3SFDC

Crystal structure of porcine mitochondrial respiratory complex ii bound with oxaloacetate and pentachlorophenol
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Thiabendazole inhibits ubiquinone reduction activity of mitochondrial respiratory complex II via a water molecule mediated binding feature.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 49
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2011-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3sfdC01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3sfdC02
3P4QC 3SFEC 2WS3D 3AE2C 3CIRC 2FBWD 4YSXC 2WU2D 2WQYC 3AEDC 3AE1D 1NEKD 3VRBD 3B71A 3AE3C 3VR8C 1ZOYD 2WU5D 3VRAD 5C3JD 3P4SC 3AEFD 3AEGD 5C2TC 4YT0D 2BS2C 4YTNC 1OW7A 2H88C 1QLBC 1NENC 2WDRD 4KX6C 4YSZC 2BS4C 3AE7D 3SFDC 4YXDC 1ZP0D 3AEAD 4YTMC 1K04A 1OW8A 1E7PC 2ACZD 3AEBD 1PV3A 4YSYC 1KTMA 1OW6A 3AEEC 2WS3C 3P4RD 2FBWC 2BS3C 2WU2C 3AE1C 1KF6D 1NEKC 3VRBC 3AE6D 4YTPD 3P4PD 1ZOYC 1YQ3D 2WU5C 3VRAC 2WDQD 3AE9D 5C3JC 2B76C 1KFYD 3AEFC 1YQ4D 3AEGC 3AE5D 4YT0C 3AECD 2WDRC 1L0VD 3AE8D 3AE7C 3AE4D 1ZP0C 3AEAC 2H89D 3VR9D 3ABVD 2ACZC 2WP9D 3P4QD 2WDVD 3AEBC 3S9OA 3SFED 3P4RC 3AE2D 3CIRD 4YSXD 2WQYD 3AEDD 1KF6C 4YSYD 3AE6C 3AEED 3AE3D 4YTPC 3VR8D 3P4PC 1YQ3C 2WDQC 3AE9C 1KFYC 3P4SD 1K05A 1YQ4C 3AE5C 5C2TD 3AECC 4YTND 1L0VC 2H88D 1NEND 3AE8C 4KX6D 2B76D 4YSZD 3AE4C 3SFDD 4YXDD 2H89C 4YTMD 3VR9C 3ABVC 2WP9C 2WDVC 2G3AA
chains in the Genus database with same CATH superfamily
2KNCA 4O9BA 5B66H 4GT1A 3AE1D 1ZXGA 1IFMA 1FJKA 1NKZB 1PP9J 3Q1MA 1L2PA 4I6LA 3E7KA 3IF4A 3AEGD 4GKGA 2V7QJ 1HGZA 2BS4C 3AE7D 4I1LA 5KLIC 3AEAD 2BCCJ 5C39A 5KLVG 3GF3A 5DJTB 3TGUJ 1GTWA 1ZRTE 2NPSC 1OMIA 5H2FE 2Q3EA 4H13C 4N6JA 1IK9A 2OYHB 4PJ0E 2WDQD 2LKMA 2Z5HA 1G1JA 4OH8B 1KV4A 3IFMA 2HFED 2FKWB 1MV8A 2KOGA 2ZFCA 3LW5H 4KT0J 3GLMA 2KK7A 1QX8A 3II6A 3CLQA 1M90Q 2QM7A 1HBWA 1VQMP 3FXEA 1SQVJ 4GOFA 1LGHB 1S1CX 3EWKA 4Z1MH 3M91A 2WSEJ 1BGYJ 2M8RA 1IJDB 2O1KA 2M3EA 4W80A 2R44A 3VMYA 1W2BO 2QA4P 5KAIE 2FYNB 1GK6A 3OA7A 3ABVC 4R4LA 2QJYC 5TISE 3CCQP 5EFWB 1SQQE 1VF5B 2I8DA 4KJMA 2P67A 2JWAA 1FZCA 4KHXA 3L74G 3LIDA 1LWUB 2R5DA 3B4SA 1LTJA 3NXSA 4BRYB 2IPPA 1ZR2A 1YTZT 1TFFA 3L72E 4WY4B 1SQVK 2QVAA 3HUSA 1EZVE 5BVZA 5C2TC 3HTKA 2WDRD 4OGQC 3IN6A 3H1KJ 2K1AA 1H0TA 2ZAEB 2ZJSE 2E43A 1NTZK 2LXBA 4PD4E 3G71P 1NTKG 1YQ3D 2V4HA 2WWWA 3L74D 5C3JC 1FS0E 2E76B 3H1LE 3B5NC 3CMEP 3HE5B 3IAOA 5AVWB 3EQ2A 1OVRA 1DEBA 5APTA 3VP8A 1WRGA 1NU1E 3H1JG 5E79E 2FYUG 2H7HA 3AEDD 3USSA 1SQPE 2W6AA 2HYNA 2ZFYA 1JCDA 2JWDA 1AQTA 1S9KD 3AE9C 1NTKD 5H2FH 3Q3DA 1URQD 4PJ0H 1X8YA 1M1JB 2H88D 1HUCA 3AE8C 4U3FG 3CWBJ 1VF5D 2O01J 1OX3A 4CPGA 2H8PD 2Y9ZA 3VONA 5KLVJ 4IFDK 1JCCA 3H1JD 1FZAA 2AEFA 2FYUD 4H44B 2WSFH 4L76A 4Y99B 1JM0A 4FJVA 1URQA 1MKMA 3P8CD 4Y28J 5AVZB 3H32B 4U3FD 1DH3A 2ACZD 3AEBD 1L0LE 5KAIH 1N7SB 2XNDH 3Q5PA 3CCMP 3RK2D 4BRYA 2C0XA 3VRBC 5TISH 4WY4A 3BCCE 3NMDA 3G6EP 3HD7B 3D70A 3H1IJ 4ASWA 2A06E 1CI6B 1KILC 5KLVK 4N3YB 5CJ0A 2E74C 1JY2O 1R5SA 2IBZG 1LJ2A 3SFED 3P4RC 3AE2D 4YSXD 3L37A 1EQ7A 5AVRB 4YSYD 3VOPA 2N1TC 1FOSF 3W67A 1VQOP 3HE5A 1FDOA 2CPBA 3L74J 2BEQD 3F5HA 3AE4C 3HRNA 5KJ7C 3CPWO 2KUBA 4N78E 2IBZI 2WP9C 3P4QC 3A2AA 1ZR4A 4NPEA 2XU6A 3UIAA 1EDKA 2WS3D 1J1DB 2IBZD 5AW5B 2WU2D 3G4SP 2KIKA 4H44D 1ZRTD 5E79H 3M06A 1M1JA 3FGAD 2QE7H 1E79H 1NTKJ 4YTNC 1BSHA 1AVOA 3RK3C 4K3AA 3M9QA 1JUNA 2J58A 3ZDMA 1R5LA 2YKOA 3ITKA 1SQQG 2JO1A 3WUVA 1N8RQ 3P32A 1RE3C 1VQ6P 4YTPD 1X9VA 2Q7CA 2FYUJ 1KFYD 5AVTB 1KFNA 2WITA 4TLFA 1EZVG 1UIIA 3CCJP 4JF7A 1N7SA 1P84E 1YTZI 1JOCA 2QRXA 4ZKUA 4U3FJ 2K9YA 4AYCA 3M9BA 4EYYQ 5KLIB 3AEED 1SQQD 2B87B 5AVUB 1JY3O 2XDJA 3PLNA 2NPSB 2W6BA 1CI6A 4H13B 3OAKA 5B66E 1EZVI 2SPZA 3H1LG 4YTMD 3V2RA 