4DHJA

The structure of a ceotub1 ubiquitin aldehyde ubc13~ub complex
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
248
structure length
248
Chain Sequence
DQQLKTIEDEQKSVPLVATLAPFSILCAEYDNETSAAFLSKATELSEVYGEIRYIRGDGNCFYRAILVGLIEIMLKDRARLEKFIASSRDWTRTLVELGFPDWTCTDFCDFFIEFLEKIHSGVHTEEAVYTILNDDGSANYILMFFRLITSAFLKQNSEEYAPFIDEGMTVAQYCEQEIEPMWKDADHLAINSLIKAAGTRVRIEYMDRTAAPNGGWHYDIPSDDQQIAPEITLLYRPGHYDVIYKKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The mechanism of OTUB1-mediated inhibition of ubiquitination.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Hydrolase/signaling protein/ligase
molecule keywords Ubiquitin thioesterase otubain-like
total genus 90
structure length 248
sequence length 248
chains with identical sequence E, I, L
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2012-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10275 Peptidase_C65 Peptidase C65 Otubain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1300.20 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases 3 helical TM bundles of succinate and fumarate reductases 4dhjA02
3.30.200.60 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4dhjA01
3VONA 1TFFA 4DHIB 4DHZA 4DHJA 4DDIA 4DDGA 4LDTA 2ZFYA 4I6LA 4FJVA
chains in the Genus database with same CATH superfamily
2ZV9A 3EQHA 2H88D 3EOCA 4FV1A 5BUEA 5E8WA 4UWCA 3P78A 2JFMA 3BHHA 3UDSA 4PV0A 1FVVA 3BI6A 4EH4A 2BRNA 3CGOA 4HNFA 1XH4A 1XBAA 4JDIA 2CNUA 2BILB 3R1SA 2XP2A 4O0WA 3PIYA 4QMVA 3AXWA 4A9YA 2XBAA 4UYNA 1PMEA 1YI4A 4WKQA 3C50A 1KOAA 2ITUA 4GG7A 4L44A 3IOKA 5DYJA 2JKQA 4ORKA 3TKUA 2QOCA 4TWPA 4FL2A 4M3QA 1YWRA 2HW6A 3EKNA 1GY3A 5L8KA 3DNEA 3QXPA 4ZZNA 2PE0A 4QPAA 4Q2AA 1OBDA 3KIOC 4KBAA 3BX5A 5IEXA 2Z7LA 5KZIA 3ZO4A 2C69A 3ZSIA 5A46A 4ASXA 3R7YA 