ B;  1VF5 B;  4JF7 A;  4OGQ C;  3AE7 D;  1ZOY D;  5GTI H;  1DEE G;  2W83 C;  2YKO A;  2XU6 A;  5AW5 B;  1LT9 B;  4N78 E;  4D6T D;  2B89 A;  3JC2 2;  3AEC D;  2MJZ A;  2KP8 A;  1RE4 A;  1KTM A;  4OGQ D;  2FBW C;  1SQB K;  3ABV D;  1JB0 J;  1KB9 E;  3L72 E;  5CBN A;  1BSH A;  2R3S A;  4N3Y B;  4C46 A;  2OTJ P;  1SQP G;  4KX6 C;  4H0L B;  1L0N K;  4NPF X;  1BCC J;  2WWW A;  1IJD B;  1M1J B;  1NHL A;  5KJ7 D;  3U1C A;  1BE3 D;  2KS1 B;  4DHJ A;  2C0W A;  1QX8 A;  3RK2 B;  2Q6Q A;  3BAS A;  1FOS E;  5AW8 B;  1ZP0 C;  4C7N A;  1L4A B;  1NEN D;  1EDK A;  3M0A A;  3VMA A;  1PPJ G;  2O01 J;  2R32 A;  1NOH A;  2IYP A;  1M7L A;  5KLV K;  4JYC A;  2G8Y A;  2D2C D;  2P1J A;  2W6J H;  1SQV D;  2QJY B;  2P67 A;  2JWD A;  2K37 A;  3CXH E;  2QJY C;  1VPC A;  1LT9 C;  5AVX B;  1G2C A;  4Z1M H;  3AEG C;  1SQQ D;  2Z5H A;  2R5B A;  2D2C C;  2WPS A;  3V2Q A;  1NTM J;  1KN7 A;  2QRX A;  2WDQ D;  2QSI A;  1DH3 A;  1R8E A;  1UIX A;  5CJ4 A;  1MV8 A;  3CCJ P;  1Q81 Q;  4DHZ A;  5GTI E;  2Y0D A;  4OH8 B;  2V4H A;  3MD0 A;  4H44 C;  1VF5 D;  2R3C A;  1LTI C;  1SQP K;  4EDF A;  2FKW B;  1KOR A;  2W90 A;  1DIP A;  3ZDM A;  5KJ7 A;  1PP9 E;  2IDB A;  3Q5S A;  1J2J B;  1N2D C;  3L75 J;  4U3F J;  3EQ2 A;  1CZQ A;  2WS3 D;  3V5B A;  1YJW P;  1HGZ A;  3HE4 A;  1OWA A;  3D71 A;  1KFM A;  2WSC H;  1GZL A;  1N86 A;  2P7J A;  4ZKP A;  3RGU A;  1OW7 A;  5B66 E;  1CW5 A;  1IO4 A;  1NTM D;  4PV1 D;  1TFF A;  3SFE D;  4RJT A;  2O3J A;  2FXP A;  3E7K A;  2QE7 H;  2WU5 C;  3P32 A;  1T6A A;  2ZFY A;  1EZV D;  5AW0 B;  2NPS B;  4KHX A;  1AQ5 A;  4JPZ B;  4TLF A;  1L0N G;  1BGY G;  1RH5 B;  3C1L A;  3VRB D;  1FBM A;  3OA7 A;  2KB7 P;  1GDT A;  3B5N A;  1K9M Q;  1N8R Q;  2WU5 D;  1IC2 A;  3VR8 D;  2QM8 A;  2PGD A;  1Q7Y Q;  1L0N J;  1DX7 A;  2H88 D;  2Y0C A;  4IFD K;  3VRB C;  2HPC A;  3L71 E;  3H1H G;  5AVV B;  3CCR P;  4XA4 A;  4YTM D;  1OXZ A;  1HH0 A;  4B86 A;  1M1J C;  4BXL A;  1EDL A;  1IFM A;  2YMK A;  2Z5I A;  3P8M C;  3H1L E;  1GW3 A;  3M0D C;  4XFJ A;  4I2L C;  3L71 J;  1J1E C;  2Y9Y A;  3RK3 C;  3CC4 P;  2PAJ A;  3FWN A;  2LR2 A;  5KAF H;  3R4Y A;  2WVR A;  4UB6 H;  5CBO A;  2ZVN B;  4ZNC A;  2WSF J;  1YBK A;  2Z4E A;  3D6Z A;  1USE A;  4IOI H;  1NU1 D;  3H1K G;  1KFY D;  2KXP B;  3BCC E;  1KYO I;  1GU5 A;  5C2T C;  3IR9 A;  3CX5 E;  3H1H D;  3UIA A;  3VOP A;  2YXQ B;  1SQB G;  3AE6 C;  1S5L E;  4IL6 E;  1CI6 A;  1SFC C;  2POH A;  1NKZ B;  2WDR D;  2E75 C;  4FJV A;  1U57 A;  1VDF A;  4L76 A;  2JO1 A;  5APX A;  5CCH C;  5C2T D;  1KYO E;  3AE1 C;  4YSX D;  1SQB J;  1LTJ C;  2YNY A;  3MUD A;  4PV1 C;  1S9K D;  3VR9 D;  1USD A;  1VQN P;  2N9Y B;  2A06 E;  5L8R J;  2M8R A;  2GA1 A;  1SQX G;  5BU8 B;  3RK2 D;  4WY4 C;  1PL5 A;  3F5H A;  3HTK B;  3RL0 B;  3R2P A;  3AE8 C;  4I1L A;  1SFC A;  1OZH A;  1NTM E;  4D6T E;  4HKZ H;  3MTU E;  4WY4 A;  3L72 J;  1KC8 Q;  3H1I J;  1H8A A;  1SS1 A;  2BS4 C;  1L4A A;  1GW4 A;  3CCQ P;  3WMM 0;  1QLB C;  1ZXG A;  3CX5 I;  4PJ0 H;  3VRA D;  1X8Y A;  5CMZ A;  3KYQ A;  4TT3 H;  1AV1 A;  3A0H E;  2BCC D;  2KSJ A;  2E74 D;  2L91 A;  3H1K E;  2FY8 A;  2NPS D;  2OTK E;  3B5N C;  1FU1 A;  3L74 G;  1PGQ A;  1FZE A;  2AXT H;  2LKM A;  1JY3 O;  2K3R A;  1VQ9 P;  2ZT9 D;  3I5C A;  4YSZ D;  3VON A;  1NTZ E;  2W8Z A;  5AVZ B;  3L70 J;  2M0B A;  1IFP A;  1BCC E;  3BCC G;  2YIU B;  1SQV G;  4GOF A;  3HTK A;  4DDG A;  1PFI A;  1GL2 A;  2RN0 A;  2H43 A;  2CK3 H;  1KIL D;  3AEE C;  2FYU K;  2KLV A;  1S72 P;  1IK7 A;  1NVO A;  1T3U A;  3L75 E;  3P4S C;  3L74 E;  3MZW B;  1PP9 J;  2HFE D;  3CI9 A;  3PHL A;  3H1J E;  1FJK A;  4BRY B;  3JCU E;  2ACZ D;  1QVF O;  3VMY A;  2KIK A;  1L0L D;  4YT0 C;  1NAY A;  2KSE A;  1FC2 C;  4AYC A;  1ZN5 A;  1G1I A;  3AE2 C;  3H1H E;  1PV3 A;  2A45 H;  4HH2 A;  3CME P;  2B87 A;  1NH4 A;  1LTT C;  3VN0 A;  1YIT P;  1VQ8 P;  1LTG C;  3CMA P;  3M9B A;  4YTP C;  3V2R A;  4H13 B;  2FFD B;  4EOT A;  3MP7 B;  1VF5 C;  5AVS B;  5AVQ B;  1HJB A;  1L0L E;  3A0H H;  3BRT B;  2FFD A;  1QGK B;  3GLM A;  4HB1 A;  1JO5 A;  