2FXPA 1EZVD 3S1KA 1FOSE 1VQ9P 1H88A 3FWLA 1S3JA 3N7NA 3V2QA 3CCLP 1FZFA 1YJWP 1NU1G 1S72P 1VQLP 4PD4I 1SQPG 1PPJE 4PD4D 1GL2C 2IYOA 3RL0g 5M1BA 1SFCD 1KILE 3LIEA 4XFJA 1K73Q 2E75D 1UIXA 4YXDC 2D2CD 3H1LD 1VQ7P 3VYIA 1L4AD 4XA4A 1AA0A 1JMMA 4HH2A 1U7JA 3VTPC 2BS3C 1U57A 2JJLA 1LTIC 2HG5D 1USDA 2QJYB 1PGQA 3P7KA 3RGUA 2PP6A 4NPFX 1NU1D 2Q3IA 1SQPD 1YQ4D 2O01N 3IR9A 3V4QA 4EDFA 3WMM0 2AEJA 1L4AA 1LTBC 4H0LD 3V5BA 4OGQB 1JMBA 2Q6QA 1IC2A 3GHGC 1RHZB 4AQRD 1HVVA 1YI2P 1VDFA 1L0LG 2FFDC 2ZT9C 1SQBK 1WT6A 3P4PC 4I2LC 1IO4A 1K05A 3BCCG 2WSFJ 3RK3E 1EXJA 2KYVA 4KX6D 2C9NY 2POHA 1GK4A 1NTMG 2A06G 3A0HE 1OWAA 1L0NK 5AW0B 2L91A 2RN0A 4I7ZC 3B5NB 5GTHH 2FBWD 2B87A 4HKZH 1P84H 2OYIA 4RESB 5CBNA 5AW3B 1L0LD 2NPSA 3D71A 4PV1D 1SQQJ 1VQ8P 3CI9A 2C9LY 1T2KD 1N73C 3WU2E 3BCCD 3SFDC 1YYCA 2PAJA 1NTMD 2A06D 3L71G 1RE4A 1KTMA 5CBOA 3CX5E 3BRVB 4IFMA 1Y47A 2R3SA 4GODA 1ZP0C 3R2PA 3VR9D 1W2EA 3H1LJ 2B89A 1D7MA 5APVA 3L71D 3L70E 2WQYD 3WUUA 4N78D 3RL0C 4TT3H 2HODB 3O6QA 2YO2A 2FYZA 1VPCA 1T3UA 1RF0C 1NU1J 3AECC 1L0VC 2WVRA 1SQPJ 1PL5A 1Y8AA 2AXTE 5AW8B 1LTTC 1LT9C 4I6MC 1X79B 2HLOA 1J1EC 1KILB 3CIRC 1NVOA 3L73E 3M9HA 2M5AB 3MUDA 4BXLA 2E74B 1M8OB 1T6AA 3VR8C 1NYHA 1EC5A 5K5GB 1KC8Q 3OJAB 2N1TB 1NENC 5CJ4A 2M3BA 4WWIA 2RH0A 3L4FA 3GF7A 1OW8A 4GDOA 2PGDA 1KZUB 1OIPA 4L74A 1DIPA 1P84I 1AQ5A 1FAVA 3A0HH 1IFIA 1P84D 3VN0A 1AFOA 3CCVP 3AE1C 1VQ4P 1QL1A 3BRTB 5KTBA 1L0LJ 4UB8H 2GUSA 1OVUA 3AEGC 1RY3A 2JDIH 3AE7C 4L75A 1G1IA 3AEAC 2H89D 3BCCJ 1CZQA 3WU2H 2YMYA 3RK3B 3NTNA 1NTMJ 1EDLA 3RBXA 5B5EE 1SQXG 4BWNA 3AE3D 3VMXA 3T97B 2WDQC 4DHJA 1FDIA 3E1IA 3QH9A 1JEKA 2IZ1A 1HTLC 3CX5H 3TGUE 2KS1B 5BU5A 4A7PA 2OYHA 1A02F 1KILD 2XNXA 1H89A 2Y9YA 1NKNA 2HODA 1MFTA 2XV5A 2YXRB 3L71J 2B9BA 2W90A 1LTJC 1SQXD 2WU5D 4MN4C 4D6TE 1QVGO 3V6IA 2HPCB 1YIJP 4LC1A 1SQVE 3CD6P 3CCSP 2PFXA 1GD2E 2G8YA 2YO3A 1KILA 2M5AA 1BGYE 1NGMB 2AXTH 1HGVA 4WY4D 3L75E 1KF6D 3HE4B 1NTZE 1FC2C 2N1TA 3C9IA 2IDBA 2B76C 1MUUA 2FXMA 1RF1C 1KORA 1M57D 2WDRC 1K9MQ 2L5GB 3TSIA 3RK3D 2WDVD 1LWUA 1GL2B 3K5BA 4DHIB 5KJ7A 5CCGD 1SS1A 3S9OA 4DHZA 2E76D 2QJKC 2N9YB 1YQ3C 2Y0EA 2WMMA 4EIJA 1GU5A 4YSZD 1PGPA 1VL2A 4ZNCA 1FE6A 1KYOE 1SLQA 2G3AA 1KB9E 5CCGA 2PRRA 3AEDC 3T97A 2KB7P 1NEKD 1MZ9A 1QL2A 3GMAA 3B71A 3MGNA 1FZBA 2YIUC 3KYQA 2QSIA 3A5TA 3GHGB 2Q5UA 5B5EH 1RE3A 3AEFD 2FFDB 2ZT9B 1URQC 1GDTA 2KS1A 2H88C 3KZIE 1NH4A 5BU8B 5APSA 1E7PC 1LTGC 2P10A 4EOTA 1PV3A 3TK1A 5AW6B 4HJGH 5AVQB 4I7ZB 3NFQA 3L73G 2HPCA 2JR8A 1T8ZA 4OVNF 3M0DA 1JTHB 1SQXJ 3LW5J 3CWBE 2Y0DA 3AE5D 1JB0J 3F89A 1N7SD 5AVYB 1J2JB 4RKUJ 4DZOA 1IFJA 1HJBA 2YXQB 2ACZC 1HH0A 1JY2N 1LNQA 5KLVE 3AEBC 1N73B 2IYPA 3HD7D 1W5CE 1HF9A 3RK2C 3H1JJ 2OYOA 4UB6E 2GM4A 4RO0A 5GTHE 2QIWA 3L72G 3L73D 1QLED 3H32A 3P4SD 5KAFE 4DOJA 1VQPP 4JPZB 1NO4A 1HWTC 1GL2A 2BS2C 2KZIA 1NTKK 1JNMA 1AJYA 3HD7A 3SFEC 3AE2C 4YSXC 3H1HE 3TNUB 3U59A 2Q1KA 5AW7B 3H25A 5L8RJ 1GU4A 3H1IE 1ZOYD 4HB1A 3VRAD 5AVVB 4WB4A 3Q5SA 3JC22 5CCHC 3KQGA 2LR2A 3L72D 3RL0B 4YT0D 1OW7A 1VQKP 1XTCC 2E5TA 3U1AA 2FYUK 1ZW0A 2A45H 1ZN5A 3GG2A 2P7JA 1OW6A 1M7LA 3D6ZA 2WS3C 2WU2C 1KYOH 2IFNA 1LT9B 3SWFA 1KB9H 3AE6D 3RBZA 3V4WA 1J1EB 4D6TG 3CXHE 3CMAP 2KLVA 2XZRA 2BASA 1SQVG 1IFPA 2KSJA 3KZIH 1WMKA 3PTZA 3TGUD 1NOHA 3I55P 1NAFA 1SVFA 4IFFA 1LTAC 2I1KA 3Q5RA 3L75G 4YTPC 1IK7A 1JY3N 2H43A 2Y0CA 1X22A 1NTZG 1KFYC 4OWFA 3W68A 1OFCX 4D6TD 4IL6E 4C7RA 5APYA 2OTJP 3I5CA 1S5LH 1SQVD 2O01H 3B8EB 2AEMA 2NPSD 3G9RA 1KMIZ 4H13D 2FYUE 1BCCE 2P1JA 1X0TA 5AVXB 1PGOA 3C1LA 3L75D 5GTIH 3P8CE 4UB6H 1FU1A 1NTZD 1KQGB 4YTMC 5KAFH 1PZQA 4UB8E 3S4RA 1PFIA 3TNUA 2OTKE 2R32A 3CL3D 3MD0A 2UWJE 2CPSA 1IFNA 3JSVC 3H6PA 4K35A 1SFCC 2CK3H 3VMAA 2Q9IA 1LTJB 3L72J 2E75C 1E5WA 3V2PA 2D2CC 3ABVD 1OZHA 