1KOBA 2KULA 4GG5A 4YHFA 4BDIA 3R1QA 2EXCX 2ESMA 1UVRA 4FZ7A 1BKXA 2PUIA 2UW3A 4MVFA 3GCUA 1W83A 3FY2A 1IAHA 5CX9A 3CPBA 3FXZA 3T8OA 4KX6C 4X21A 4F6UA 2VO7A 4ZXTA 2C0OA 5EI6A 4JJRA 4OGRA 5L6PA 3SRVB 4FMQA 4MWHA 2XYNA 4P5QA 3VUKA 3W8LA 2CKOA 3BPRA 3FZSA 3PVBA 4PP7A 2CKQA 3NDMA 3QGWA 5IQIA 4PDOA 1WBTA 4ZMFA 4J97A 5EDRA 3A99A 3QTSA 4CTBA 2ITQA 3KB7A 1ZRZA 4AGWA 2WQNA 4ANLA 2WTJA 5A4LA 4QMLA 3IDCA 1CTPE 4IX5A 4Y5QA 3ZLSA 2ZAZA 4EWQA 4FE2A 4IWDA 4QP6A 4QTDA 3KRWA 3UIUA 2WFYA 3V51A 3P4SC 3FDNA 3LCOA 1Y91A 3UVPA 1H01A 2XNGA 4QP3A 5EH0A 5GJFA 4AXDA 2VTQA 1ZARA 2ZMDA 3L8XA 2ONLC 3L9PA 2VAGA 3KXNA 4LMUA 1E9HA 4F9YA 4PMMA 2GHLA 1KF6D 2YEXA 3BE2A 4G6NA 4TWNA 3LXNA 4IVCA 5EHLA 4AFJA 4FYOA 2YM5A 4RZVA 3FMKA 3GXLA 4A06A 4C4GA 5IQFA 1QMZA 3G9NA 3W2PA 4EL9A 5K4JA 3UQCA 4WT6A 4HPUE 1NW1A 2CGXA 4WOVA 4FVPA 2OI4X 4LV7A 2GS7A 5EKOA 4AXCA 5AUUA 1H4LA 4MF1A 4UX9A 2PVRA 2ITZA 3MIYA 4YJOA 2J6MA 5C01A 4YJPA 3FYKX 3ZSHA 3EN4A 3KXMA 4IBMA 3KU2A 4O86A 5D41A 5KMOA 4FIFA 1PMUA 4BDCA 1G8KA 5IH6A 5IA1A 4DDIA 3I5NA 3V01A 3JY0A 3LCDA 4ID7A 4PY1A 3PRIA 4RFZA 2QOKA 4QEBA 2G9XA 3GP0A 4CG9A 5HLWA 1YXSA 4HVSA 3QXOA 3S0OA 4L8MA 3VBTA 1ZOYC 4EHEA 4J8MA 3F5UA 2J9MA 1JKSA 4G9RA 4ZJJA 3REPA 2PZRA 3R9RA 5LVPA 3TEIA 4OTFA 2ZB1A 2XJ0A 3BKBA 4D4RA 4AWIA 4YC3A 1ZOEA 3QYWA 1OUKA 1QPJA 4R1VA 5AUTA 1MP8A 3LOKA 4F7LA 5EQYA 3UNJA 1VJYA 3ENHA 3DB6A 4P7EA 2PE2A 2WTDA 5FGKA 1OPLA 3RM6A 5H9BA 4B9DA 3QHRA 3WZKA 5E7RA 3R7EA 5I4NA 2QLUA 4I4FA 4HVDA 4S30A 5DR2A 3MPTA 3CP9A 3O2MA 3MV5A 4RIWB 3TNWA 1XH9A 3DK6A 4ACHA 5AV0A 4ENXA 2PUNA 4HCVA 4ASDA 2UZWE 2VNYA 1URWA 4GUEA 2F2CB 4O83A 4KUJA 1NEND 4IX6A 2XNPA 4C4JA 3I0OA 5EW3A 4O0YA 3THBA 4JMQA 1JSTA 3F2NA 3CCNA 3AGLA 3MVJA 4IAFA 4IIRA 5C4LA 3MA6A 2R7IA 1YXVA 3LJ1A 2F7XE 3KULA 4YGAA 1NVRA 4JOAA 4E1ZA 5HCYA 2VTPA 4G5JA 4GYGA 