4QMA A;  1RF0 A;  2KNC A;  5APQ A;  2CPB A;  3GHG C;  3VMX A;  1JM0 A;  2E74 C;  2FXM A;  4H44 B;  3CL3 D;  3H6P A;  1DD4 A;  4WB4 A;  3KHU A;  1KIL E;  2Y9Z A;  3V2P A;  3BVH A;  3P8C D;  3NMD A;  5CCG D;  1SQP J;  1BCC G;  1D7M A;  2HR3 A;  2KI7 B;  1GL2 B;  1LWU B;  2XNX A;  3HE5 B;  1VQ7 P;  1H89 A;  1KIL C;  1SQB D;  3P4R D;  1HUC A;  5KKZ C;  4HJG H;  4H13 C;  5BVZ A;  1JY3 P;  3L74 D;  2WZ7 A;  1Z56 A;  4BWN A;  1KF6 D;  1JCC A;  4JYB A;  4LC1 A;  1LTB C;  3A0B H;  3M9H A;  2OTL P;  3CWB G;  1LGH B;  4YT0 D;  1L0L G;  3H1I D;  3V6I A;  3P7K A;  1NU1 J;  5C3J C;  3CWB J;  1GMJ A;  1SQQ E;  1L0N E;  1ZV8 A;  2WSS H;  4OVN F;  1IK9 A;  2QVA A;  3L36 A;  2WQY D;  2PRR A;  3AEF C;  1SQQ J;  1VQ4 P;  3AEA C;  1BE3 G;  5APU A;  2A45 G;  2OYO A;  1KMI Z;  3VTP C;  2Q5U A;  1T8Z A;  2FYN C;  2IPP A;  3T97 B;  3VP9 A;  3SWY A;  1SQV E;  2NZ2 A;  2QJP B;  4EI2 A;  5KAF E;  4OWF A;  5AVU B;  1AQT A;  3D70 A;  2A06 D;  3L75 G;  3L73 G;  3GMA A;  2M3E A;  2OQQ A;  1EZV G;  3HUS C;  3KDP B;  4U3F D;  5GTH E;  2ZYA A;  1N7S A;  3TNU B;  3B4S A;  3PRJ A;  4ZKU A;  4Y28 J;  1S3J A;  2AXT E;  1YQ3 D;  2IZ0 A;  3TGU J;  3NXS A;  2ITA A;  3P4P C;  2K1A A;  5AW7 B;  1NTK K;  1PGJ A;  2AEM A;  2P2U A;  3L70 E;  3IN6 A;  1S5L X;  1NTZ J;  4IL6 X;  1QL1 A;  4GDO A;  1YQ4 D;  1SQX D;  3E1I A;  3TGU G;  2O01 N;  2V7Q H;  3WUU A;  2JR8 A;  4N78 D;  1DD3 A;  2YMY A;  3V4W A;  3RL0 D;  1T2K D;  4LLH A;  3AE8 D;  1KB9 D;  1KZU B;  1GK6 A;  3CPW O;  3H1H J;  2OGU A;  3F89 A;  5CHX A;  3AE1 D;  2KS1 A;  4O9B A;  3EWK A;  2WS3 C;  3KQG A;  4LDT A;  3P4Q C;  1JTH A;  2QIW A;  4YSY C;  3HD7 D;  3L75 D;  3CIR C;  3L70 D;  3H1J D;  1E79 H;  5AW2 B;  4RES B;  2A45 I;  1P84 D;  2YKP A;  2H89 C;  2WPR A;  3AEB D;  1N7S B;  2OYI A;  1DEB A;  4PJ0 E;  2WQY C;  1K73 Q;  1NGM B;  2ZJS E;  1ZME C;  3GF3 A;  3Q5P A;  5H2F H;  1Q82 Q;  3TGU E;  5CCH A;  3A5T A;  1LNQ A;  1KIL B;  3FGA D;  4L74 A;  1RF1 C;  2VRS A;  2WTY A;  5AVT B;  5AW6 B;  3S1K A;  