1L4AC 1USEA 1KYOI 1RQVA 1KB9I 1LT9A 1ZMEC 3U1CA 1KYOD 1KB9D 2WPRA 4JYCA 3MIWA 2MKVA 1SQBE 1YQ4C 2ZYAA 5C2TD 4ZKPA 4OGQD 3CWBG 5AVSB 2WSSH 1Q81Q 1SQQK 1KQLA 3CXHH 4H0LC 1RF1B 2IBZE 1L0NE 5AW4B 1G2CB 2OYIC 3CC2P 1S4XA 2DW3A 5CMZA 1LT1A 3TF5A 5C3JD 1LTSC 2W8ZA 3B5ND 2ZXEB 2NRGA 2QJKB 3OW2O 1SP4A 4KX6C 1Q2NA 2E42A 2ITAA 2YKPA 4D6TJ 3CWBD 4L73A 4IL6H 5AW9B 3JCUE 1RE4C 1VQ5P 1QVFO 2FBWC 2ZXXA 5KLVD 4WVZA 3H1HG 4PV1C 2IFMA 3AE9D 3H1IG 1NJIQ 2K88A 1T2KC 1AV1A 3B5NA 1RQUA 1GZLA 1YITP 3L75J 4ASVA 3AE8D 1BE3E 2YIUB 1FJPA 1NTZJ 1NU1K 1URQB 1SQPK 2W27A 1DEEG 3FX0A 2KP8A 3C8VA 2ZVOB 2YMKA 3FXDA 1PPJG 3VP9A 2WPSA 2KSEA 3H1HD 3TYYA 4EI2A 4IL6X 2KZJA 3H1ID 2QM8A 2B76D 2RMZA 3PHLA 3VR9C 1RH5B 2R3CA 3A7OA 3KPEA 4NPDA 1PP9E 2WSCH 2WPQA 4RJTA 4XE5B 1YHQP 2WQYC 3MUDC 2QEXP 2P2UA 3VRBD 3TDKA 2W83C 2BCCE 3RK2B 1PPJD 5TJHA 1QLBC 2QJPC 5KKZC 3CXHI 2GA1A 3BASA 1L0LK 1YJ9P 1RF1A 4DT0A 4GIFA 1AVYA 1A02J 3VMZA 2E74D 3CXHD 3QWOC 2N9BA 1FZCC 3MP7B 1G2CA 1EDJA 3PH0A 3P4RD 1JY2P 2K37A 1KFMA 3PP5A 1DD4A 2N1TD 3HUSC 2JEEA 4B86A 1OVVA 1BCCG 3BATA 1NTMK 2MJZA 3Q2YA 3R4YA 2WT7B 3SWKA 3AE4D 3BVHA 5KJ7D 4YXWH 2WP9D 3P4QD 1DX7A 3A0BE 3WUTA 4DCKA 5APUA 4QMAA 3JCUH 2O3JA 3A3YB 1BCCD 2KLUA 2Z5IA 4YTND 4AUWA 2K9JB 2LXCB 4DDIA 1S2EA 2H89C 3SWYA 2OYHC 1CSBA 1N86A 3PJSK 2OQQA 4IOIH 1Q86Q 1DD3A 1EDIA 3H1KE 3AE3C 4LLHA 3V2NA 2WZ7A 1GW3A 2NZ2A 4U7JA 5APWA 1SQBG 3H1HJ 3D6YA 1H8AA 2QG4A 2IX7C 1NTME 4DDGA 3L70G 2Z4EA 2O1JA 1BSNA 1L0NG 1IFDA 5APQA 3CX5I 2HR3A 3KDPB 1KN7A 2WU5C 1T3JA 2FYNC 3CX5D 2YKQA 2V7QH 4W7YA 2B88A 1JY3P 1VF5C 5CCHD 1SQBD 3CCRP 4PD4H 1ZLLA 5AW1B 1LWUC 3M0AA 3CC7P 1MFZA 3L71E 2GUVA 1QEXA 4WY4C 1R8EA 3MZWB 3GW6A 2J59M 1KF6C 1CW5A 3L70D 2YNYA 1L0ND 4DJGA 2WT7A 1M1KQ 2KXPB 4C7NB 1S5LE 2VRSA 1PIXA 4WBAA 1GL2D 1LP1B 1M56D 5CCHA 1BDDA 4YXDD 1NWQA 1BE3G 3HE4A 2R5BA 3P8MC 2WDVC 2ZVNB 5GTIE 1SFCB 5CCGC 4LGDE 2FY8A 1N2DC 2E75B 2E76C 2OTLP 2E5YA 2D2CB 2WSEH 1L4AB 3MTUE 3A0BH 4M3LA 1OXZA 2K9JA 4HYTB 1JO5A 3CCUP 1FBMA 4YSZC 1BCCJ 1XTGB 1N7LA 1SQXK 1BE3D 4YSYC 2IZ0A 1PP9G 2OGUA 3I56P 3SSUA 2KI7B 2WTYA 2ZT9D 5APXA 1NEKC 1KQSO 1GMJA 1M1JC 4H0LB 1Q82Q 3P4PD 2OARA 1NHLA 3M0DC 2BCCG 3AEFC 2OYIB 1FDMA 1YJNP 2M0BA 5CHXA 3TGUG 3EFFK 4ZMDA 4C46A 1EXIA 3PRJA 1FZGA 2J5UA 2WSCJ 4H44C 3GHGA 4W7ZA 1GW4A 2C0WA 4Y99C 3L74E 1Q7YQ 2FFDA 2KNCB 1PP9D 1U7MA 3L35A 1KD1Q 1HJ0A 1VQNP 5DJUB 2JKVA 3AE5C 2K3RA 2BCCD 1N7SC 4PV1B 3SFDD 2FXOA 3CC4P 1SQBJ 3KXDA 4JBZA 1QGKB 1BGYG 1IZNB 2ZYGA 3HD7C 3CCEP 1S9KE 1JTHA 2JP3A 1NTKE 3G3ZA 3KHUA 5AW2B 1K8AQ 4YPCA 4C7NA 1SQXE 3L36A 4JYBA 2XKMA 3L70J 1Y9BA 1LP1A 2AXCA 1L0NJ 3P4SC 1ZV8A 1N73A 3O6QB 1ZP0D 1K04A 1SFCA 2RKLA 1Q90D 4R4MA 3H1JE 4LDTA 3AEEC 1FZEA 1BGYD 4JQ0D 3RL0D 3FWNA 1ZOYC 3VRAC 3L73J 3H1KG 2A45G 4GOEA 4U3FE 1NAYA 4YT0C 3AECD 1L0VD 1J1DC 2P58A 2I1JA 1TU3F 1PGJA 1Z56A 3O8ZA 2QJPB 5KKZB 3CIRD 1BE3J 2WPVB 3N4XA 2W6JH 1S5LX 3AE6C 3E1RA 3VR8D 3EFGA 1FZCB 1YBKA 2A45I 1RF0A 2BEZF 3H1KD 3MHVA 1NEND 3HUSB 3HTKB 1BDCA 2ZYDA 1KQFB 1H0TB
chains in the Genus database with same CATH topology
3P4QC 1AJYA 1VF5B 3SFEC 2WS3D 2OQQA 3AE2C 3CIRC 2E75B 2E76C 2JP3A 3G9RA 2FBWD 2WU2D 4YSXC 2D2CB 1KMIZ 2WQYC 3AEDC 1DD3A 4H13D 3AE1D 1NEKD 2E74B 5L8RJ 3GMAA 3B71A 4H44D 3H25A 3VRBD 3AE3C 3VR8C 3D71A 4PV1D 2YIUC 1ZOYD 2WU5D 3VRAD 1NYHA 2QSIA 3Q1MA 4H44B 1Y9BA 2WDRD 5C3JD 3P4SC 3Q5SA 3FGAD 2NZ2A 3AEFD 4U7JA 2ZT9B 3AEGD 5C2TC 4YT0D 2G3AA 3D6YA 1OW7A 2H88C 3IN6A 1KILE 2V7QJ 2QJPC 1MKMA 1KQGB 4OGQC 4XFJA 5M1BA 1NENC 4Y28J 5KKZC 2BS4C 3AE7D 3SFDC 4KX6C 4YSZC 2E75D 1UIXA 5KLIC 4YXDC 1ZP0D 2D2CD 3GF7A 1K04A 3AEAD 4YTMC 1OW8A 4GDOA 2G8YA 1E7PC 2E74D 1Q90D 3GF3A 2ACZD 4R4MA 1DIPA 2P10A 3AEBD 1PV3A 4YSYC 1KTMA 1OW6A 3D6ZA 3AEEC 2WS3C 1ZRTE 3Q5PA 1NGMB 3P4RD 