4GSBA 4L7SA 3TNPC 4ZTQA 3KXZA 5E9EA 5BUIA 4UV0A 1P2AA 3KN5A 3PJ1A 3ZM9A 4FVRA 5D10A 3KK8A 3DFCB 3DPKA 2W4OA 2ZDUA 4RIOA 3O5AA 2X7OA 3CY2A 1YHVA 3AEAD 1M2PA 2PULA 5EYCA 3K54A 4UYAA 4ZY5A 4ZTLA 2VTIA 4NT4A 4EK3A 2E9PA 4YTMC 3F69A 4RJ3A 3TTJA 4RPVA 3BELA 5CQWA 3BL9A 3Q60A 4Y72A 4PDSA 4JBQA 2WOTA 3I5ZA 4JG6A 5CVHA 3ZZWA 4AQKA 4JNWA 3IW6A 2HW7A 2XNBA 2GFCA 3CXWA 4YTPC 3VRBC 1AGWA 4BCGA 1XR1A 2PVMA 3FWQA 3TUCA 3LQ8A 4CSVA 5M56A 4B0GA 2YA9A 2ZB0A 4FV2A 3UP7A 4E5BA 2X2LA 4Y83A 1O9UA 1BL7A 3P4KA 4C59A 2C30A 4JBVA 2NRUA 5D7AA 3ZMMA 3R0TA 3E62A 4Y46A 1H8FA 2Y9QA 5C8NA 3AEDC 1ZOHA 3EQPA 3N4TA 2VO3A 2WTCA 1PW2A 2BAJA 2FBWD 3FUPA 3VF9A 5CEOA 4ANQA 3ZUTA 4V05A 1WBOA 4G17A 4HGEA 3L9MA 4OW8A 3S00A 2W9FB 2JC6A 5IU2A 2WMXA 3R8LA 2OXDA 3P4QC 2OG8A 3C0IA 4CLJA 5FTGA 1YXTA 4BI2A 4FNZA 5EDPA 3OC1A 3TKHA 4ANSA 5KX8A 2F9GA 5E1SA 3QYZA 4WD5A 5JFXA 4YHTA 4XH6A 1KF6C 5M55A 3UMWA 1OM1A 4XLIA 4I41A 5GIOE 1APME 2WQYC 1WCCA 1Q99A 2VTAA 3E8CA 1KV2A 4H05A 1PJKA 4IQ6A 1OI9A 1U46A 3A62A 2UZDA 4EH5A 2Q0NA 2W1EA 4IM2A 4YJTA 4G6LA 4C38A 4G3GA 3OCTA 4U80A 5AUVA 3SHEA 4AZWA 4O7LA 4BRXA 4E6CA 3G6HA 4H36A 4MH7A 2C6DA 3R8ZA 3FJQE 4GIHA 4NJ3A 4NW6A 4OTRA 3SGCA 3QKMA 2OIBA 1M2RA 4L43A 5GHVA 1H0WA 4EOIA 5JK3A 4MBIA 2BZHB 1FGIA 4YZBA 3MESA 4HYUA 3LXKA 5AV2A 3O8TA 3A7GA 3VQHA 3V3VA 1PXMA 2VWZA 5A6OA 5BPYA 3KRXA 2YITA 4CFMA 4WNOA 4C4EA 1KSWA 4NTTA 3KULB 2X8DA 3P4PD 3A7JA 2GNHA 3IKAA 1BX6A 2W5HA 4CLIA 3H0ZA 5K5NA 3AE1C 5B2KA 3DB8A 1UNLA 5C26A 1RQQA 2WGJA 4W8DA 1DAYA 3PVGA 2W0JA 2BMCA 2QKRA 2CMWA 3DK3A 3DLSA 4J7BA 4J52A 3VULA 4UBAA 4UZHA 2Y4IC 1F5QA 1EH4A 2GNGA 2PVLA 2YM4A 5DT4A 4I0RA 2QLQA 5E8YA 4DFNA 4F9CA 2W1HA 4CRSA 5JGDA 2OWBA 4CFVA 2YWPA 4O6LA 3I1AA 5AP2A 5KMMA 3MJ1A 3PZHA 2GDOA 1H00A 2B1PA 4CVAA 5K3YA 4GT3A 4D0WA 3D5UA 3VS4A 4YP8A 4EK8A 3BL7A 3NEWA 