4UB8 E;  2RMZ A;  2QA4 P;  3PH0 A;  1LT9 A;  3AE3 C;  3CXH D;  2JWA A;  1HBW A;  2Q3E A;  1EXJ A;  2Q1K A;  3I56 P;  3B5N D;  1OVU A;  3AE3 D;  3CC2 P;  2Y0E A;  1NU1 K;  3M91 A;  1HTL C;  1VQO P;  2IBZ D;  3VP8 A;  2NRG A;  1FZC A;  1FZB A;  4DJG A;  5EFW B;  3TF5 A;  4U7J A;  1ZLL A;  3AED C;  3CCS P;  1RE3 A;  1MUU A;  3G3Z A;  3U59 A;  4W7Z A;  2JDI H;  1PIX A;  1SVF A;  3AE2 D;  3TYY A;  1SFC D;  2XZR A;  3EFF K;  3H1I G;  3CX5 H;  1OIP A;  1R5L A;  4YSX C;  2BEZ F;  1FDI A;  4IL6 H;  2QJP C;  1S5L H;  4YTN C;  2ACZ C;  1FS0 E;  3RK3 E;  2E43 A;  1W2B O;  3G9R A;  1NEK D;  1OX3 A;  1SQX E;  4AQR D;  1JY2 P;  1X0T A;  2FYN B;  4EIJ A;  1BGY E;  5KLI C;  2B87 B;  5KLV G;  2O1J A;  2HLO A;  4D6T J;  2FFD C;  1L0V D;  5CCH D;  1RE4 C;  4MN4 C;  3H1J G;  3LW5 J;  4GOE A;  2QEX P;  2WSC J;  3N4X A;  2O01 H;  3NFQ A;  4KJM A;  1P84 E;  3BCC J;  1YTZ I;  2KUB A;  2E76 C;  2WT7 A;  2W6A A;  1WMK A;  4UB8 H;  5APY A;  1X22 A;  4IFF A;  2AEF A;  1SQB E;  3GF7 A;  1NAF A;  1AVY A;  1FDO A;  1L2P A;  2WDQ C;  1NWQ A;  1GD2 E;  1BCC D;  2XV5 A;  1NTM K;  1PP9 G;  1W2E A;  1BGY D;  1URQ A;  3L70 G;  3FX0 A;  1LJ2 A;  4DT0 A;  1SQV J;  1JNM A;  3BAT A;  2OYH C;  2YIU C;  1HF9 A;  2SPZ A;  1EXI A;  1H0T B;  3PJS K;  3CWB D;  4NPE A;  5AW1 B;  1SP4 A;  5GTH H; 
#chains in the Genus database with same CATH homology
 1U57 A;  2WU5 C;  1YQ3 C;  2E74 C;  2QJY C;  4H44 B;  3AEG D;  2QJK C;  2BEZ F;  1FDI A;  1YQ4 C;  2FYN C;  2QJP C;  2JO1 A;  3AEC C;  2WP9 D;  3P4P D;  3VRA C;  4YTN C;  5C2T D;  2E75 D;  2ACZ C;  3T97 B;  4YSX C;  4KX6 D;  3AE1 C;  2WSE J;  4Z1M H;  1Q90 D;  1VF5 B;  1DD4 A;  2D2C B;  3AEG C;  4OGQ C;  1RQV A;  3AEE C;  3RK3 E;  3SFE C;  2WDV D;  4YSX D;  3AE7 D;  3S9O A;  3G9R A;  2H89 C;  2D2C C;  1NEK D;  1ZOY D;  1KQG B;  1KIL E;  3AED D;  3VR9 C;  3AEB D;  1IK7 A;  2WU2 C;  2NZ2 A;  4PV1 C;  3P4S C;  3AEE D;  3VRB D;  2WDQ D;  2QSI A;  3AE7 C;  2WQY C;  4PV1 B;  4YXD C;  3D6Y A;  1NEK C;  2J5U A;  3Q5R A;  