2FBWC 1U57A 2BS3C 2WU2C 1OMIA 2JO1A 2ZT9D 4H13C 3AE1C 1KF6D 1NEKC 4I7ZB 1GMJA 1DD4A 3AE6D 3VRBC 4H0LB 4YTPD 4PV1C 3P4PD 1ZOYC 1YQ3D 2WU5C 3VRAC 2WDQD 2FYNC 3AE9D 3Q2YA 3R4YA 3D70A 5C3JC 2E76B 1KFYD 2B76C 2IDBA 3AEFC 1YQ4D 1QLBC 3LW5J 1RQUA 3AEGC 1KORA 3AE5D 4YT0C 1JB0J 2WDRC 3AECD 1VF5C 1L0VD 4KT0J 3AE8D 3GLMA 3IAOA 3AE7C 3AE4D 2E75C 1ZP0C 2D2CC 3AEAC 2H89D 3VR9D 1EXIA 4RKUJ 1TU3F 3ABVD 2E74C 2ACZC 2WP9D 3P4QD 2WDVD 4H0LD 1RQVA 3AEBC 2J5UA 1WMKA 4OGQB 3S9OA 1S1CX 2K9YA 2WSCJ 4H44C 3C8VA 3SFED 1ZMEC 3P4RC 3AE2D 1HF9A 2E76D 3CIRD 1R8EA 4YTNC 4YSXD 3EWKA 2WPVB 4Z1MH 2WQYD 2ZT9C 2QJKC 3AEDD 1KF6C 4TT3H 4YSYD 2YMKA 1S5LX 3RL0g 3AE6C 2WSEJ 3O6QA 3AEED 3Q5RA 3AE3D 4YTPC 3VR8D 3P4PC 1YQ3C 1HJ0A 3T97B 2WDQC 1IK7A 3AE9C 2MKVA 2QIWA 1FDIA 1PIXA 4IL6X 1KFYC 3P4SD 1K05A 1YQ4C 1FDOA 2BEZF 2WSFJ 4H13B 3Q3DA 2WDVC 3AE5C 5C2TD 3RK3E 3AECC 1EXJA 4YTND 4OGQD 2BEQD 1L0VC 1NEND 2H88D 3AE8C 4KX6D 4PV1B 2B76D 4YSZD 3AE4C 1VL2A 3SFDD 1PL5A 4YXDD 2H89C 4YTMD 2FXPA 3VR9C 3ABVC 1VF5D 4R4LA 4I7ZC 1KQFB 2QJYC 2WP9C 2BS2C 2O01J 4H0LC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P4Q C;  3SFE C;  2WS3 D;  3AE2 C;  3CIR C;  2FBW D;  4YSX C;  2WU2 D;  2WQY C;  3AED C;  3AE1 D;  1NEK D;  3VRB D;  3B71 A;  3AE3 C;  3VR8 C;  1ZOY D;  2WU5 D;  3VRA D;  5C3J D;  3P4S C;  3AEF D;  3AEG D;  5C2T C;  4YT0 D;  2BS2 C;  4YTN C;  1OW7 A;  2H88 C;  1QLB C;  1NEN C;  2WDR D;  4KX6 C;  4YSZ C;  2BS4 C;  3AE7 D;  3SFD C;  4YXD C;  1ZP0 D;  3AEA D;  4YTM C;  1K04 A;  1OW8 A;  1E7P C;  2ACZ D;  3AEB D;  1PV3 A;  4YSY C;  1KTM A;  1OW6 A;  3AEE C;  2WS3 C;  3P4R D;  2FBW C;  2BS3 C;  2WU2 C;  3AE1 C;  1KF6 D;  1NEK C;  3VRB C;  3AE6 D;  4YTP D;  3P4P D;  1ZOY C;  1YQ3 D;  2WU5 C;  3VRA C;  2WDQ D;  3AE9 D;  5C3J C;  2B76 C;  1KFY D;  3AEF C;  1YQ4 D;  3AEG C;  3AE5 D;  4YT0 C;  3AEC D;  2WDR C;  1L0V D;  3AE8 D;  3AE7 C;  3AE4 D;  1ZP0 C;  3AEA C;  2H89 D;  3VR9 D;  3ABV D;  2ACZ C;  2WP9 D;  3P4Q D;  2WDV D;  3AEB C;  3S9O A;  3SFE D;  3P4R C;  3AE2 D;  3CIR D;  4YSX D;  2WQY D;  3AED D;  1KF6 C;  4YSY D;  3AE6 C;  3AEE D;  3AE3 D;  4YTP C;  3VR8 D;  3P4P C;  1YQ3 C;  2WDQ C;  3AE9 C;  1KFY C;  3P4S D;  1K05 A;  1YQ4 C;  3AE5 C;  5C2T D;  3AEC C;  4YTN D;  1L0V C;  2H88 D;  1NEN D;  3AE8 C;  4KX6 D;  2B76 D;  4YSZ D;  3AE4 C;  3SFD D;  4YXD D;  2H89 C;  4YTM D;  3VR9 C;  3ABV C;  2WP9 C;  2WDV C;  2G3A A; 
#chains in the Genus database with same CATH topology
 2KNC A;  4O9B A;  5B66 H;  4GT1 A;  3AE1 D;  1ZXG A;  1IFM A;  1FJK A;  1NKZ B;  1PP9 J;  3Q1M A;  1L2P A;  4I6L A;  3E7K A;  3IF4 A;  3AEG D;  4GKG A;  2V7Q J;  1HGZ A;  2BS4 C;  3AE7 D;  4I1L A;  5KLI C;  3AEA D;  2BCC J;  5C39 A;  5KLV G;  3GF3 A;  5DJT B;  3TGU J;  1GTW A;  1ZRT E;  2NPS C;  1OMI A;  5H2F E;  2Q3E A;  4H13 C;  4N6J A;  1IK9 A;  2OYH B;  4PJ0 E;  2WDQ D;  2LKM A;  2Z5H A;  1G1J A;  4OH8 B;  1KV4 A;  3IFM A;  2HFE D;  2FKW B;  1MV8 A;  2KOG A;  2ZFC A;  3LW5 H;  4KT0 J;  3GLM A;  2KK7 A;  1QX8 A;  3II6 A;  3CLQ A;  1M90 Q;  2QM7 A;  1HBW A;  1VQM P;  3FXE A;  1SQV J;  4GOF A;  1LGH B;  1S1C X;  3EWK A;  4Z1M H;  3M91 A;  2WSE J;  1BGY J;  2M8R A;  1IJD B;  2O1K A;  2M3E A;  4W80 A;  2R44 A;  3VMY A;  1W2B O;  2QA4 P;  5KAI E;  2FYN B;  1GK6 A;  3OA7 A;  3ABV C;  4R4L A;  2QJY C;  5TIS E;  3CCQ P;  5EFW B;  1SQQ E;  1VF5 B;  2I8D A;  4KJM A;  2P67 A;  2JWA A;  1FZC A;  4KHX A;  3L74 G;  3LID A;  1LWU B;  2R5D A;  3B4S A;  1LTJ A;  3NXS A;  4BRY B;  2IPP A;  1ZR2 A;  1YTZ T;  1TFF A;  3L72 E;  4WY4 B;  1SQV K;  2QVA A;  3HUS A;  1EZV E;  5BVZ A;  5C2T C;  3HTK A;  2WDR D;  4OGQ C;  3IN6 A;  3H1K J;  2K1A A;  1H0T A;  2ZAE B;  2ZJS E;  2E43 A;  1NTZ K;  2LXB A;  