3V6RA 3JXWA 3QF9A 4U81A 3UVRA 3ZEWA 1H28A 3NYOA 3OWLA 5F9EA 2VTNA 2B9HA 1UNGA 3HMNA 4O7WA 5AIRA 4JDJA 2GSFA 3PY1A 3BHUA 3QQGA 4MCVA 2YISA 5AWMA 3QCXA 4P2KA 4KNBA 2VTOA 5KCVA 4FJVA 1PXJA 3Q9YA 2UW5A 4WNKA 2OFUA 4N57A 4ZTHA 1DAWA 4I5CA 5ANJA 3R71A 5EW8A 2IW8A 1OKZA 3IONA 3KRRA 3BYVA 4AE9A 4I6QA 4GK3A 5DFPA 3VS5A 2GS2A 3R00A 5C3JC 3RCDA 4RVKA 4X2JA 3DBDA 4AZTA 1PMNA 4PMPA 1ND4A 3U4WA 1ZZLA 3DKCA 5LOHA 3GFWA 2EB2A 3HP2A 4CXAA 1OL7A 5DRDA 1MQ4A 3L8VA 3MY0A 5EYDA 4ALVA 1OECA 2XKDA 3PWYA 4EKLA 3BCEA 4O0TA 3EFJA 5AP4A 3OROA 3VJOA 2CCHA 3G90X 5J9LA 3Q9WA 1VYWA 4EONA 4IX3A 4ZK5A 4ZEGA 4MXAA 2IZTA 5LVNA 4R7HA 2WMVA 2WU6A 3UOKA 4JT3A 4O7NA 3V8TA 4OTWA 4JQEA 3BLAA 1URCA 1OIRA 3EFKA 4FKPA 1M2QA 1W98A 2ONLA 2J0MB 4LYNA 4DITA 3EQGA 4A4OA 5HHWA 2YAKA 3AE3D 2VWXA 3QWKA 4C61A 1W84A 4ZY6A 4FZFB 4KSQA 3PTGA 4EQUA 4GV1A 5I9XA 3IOPA 2WTKB 3LW0A 4FKGA 2B76D 3F3UA 2NO3A 2WKMA 4OTDA 2BUJA 5HKMA 3COKA 3QD0A 3NIEA 1SVEA 4I22A 4U97A 5I9UA 2ETKA 4DH1A 4B7TA 4MBLA 4GEOA 4DA5A 1H1RA 2A0CX 2ETRA 3W8QA 2V55A 5FD2A 3FZPA 4CKIA 3VR9C 3HV6A 3F2RA 3OWKA 4XCUA 3TJCA 3Q53A 3FQHA 2C0TA 4O2ZA 1UNHA 2WMSA 2F7ZE 1IAJA 3GC7A 4NKSA 4BCHA 4MXOA 5CAOA 4O27B 3NUAA 4CQEA 4FTTA 5FM3A 4DTBA 2HY81 4FUYA 3OXTA 1L8TA 3IW4A 2RFSA 3NCZA 4Z3VA 3C5IA 5T6KA 4C36A 4UEUA 3EQDA 3OCBA 1ZY4A 4FTNA 4AN9A 4FG9A 4LL5A 4DGMA 2GHGA 5CSVA 4YLKA 4BHZA 4CG8A 4ZLOA 1Q8TA 5AX9A 3O7LD 4GT5A 4YMJA 3KXHA 4TYIA 5KMLA 3HMOA 5A3XA 3RPYA 4FTCA 3AKJA 2OICA 2PMIA 4XP3A 3NUYA 4I6HA 4PDYA 4YJQA 2H9VA 3OBGA 4M67A 3S2PA 2ACZC 5CEPA 4M0ZA 3RP9A 4IJPA 1VZOA 4FK6A 3PVUA 4FTUA 2CKPA 3QCYA 2B54A 2YDIA 2FO0A 4I6BA 2VTRA 2JBOA 3NRMA 3AE2D 2W17A 4HCUA 4FG7A 4BGQA 4QPSA 5CXHA 4R77A 5DEYA 5ETFA 3WILA 1NVQA 2PZPA 5CNNA 3ZSGA 2XEYA 4O7SA 4FK3A 2ITNA 5H8EA 5AUZA 1ATPE 5FG8A 4AG8A 3FI3A 2WTWA 4BI1A 5ANOA 