3SFD C;  1R8E A;  1NGM B;  2WU5 D;  5C3J D;  1Y9B A;  3VR9 D;  1UIX A;  1ZME C;  3GF3 A;  2WP9 C;  2E76 B;  2G3A A;  3Q5P A;  3AEC D;  5KLI C;  3VR8 D;  5L8R J;  2ACZ D;  3P4Q D;  1VL2 A;  2K9Y A;  4H13 D;  3D70 A;  1KTM A;  3Q3D A;  2BS2 C;  2H88 D;  4OGQ D;  2FBW C;  4H44 C;  3ABV D;  1VF5 D;  1JB0 J;  1PL5 A;  2B76 C;  3FGA D;  4H0L D;  2ZT9 C;  1RQU A;  3AE8 C;  3GMA A;  2OQQ A;  1L0V D;  2WU2 D;  4YT0 C;  2BEQ D;  3VRB C;  4H44 D;  2JP3 A;  3AEA D;  4I7Z B;  1KOR A;  3LW5 J;  2V7Q J;  4YTM D;  2WSC J;  1DIP A;  2WDV C;  3P4R D;  3AE5 D;  3VR8 C;  5KKZ C;  3AE2 C;  1AJY A;  4Y28 J;  4H13 C;  3AE3 C;  1PV3 A;  4KT0 J;  1YQ3 D;  1KF6 C;  1NEN C;  2FBW D;  2E76 C;  3P4P C;  1NYH A;  2YMK A;  2IDB A;  3Q5S A;  4KX6 C;  4H0L B;  3SFD D;  1WMK A;  4XFJ A;  1KF6 D;  2BS4 C;  1MKM A;  1EXJ A;  1ZRT E;  3IN6 A;  4YTP C;  1S1C X;  3GF7 A;  4H13 B;  1KQF B;  4YSZ C;  1FDO A;  1S5L X;  4IL6 X;  1QLB C;  3AE4 D;  4GDO A;  2WDQ C;  1K04 A;  3B71 A;  1YQ4 D;  3Q2Y A;  2WS3 D;  3VRA D;  4I7Z C;  4H0L C;  4YT0 D;  3AE3 D;  3R4Y A;  2P10 A;  4TT3 H;  3Q1M A;  2E74 B;  2BS3 C;  1DD3 A;  2ZT9 B;  1ZOY C;  2H89 D;  2WDR C;  1OW8 A;  3AE9 D;  3RL0 g;  1K05 A;  2E74 D;  3D71 A;  1ZP0 D;  3P4S D;  2WSF J;  3P4R C;  1VF5 C;  2WPV B;  3H25 A;  4OGQ B;  2B76 D;  4RKU J;  5C3J C;  1GMJ A;  4R4M A;  5M1B A;  1ZP0 C;  3D6Z A;  1TU3 F;  1L0V C;  3AE8 D;  3AE4 C;  1NEN D;  1OW7 A;  4YSY D;  2E76 D;  4U7J A;  1KFY D;  3AED C;  3CIR D;  3AEF D;  2O01 J;  4PV1 D;  3GLM A;  2H88 C;  1E7P C;  3ABV C;  1PIX A;  4R4L A;  1KFY C;  4YTN D;  5C2T C;  2WQY D;  1HJ0 A;  3AE2 D;  4YXD D;  2MKV A;  2YIU C;  3AEF C;  2ZT9 D;  1HF9 A;  3AE1 D;  3AE9 C;  3O6Q A;  4YSZ D;  3SFE D;  1EXI A;  3AE6 D;  3EWK A;  2G8Y A;  3IAO A;  3AEA C;  2WS3 C;  2D2C D;  3P4Q C;  2FXP A;  1OMI A;  3C8V A;  3AEB C;  2QIW A;  2E75 B;  3AE6 C;  4YTM C;  4YSY C;  1KMI Z;  3AE5 C;  2WDR D;  3CIR C;  2E75 C;  1OW6 A;  4YTP D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...