4PD4 E;  3G71 P;  1NTK G;  1YQ3 D;  2V4H A;  2WWW A;  3L74 D;  5C3J C;  1FS0 E;  2E76 B;  3H1L E;  3B5N C;  3CME P;  3HE5 B;  3IAO A;  5AVW B;  3EQ2 A;  1OVR A;  1DEB A;  5APT A;  3VP8 A;  1WRG A;  1NU1 E;  3H1J G;  5E79 E;  2FYU G;  2H7H A;  3AED D;  3USS A;  1SQP E;  2W6A A;  2HYN A;  2ZFY A;  1JCD A;  2JWD A;  1AQT A;  1S9K D;  3AE9 C;  1NTK D;  5H2F H;  3Q3D A;  1URQ D;  4PJ0 H;  1X8Y A;  1M1J B;  2H88 D;  1HUC A;  3AE8 C;  4U3F G;  3CWB J;  1VF5 D;  2O01 J;  1OX3 A;  4CPG A;  2H8P D;  2Y9Z A;  3VON A;  5KLV J;  4IFD K;  1JCC A;  3H1J D;  1FZA A;  2AEF A;  2FYU D;  4H44 B;  2WSF H;  4L76 A;  4Y99 B;  1JM0 A;  4FJV A;  1URQ A;  1MKM A;  3P8C D;  4Y28 J;  5AVZ B;  3H32 B;  4U3F D;  1DH3 A;  2ACZ D;  3AEB D;  1L0L E;  5KAI H;  1N7S B;  2XND H;  3Q5P A;  3CCM P;  3RK2 D;  4BRY A;  2C0X A;  3VRB C;  5TIS H;  4WY4 A;  3BCC E;  3NMD A;  3G6E P;  3HD7 B;  3D70 A;  3H1I J;  4ASW A;  2A06 E;  1CI6 B;  1KIL C;  5KLV K;  4N3Y B;  5CJ0 A;  2E74 C;  1JY2 O;  1R5S A;  2IBZ G;  1LJ2 A;  3SFE D;  3P4R C;  3AE2 D;  4YSX D;  3L37 A;  1EQ7 A;  5AVR B;  4YSY D;  3VOP A;  2N1T C;  1FOS F;  3W67 A;  1VQO P;  3HE5 A;  1FDO A;  2CPB A;  3L74 J;  2BEQ D;  3F5H A;  3AE4 C;  3HRN A;  5KJ7 C;  3CPW O;  2KUB A;  4N78 E;  2IBZ I;  2WP9 C;  3P4Q C;  3A2A A;  1ZR4 A;  4NPE A;  2XU6 A;  3UIA A;  1EDK A;  2WS3 D;  1J1D B;  2IBZ D;  5AW5 B;  2WU2 D;  3G4S P;  2KIK A;  4H44 D;  1ZRT D;  5E79 H;  3M06 A;  1M1J A;  3FGA D;  2QE7 H;  1E79 H;  1NTK J;  4YTN C;  1BSH A;  1AVO A;  3RK3 C;  4K3A A;  3M9Q A;  1JUN A;  2J58 A;  3ZDM A;  1R5L A;  2YKO A;  3ITK A;  1SQQ G;  2JO1 A;  3WUV A;  1N8R Q;  3P32 A;  1RE3 C;  1VQ6 P;  4YTP D;  1X9V A;  2Q7C A;  2FYU J;  1KFY D;  5AVT B;  1KFN A;  2WIT A;  4TLF A;  1EZV G;  1UII A;  3CCJ P;  4JF7 A;  1N7S A;  1P84 E;  1YTZ I;  1JOC A;  2QRX A;  4ZKU A;  4U3F J;  2K9Y A;  4AYC A;  3M9B A;  4EYY Q;  5KLI B;  3AEE D;  1SQQ D;  2B87 B;  5AVU B;  1JY3 O;  2XDJ A;  3PLN A;  2NPS B;  2W6B A;  1CI6 A;  4H13 B;  3OAK A;  5B66 E;  1EZV I;  2SPZ A;  3H1L G;  4YTM D;  3V2R A;  2FXP A;  1EZV D;  3S1K A;  1FOS E;  1VQ9 P;  1H88 A;  3FWL A;  1S3J A;  3N7N A;  3V2Q A;  3CCL P;  1FZF A;  1YJW P;  1NU1 G;  1S72 P;  1VQL P;  4PD4 I;  1SQP G;  1PPJ E;  4PD4 D;  1GL2 C;  2IYO A;  3RL0 g;  5M1B A;  1SFC D;  1KIL E;  3LIE A;  4XFJ A;  1K73 Q;  2E75 D;  1UIX A;  4YXD C;  2D2C D;  3H1L D;  1VQ7 P;  3VYI A;  1L4A D;  4XA4 A;  1AA0 A;  1JMM A;  4HH2 A;  1U7J A;  3VTP C;  2BS3 C;  1U57 A;  2JJL A;  1LTI C;  2HG5 D;  1USD A;  2QJY B;  1PGQ A;  3P7K A;  3RGU A;  2PP6 A;  4NPF X;  1NU1 D;  2Q3I A;  1SQP D;  1YQ4 D;  2O01 N;  3IR9 A;  3V4Q A;  4EDF A;  3WMM 0;  2AEJ A;  1L4A A;  1LTB C;  4H0L D;  3V5B A;  4OGQ B;  1JMB A;  2Q6Q A;  1IC2 A;  3GHG C;  1RHZ B;  4AQR D;  1HVV A;  1YI2 P;  1VDF A;  1L0L G;  2FFD C;  2ZT9 C;  1SQB K;  1WT6 A;  3P4P C;  4I2L C;  1IO4 A;  1K05 A;  3BCC G;  2WSF J;  3RK3 E;  1EXJ A;  2KYV A;  4KX6 D;  2C9N Y;  2POH A;  1GK4 A;  1NTM G;  2A06 G;  3A0H E;  1OWA A;  1L0N K;  5AW0 B;  2L91 A;  2RN0 A;  4I7Z C;  3B5N B;  5GTH H;  2FBW D;  2B87 A;  4HKZ H;  1P84 H;  2OYI A;  4RES B;  5CBN A;  5AW3 B;  1L0L D;  2NPS A;  3D71 A;  4PV1 D;  1SQQ J;  1VQ8 P;  3CI9 A;  2C9L Y;  1T2K D;  1N73 C;  3WU2 E;  3BCC D;  3SFD C;  1YYC A;  2PAJ A;  1NTM D;  2A06 D;  3L71 G;  1RE4 A;  1KTM A;  5CBO A;  3CX5 E;  3BRV B;  4IFM A;  1Y47 A;  2R3S A;  4GOD A;  1ZP0 C;  3R2P A;  3VR9 D;  1W2E A;  3H1L J;  2B89 A;  1D7M A;  5APV A;  3L71 D;  3L70 E;  2WQY D;  3WUU A;  4N78 D;  3RL0 C;  4TT3 H;  2HOD B;  3O6Q A;  2YO2 A;  2FYZ A;  1VPC A;  1T3U A;  1RF0 C;  1NU1 J;  3AEC C;  1L0V C;  2WVR A;  1SQP J;  1PL5 A;  1Y8A A;  2AXT E;  