4EK4A 2BIKB 2XA4A 3Q04A 4HYSA 5AAGA 3BYUA 3BEGA 3OY1A 3FHIA 4R78A 1ZOYD 4YHJA 5HD7A 3BQRA 4ZMEA 4OTQA 3HVCA 3HV7A 4GS6A 3E8NA 2X9EA 4ALUA 2WOUA 2FUMA 5J5SA 2BS4C 3PJ3A 2YIXA 4QT1A 3DAKA 5KBQA 2ACZD 4EZ3A 2Y6MA 1KE8A 4NUSA 4RG0A 5DGZA 4Z55A 2XIKA 3ATTA 3BGZA 3DT1A 4MD8E 4FSTA 3SLSA 5A4TA 3EQIA 3ROYA 4FT9A 3GCQA 2C47A 4IEBA 3UC3A 5K9IA 1L0VC 2CKEA 3RAHA 2E9OA 4DBXA 3NSZA 4XYFA 3BHYA 3QQHA 4FV9A 2WZJA 4PRJA 3VQUA 5TF9A 3ZFXA 4BIBA 4C3FA 2E9NA 2VZ6A 4BCOA 4MKCA 5L6WL 4ZTMA 5J1WA 3WF6A 5FBOA 4YTNC 3RK5A 5DG5A 5GIPE 5H8BA 4QQTA 2OXXA 4AUAA 4XP2A 4FV8A 3F66A 3HGKA 4JX3A 4XV9A 4EHVA 1T46A 4F65A 1YQ4C 5BVOA 3SFEC 3VS6A 5KMIA 3BIZA 3ORKA 3LM5A 3OS3A 3FMEA 5EOLA 1RE8A 1ZYJA 3F6XA 3TZ8A 4MQ2A 1LR4A 2B9IA 2HENA 4GRBA 4JVGA 4ONAA 4QMOA 5CF4A 3FE3A 2IN6A 3CJGA 1JQHA 4IDVA 2A19B 2W1ZA 3LHJA 4AQCA 3W2CA 2R2PA 4WG3A 3ZRKA 1U54B 1G8SA 2I6LA 2JDVA 2BAKA 4IADA 2XEZA 3S4QA 3KRLA 3Q4TA 4QMNA 3M2WA 2JFLA 2BS2C 2CJMA 2OH4A 4DT8A 4C02A 4IW0A 4CFUA 4U44A 1H25A 5TO8A 2IZSA 2DYLA 5DR9A 3FSKA 2H89C 3MFTA 1LP4A 1A9UA 4JDHA 3LFFA 1CKIA 4DFLA 1HOWA 2P4IA 3U6HA 3PPJA 3VWAA 2XCKA 3A4PA 2QONA 4F0GA 1QPDA 5IISA 4BDKA 1W82A 4KA3A 4S34A 3A7FA 4A4XA 3U6JA 4FBXA 3OY3A 3PSDA 2V62A 1MQBA 2I40A 4GU6A 3JR1A 5AJQA 4ZP5A 2GS6A 3KA0A 3ULIA 3LQ5A 3UDBA 3UGCA 5B2LA 4AW5A 1M14A 3ZC6A 1B39A 5HE3A 2VWWA 3FZOA 4ASEA 4EZ5A 2ZYBA 3AC2A 4HGTA 2PE1A 4EOMA 3CTHA 4HZRA 4L3PA 1KE9A 2GTNA 4DCAA 3WI6A 4YSZC 3VR9D 4G3CA 4DG0E 2YFXA 3CKXA 3PY0A 3QC4A 3OOGA 3OG7A 1BUHA 2VTTA 4JLCA 1ZYCA 2R3FA 1TFFA 4RX7A 1JKKA 2C5VA 1BL6A 3MH2A 5E8VA 1GZ8A 5FDPA 3R2YA 3CQWA 2B9JA 2F4JA 3KF4A 3BYMA 3QGYA 3Q5IA 3RM7A 1YI3A 4AZVA 3DJ6A 3KVXA 4JDKA 3OUNB 3SW7A 2WDVD 3NW7A 1YQJA 3R1NA 4FOBA 4U5JA 3VNTA 3R01A 3QUPA 5HCZA 5M06A 2R3GA 4YSMA 3DJ7A 5AP1A 2G1TA 4X3JA 4FUXA 3DTWA 5LJJA 4BDBA 1OB3A 