5AW8 B;  1LTT C;  1LT9 C;  4I6M C;  1X79 B;  2HLO A;  1J1E C;  1KIL B;  3CIR C;  1NVO A;  3L73 E;  3M9H A;  2M5A B;  3MUD A;  4BXL A;  2E74 B;  1M8O B;  1T6A A;  3VR8 C;  1NYH A;  1EC5 A;  5K5G B;  1KC8 Q;  3OJA B;  2N1T B;  1NEN C;  5CJ4 A;  2M3B A;  4WWI A;  2RH0 A;  3L4F A;  3GF7 A;  1OW8 A;  4GDO A;  2PGD A;  1KZU B;  1OIP A;  4L74 A;  1DIP A;  1P84 I;  1AQ5 A;  1FAV A;  3A0H H;  1IFI A;  1P84 D;  3VN0 A;  1AFO A;  3CCV P;  3AE1 C;  1VQ4 P;  1QL1 A;  3BRT B;  5KTB A;  1L0L J;  4UB8 H;  2GUS A;  1OVU A;  3AEG C;  1RY3 A;  2JDI H;  3AE7 C;  4L75 A;  1G1I A;  3AEA C;  2H89 D;  3BCC J;  1CZQ A;  3WU2 H;  2YMY A;  3RK3 B;  3NTN A;  1NTM J;  1EDL A;  3RBX A;  5B5E E;  1SQX G;  4BWN A;  3AE3 D;  3VMX A;  3T97 B;  2WDQ C;  4DHJ A;  1FDI A;  3E1I A;  3QH9 A;  1JEK A;  2IZ1 A;  1HTL C;  3CX5 H;  3TGU E;  2KS1 B;  5BU5 A;  4A7P A;  2OYH A;  1A02 F;  1KIL D;  2XNX A;  1H89 A;  2Y9Y A;  1NKN A;  2HOD A;  1MFT A;  2XV5 A;  2YXR B;  3L71 J;  2B9B A;  2W90 A;  1LTJ C;  1SQX D;  2WU5 D;  4MN4 C;  4D6T E;  1QVG O;  3V6I A;  2HPC B;  1YIJ P;  4LC1 A;  1SQV E;  3CD6 P;  3CCS P;  2PFX A;  1GD2 E;  2G8Y A;  2YO3 A;  1KIL A;  2M5A A;  1BGY E;  1NGM B;  2AXT H;  1HGV A;  4WY4 D;  3L75 E;  1KF6 D;  3HE4 B;  1NTZ E;  1FC2 C;  2N1T A;  3C9I A;  2IDB A;  2B76 C;  1MUU A;  2FXM A;  1RF1 C;  1KOR A;  1M57 D;  2WDR C;  1K9M Q;  2L5G B;  3TSI A;  3RK3 D;  2WDV D;  1LWU A;  1GL2 B;  3K5B A;  4DHI B;  5KJ7 A;  5CCG D;  1SS1 A;  3S9O A;  4DHZ A;  2E76 D;  2QJK C;  2N9Y B;  1YQ3 C;  2Y0E A;  2WMM A;  4EIJ A;  1GU5 A;  4YSZ D;  1PGP A;  1VL2 A;  4ZNC A;  1FE6 A;  1KYO E;  1SLQ A;  2G3A A;  1KB9 E;  5CCG A;  2PRR A;  3AED C;  3T97 A;  2KB7 P;  1NEK D;  1MZ9 A;  1QL2 A;  3GMA A;  3B71 A;  3MGN A;  1FZB A;  2YIU C;  3KYQ A;  2QSI A;  3A5T A;  3GHG B;  2Q5U A;  5B5E H;  1RE3 A;  3AEF D;  2FFD B;  2ZT9 B;  1URQ C;  1GDT A;  2KS1 A;  2H88 C;  3KZI E;  1NH4 A;  5BU8 B;  5APS A;  1E7P C;  1LTG C;  2P10 A;  4EOT A;  1PV3 A;  3TK1 A;  5AW6 B;  4HJG H;  5AVQ B;  4I7Z B;  3NFQ A;  3L73 G;  2HPC A;  2JR8 A;  1T8Z A;  4OVN F;  3M0D A;  1JTH B;  1SQX J;  3LW5 J;  3CWB E;  2Y0D A;  3AE5 D;  1JB0 J;  3F89 A;  1N7S D;  5AVY B;  1J2J B;  4RKU J;  4DZO A;  1IFJ A;  1HJB A;  2YXQ B;  2ACZ C;  1HH0 A;  1JY2 N;  1LNQ A;  5KLV E;  3AEB C;  1N73 B;  2IYP A;  3HD7 D;  1W5C E;  1HF9 A;  3RK2 C;  3H1J J;  2OYO A;  4UB6 E;  2GM4 A;  4RO0 A;  5GTH E;  2QIW A;  3L72 G;  3L73 D;  1QLE D;  3H32 A;  3P4S D;  5KAF E;  4DOJ A;  1VQP P;  4JPZ B;  1NO4 A;  1HWT C;  1GL2 A;  2BS2 C;  2KZI A;  1NTK K;  1JNM A;  1AJY A;  3HD7 A;  3SFE C;  3AE2 C;  4YSX C;  3H1H E;  3TNU B;  3U59 A;  2Q1K A;  5AW7 B;  3H25 A;  5L8R J;  1GU4 A;  3H1I E;  1ZOY D;  4HB1 A;  3VRA D;  5AVV B;  4WB4 A;  3Q5S A;  3JC2 2;  5CCH C;  3KQG A;  2LR2 A;  3L72 D;  3RL0 B;  4YT0 D;  1OW7 A;  1VQK P;  1XTC C;  2E5T A;  3U1A A;  2FYU K;  1ZW0 A;  2A45 H;  1ZN5 A;  3GG2 A;  2P7J A;  1OW6 A;  1M7L A;  3D6Z A;  2WS3 C;  2WU2 C;  1KYO H;  2IFN A;  1LT9 B;  3SWF A;  1KB9 H;  3AE6 D;  3RBZ A;  3V4W A;  1J1E B;  4D6T G;  3CXH E;  3CMA P;  2KLV A;  2XZR A;  2BAS A;  1SQV G;  1IFP A;  2KSJ A;  3KZI H;  1WMK A;  3PTZ A;  3TGU D;  1NOH A;  3I55 P;  1NAF A;  1SVF A;  4IFF A;  1LTA C;  2I1K A;  3Q5R A;  3L75 G;  4YTP C;  1IK7 A;  1JY3 N;  2H43 A;  2Y0C A;  1X22 A;  1NTZ G;  1KFY C;  4OWF A;  3W68 A;  1OFC X;  4D6T D;  4IL6 E;  4C7R A;  5APY A;  2OTJ P;  3I5C A;  1S5L H;  1SQV D;  2O01 H;  3B8E B;  2AEM A;  2NPS D;  3G9R A;  1KMI Z;  4H13 D;  2FYU E;  1BCC E;  2P1J A;  1X0T A;  5AVX B;  1PGO A;  3C1L A;  3L75 D;  5GTI H;  3P8C E;  4UB6 H;  1FU1 A;  1NTZ D;  1KQG B;  4YTM C;  5KAF H;  1PZQ A;  4UB8 E;  3S4R A;  1PFI A;  3TNU A;  2OTK E;  2R32 A;  3CL3 D;  3MD0 A;  2UWJ E;  2CPS A;  1IFN A;  3JSV C;  3H6P A;  4K35 A;  1SFC C;  2CK3 H;  3VMA A;  2Q9I A;  1LTJ B;  3L72 J;  2E75 C;  1E5W A;  3V2P A;  2D2C C;  3ABV D;  1OZH A;  1L4A C;  1USE A;  1KYO I;  1RQV A;  1KB9 I;  1LT9 A;  1ZME C;  3U1C A;  1KYO D;  1KB9 D;  2WPR A;  4JYC A;  3MIW A;  2MKV A;  1SQB E;  1YQ4 C;  2ZYA A;  5C2T D;  4ZKP A;  4OGQ D;  3CWB G;  5AVS B;  2WSS H;  1Q81 Q;  1SQQ K;  1KQL A;  3CXH H;  4H0L C;  1RF1 B;  2IBZ E;  1L0N E;  5AW4 B;  1G2C B;  2OYI C;  3CC2 P;  1S4X A;  2DW3 A;  5CMZ A;  1LT1 A;  3TF5 A;  5C3J D;  1LTS C;  2W8Z A;  3B5N D;  2ZXE B;  2NRG A;  2QJK B;  3OW2 O;  1SP4 A;  4KX6 C;  1Q2N A;  2E42 A;  2ITA A;  2YKP A;  4D6T J;  3CWB D;  4L73 A;  4IL6 H;  5AW9 B;  3JCU E;  1RE4 C;  1VQ5 P;  1QVF O;  2FBW C;  2ZXX A;  5KLV D;  4WVZ A;  3H1H G;  4PV1 C;  2IFM A;  3AE9 D;  3H1I G;  1NJI Q;  2K88 A;  1T2K C;  1AV1 A;  3B5N A;  1RQU A;  1GZL A;  1YIT P;  3L75 J;  4ASV A;  3AE8 D;  1BE3 E;  2YIU B;  1FJP A;  1NTZ J;  1NU1 K;  1URQ B;  1SQP K;  2W27 A;  1DEE G;  3FX0 A;  2KP8 A;  3C8V A;  2ZVO B;  2YMK A;  3FXD A;  1PPJ G;  3VP9 A;  2WPS A;  2KSE A;  3H1H D;  3TYY A;  4EI2 A;  4IL6 X;  2KZJ A;  3H1I D;  2QM8 A;  2B76 D;  2RMZ A;  3PHL A;  3VR9 C;  1RH5 B;  2R3C A;  3A7O A;  3KPE A;  4NPD A;  1PP9 E;  2WSC H;  2WPQ A;  4RJT A;  4XE5 B;  1YHQ P;  2WQY C;  3MUD C;  2QEX P;  2P2U A;  3VRB D;  3TDK A;  2W83 C;  2BCC E;  3RK2 B;  1PPJ D;  5TJH A;  1QLB C;  2QJP C;  5KKZ C;  3CXH I;  2GA1 A;  3BAS A;  1L0L K;  1YJ9 P;  1RF1 A;  4DT0 A;  4GIF A;  1AVY A;  1A02 J;  3VMZ A;  2E74 D;  3CXH D;  3QWO C;  2N9B A;  1FZC C;  3MP7 B;  1G2C A;  1EDJ A;  3PH0 A;  3P4R D;  1JY2 P;  2K37 A;  1KFM A;  3PP5 A;  1DD4 A;  2N1T D;  3HUS C;  2JEE A;  4B86 A;  1OVV A;  1BCC G;  3BAT A;  1NTM K;  2MJZ A;  3Q2Y A;  3R4Y A;  2WT7 B;  3SWK A;  3AE4 D;  3BVH A;  5KJ7 D;  4YXW H;  2WP9 D;  3P4Q D;  1DX7 A;  3A0B E;  3WUT A;  4DCK A;  5APU A;  4QMA A;  3JCU H;  2O3J A;  3A3Y B;  1BCC D;  2KLU A;  2Z5I A;  4YTN D;  4AUW A;  2K9J B;  2LXC B;  4DDI A;  1S2E A;  2H89 C;  3SWY A;  2OYH C;  1CSB A;  1N86 A;  3PJS K;  2OQQ A;  4IOI H;  1Q86 Q;  1DD3 A;  1EDI A;  3H1K E;  3AE3 C;  4LLH A;  3V2N A;  2WZ7 A;  1GW3 A;  2NZ2 A;  4U7J A;  5APW A;  1SQB G;  3H1H J;  3D6Y A;  1H8A A;  2QG4 A;  2IX7 C;  1NTM E;  4DDG A;  3L70 G;  2Z4E A;  2O1J A;  1BSN A;  1L0N G;  1IFD A;  5APQ A;  3CX5 I;  2HR3 A;  3KDP B;  1KN7 A;  2WU5 C;  1T3J A;  2FYN C;  3CX5 D;  2YKQ A;  2V7Q H;  4W7Y A;  2B88 A;  1JY3 P;  1VF5 C;  5CCH D;  1SQB D;  3CCR P;  4PD4 H;  1ZLL A;  5AW1 B;  1LWU C;  3M0A A;  3CC7 P;  1MFZ A;  3L71 E;  2GUV A;  1QEX A;  4WY4 C;  1R8E A;  3MZW B;  3GW6 A;  2J59 M;  1KF6 C;  1CW5 A;  3L70 D;  2YNY A;  1L0N D;  4DJG A;  2WT7 A;  1M1K Q;  2KXP B;  4C7N B;  1S5L E;  2VRS A;  1PIX A;  4WBA A;  1GL2 D;  1LP1 B;  1M56 D;  5CCH A;  1BDD A;  4YXD D;  1NWQ A;  1BE3 G;  3HE4 A;  2R5B A;  3P8M C;  2WDV C;  2ZVN B;  5GTI E;  1SFC B;  5CCG C;  4LGD E;  2FY8 A;  1N2D C;  2E75 B;  2E76 C;  2OTL P;  2E5Y A;  2D2C B;  2WSE H;  1L4A B;  3MTU E;  3A0B H;  4M3L A;  1OXZ A;  2K9J A;  4HYT B;  1JO5 A;  3CCU P;  1FBM A;  4YSZ C;  1BCC J;  1XTG B;  1N7L A;  1SQX K;  1BE3 D;  4YSY C;  2IZ0 A;  1PP9 G;  2OGU A;  3I56 P;  3SSU A;  2KI7 B;  2WTY A;  2ZT9 D;  5APX A;  1NEK C;  1KQS O;  1GMJ A;  1M1J C;  4H0L B;  1Q82 Q;  3P4P D;  2OAR A;  1NHL A;  3M0D C;  2BCC G;  3AEF C;  2OYI B;  1FDM A;  1YJN P;  2M0B A;  5CHX A;  3TGU G;  3EFF K;  4ZMD A;  4C46 A;  1EXI A;  3PRJ A;  1FZG A;  2J5U A;  2WSC J;  4H44 C;  3GHG A;  4W7Z A;  1GW4 A;  2C0W A;  4Y99 C;  3L74 E;  1Q7Y Q;  2FFD A;  2KNC B;  1PP9 D;  1U7M A;  3L35 A;  1KD1 Q;  1HJ0 A;  1VQN P;  5DJU B;  2JKV A;  3AE5 C;  2K3R A;  2BCC D;  1N7S C;  4PV1 B;  3SFD D;  2FXO A;  3CC4 P;  1SQB J;  3KXD A;  4JBZ A;  1QGK B;  1BGY G;  1IZN B;  2ZYG A;  3HD7 C;  3CCE P;  1S9K E;  1JTH A;  2JP3 A;  1NTK E;  3G3Z A;  3KHU A;  5AW2 B;  1K8A Q;  4YPC A;  4C7N A;  1SQX E;  3L36 A;  4JYB A;  2XKM A;  3L70 J;  1Y9B A;  1LP1 A;  2AXC A;  1L0N J;  3P4S C;  1ZV8 A;  1N73 A;  3O6Q B;  1ZP0 D;  1K04 A;  1SFC A;  2RKL A;  1Q90 D;  4R4M A;  3H1J E;  4LDT A;  3AEE C;  1FZE A;  1BGY D;  4JQ0 D;  3RL0 D;  3FWN A;  1ZOY C;  3VRA C;  3L73 J;  3H1K G;  2A45 G;  4GOE A;  4U3F E;  1NAY A;  4YT0 C;  3AEC D;  1L0V D;  1J1D C;  2P58 A;  2I1J A;  1TU3 F;  1PGJ A;  1Z56 A;  3O8Z A;  2QJP B;  5KKZ B;  3CIR D;  1BE3 J;  2WPV B;  3N4X A;  2W6J H;  1S5L X;  3AE6 C;  3E1R A;  3VR8 D;  3EFG A;  1FZC B;  1YBK A;  2A45 I;  1RF0 A;  2BEZ F;  3H1K D;  3MHV A;  1NEN D;  3HUS B;  3HTK B;  1BDC A;  2ZYD A;  1KQF B;  1H0T B; 
#chains in the Genus database with same CATH homology
 3P4Q C;  1AJY A;  1VF5 B;  3SFE C;  2WS3 D;  2OQQ A;  3AE2 C;  3CIR C;  2E75 B;  2E76 C;  2JP3 A;  3G9R A;  2FBW D;  2WU2 D;  4YSX C;  2D2C B;  1KMI Z;  2WQY C;  3AED C;  1DD3 A;  4H13 D;  3AE1 D;  1NEK D;  2E74 B;  5L8R J;  3GMA A;  3B71 A;  4H44 D;  3H25 A;  3VRB D;  3AE3 C;  3VR8 C;  3D71 A;  4PV1 D;  2YIU C;  1ZOY D;  2WU5 D;  3VRA D;  1NYH A;  2QSI A;  3Q1M A;  4H44 B;  1Y9B A;  2WDR D;  5C3J D;  3P4S C;  3Q5S A;  3FGA D;  2NZ2 A;  3AEF D;  4U7J A;  2ZT9 B;  3AEG D;  5C2T C;  4YT0 D;  2G3A A;  3D6Y A;  1OW7 A;  2H88 C;  3IN6 A;  1KIL E;  2V7Q J;  2QJP C;  1MKM A;  1KQG B;  4OGQ C;  4XFJ A;  5M1B A;  1NEN C;  4Y28 J;  5KKZ C;  2BS4 C;  3AE7 D;  3SFD C;  4KX6 C;  4YSZ C;  2E75 D;  1UIX A;  5KLI C;  4YXD C;  1ZP0 D;  2D2C D;  3GF7 A;  1K04 A;  3AEA D;  4YTM C;  1OW8 A;  4GDO A;  2G8Y A;  1E7P C;  2E74 D;  1Q90 D;  3GF3 A;  2ACZ D;  4R4M A;  1DIP A;  2P10 A;  3AEB D;  1PV3 A;  4YSY C;  1KTM A;  1OW6 A;  3D6Z A;  3AEE C;  2WS3 C;  1ZRT E;  3Q5P A;  1NGM B;  3P4R D;  2FBW C;  1U57 A;  2BS3 C;  2WU2 C;  1OMI A;  2JO1 A;  2ZT9 D;  4H13 C;  3AE1 C;  1KF6 D;  1NEK C;  4I7Z B;  1GMJ A;  1DD4 A;  3AE6 D;  3VRB C;  4H0L B;  4YTP D;  4PV1 C;  3P4P D;  1ZOY C;  1YQ3 D;  2WU5 C;  3VRA C;  2WDQ D;  2FYN C;  3AE9 D;  3Q2Y A;  3R4Y A;  3D70 A;  5C3J C;  2E76 B;  1KFY D;  2B76 C;  2IDB A;  3AEF C;  1YQ4 D;  1QLB C;  3LW5 J;  1RQU A;  3AEG C;  1KOR A;  3AE5 D;  4YT0 C;  1JB0 J;  2WDR C;  3AEC D;  1VF5 C;  1L0V D;  4KT0 J;  3AE8 D;  3GLM A;  3IAO A;  3AE7 C;  3AE4 D;  2E75 C;  1ZP0 C;  2D2C C;  3AEA C;  2H89 D;  3VR9 D;  1EXI A;  4RKU J;  1TU3 F;  3ABV D;  2E74 C;  2ACZ C;  2WP9 D;  3P4Q D;  2WDV D;  4H0L D;  1RQV A;  3AEB C;  2J5U A;  1WMK A;  4OGQ B;  3S9O A;  1S1C X;  2K9Y A;  2WSC J;  4H44 C;  3C8V A;  3SFE D;  1ZME C;  3P4R C;  3AE2 D;  1HF9 A;  2E76 D;  3CIR D;  1R8E A;  4YTN C;  4YSX D;  3EWK A;  2WPV B;  4Z1M H;  2WQY D;  2ZT9 C;  2QJK C;  3AED D;  1KF6 C;  4TT3 H;  4YSY D;  2YMK A;  1S5L X;  3RL0 g;  3AE6 C;  2WSE J;  3O6Q A;  3AEE D;  3Q5R A;  3AE3 D;  4YTP C;  3VR8 D;  3P4P C;  1YQ3 C;  1HJ0 A;  3T97 B;  2WDQ C;  1IK7 A;  3AE9 C;  2MKV A;  2QIW A;  1FDI A;  1PIX A;  4IL6 X;  1KFY C;  3P4S D;  1K05 A;  1YQ4 C;  1FDO A;  2BEZ F;  2WSF J;  4H13 B;  3Q3D A;  2WDV C;  3AE5 C;  5C2T D;  3RK3 E;  3AEC C;  1EXJ A;  4YTN D;  4OGQ D;  2BEQ D;  1L0V C;  1NEN D;  2H88 D;  3AE8 C;  4KX6 D;  4PV1 B;  2B76 D;  4YSZ D;  3AE4 C;  1VL2 A;  3SFD D;  1PL5 A;  4YXD D;  2H89 C;  4YTM D;  2FXP A;  3VR9 C;  3ABV C;  1VF5 D;  4R4L A;  4I7Z C;  1KQF B;  2QJY C;  2WP9 C;  2BS2 C;  2O01 J;  4H0L C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...