1Q62A 3TN8A 3RAIA 2PWLA 3RGFA 3DK7A 4QYGA 1MRVA 1BLXA 2R3LA 4DH7A 5JRSA 3QTZA 4BCMA 2IVVA 4A9SA 2BZKB 5AV1A 1I44A 2R5TA 5F20A 4XS2A 5AAFA 4YUQA 4J8NA 2X9FA 3E7VA 4D55A 3VAPA 2W1DA 3TM0A 5CZHA 2C1BA 2CGVA 1MRYA 3BWJA 1PXIA 4KWPA 4GL9A 2Q83A 3P4RC 2Z8CA 2FYSA 3FLSA 4F0FA 4D58A 3HZTA 1UU3A 4I94A 4K77A 3T3VA 2YCSA 3MPMA 1JPAA 2QI8A 3JVSA 2RKUA 3ZFMA 3MDYA 2XIYA 2YERA 3WIGA 3VS3A 3DA6A 3FMNA 2C6EA 3F3TA 3L9LA 2UW8A 5HESA 2Y0AA 4YC8A 3G15A 5HG5A 3ZTXA 3AD6A 2XIRA 1FPUA 1ZMWA 2CHLA 4UY9A 4D9UA 2W05A 3DBCA 5CEQA 3AC1A 4RWKA 4UB7A 5IEVA 4PMSA 4RIXA 3ZONA 3P0MA 4E4NA 2O0UA 3EL7A 4BCPA 3NLBA 4CEGA 2P0CA 3VO3A 5BVWA 2X2KA 4YT0C 3EZVA 4TYGA 5DOSA 5EQEA 3IPHA 4EOKA 5HU9A 4L00A 1OIUA 4B8MA 2QC6A 3ID6C 5JZNA 4FIJA 5IUHA 1Y8GA 2PYWA 4U9AA 3NUSA 4L67A 3U87A 1YRPA 2V7AA 3MVMA 5CAVA 3ZS5A 2AUHA 3MH1A 4E26A 3EYHA 3FLZA 4FZDB 3TL8A 4CTCA 5CAQA 3TDVA 4X0MA 4YTND 5I9ZA 2FBWC 4NM3A 3O71A 4G3FA 1Q61A 4NM5A 1Q24A 4QMZA 2G2HA 2X1NA 2XKCA 2E9UA 5EM5A 5AP5A 2CLXA 2J0JA 3G9LX 3TIZA 4YPDA 3T9TA 4O7ZA 5BYZA 2WDVC 4FKIA 3P7CA 2ITTA 3RMFA 4DEGA 4U3YA 4PUZA 2WDQC 4FTMA 4EEVA 5DEWA 4DTAA 3LFBA 4FNXA 4DGNA 2PMOX 2PUUA 3FQSA 4IVAA 2VWIA 3CKWA 3HMPA 1OKYA 3PXRA 3PLAE 4CT1A 3D0EA 4O0UA 4I1ZA 4CV8A 4IH8A 2WNTA 5K5XA 1NXKA 3UIXA 4FSZA 4Q9SA 3Q2JA 2BDWA 1JKTA 5H8GA 3WE8A 4DH3A 3ODZX 2Z7RA 4AXFA 3DXQA 3MFSA 4ZY4A 2H34A 3UPXA 3AG9A 2R3JA 1JKLA 4L42A 4RJ7A 1Q3WA 1U59A 3BYOA 3CY3A 3TTIA 3VBYA 4WG4A 1YDRE 4BCFA 3GVUA 2JKMA 1H1QA 3BHVA 4OT6A 4QP1A 3B2WA 3DKFA 4QYFA 5EI2A 1OMWA 5HE0A 1UKIA 4I23A 3S95A 3VRYA 5IH5A 2P3GX 4MD7E 3KQ7A 3DS6A 3QHWA 1UU8A 4O21A 4DHIB 3OBJA 4PNIA 5AADA 3ZBFA 3FEGA 3PJCA 1BI7A 5J8IA 2OIDA 4QMMA 5CU0A 3U9CA 4XX9A 4Z7HA 2SRCA 3D4QA 3G5DA 4NSTA 5J95A 2XH5A 4I20A 3EQFA 4MD9E 5IMXA 3RAKA 4BBFA 4AN3A 1VLRA 3QQUA 2ITWA 3WOWA 2QR8A 4GFGA 3BWFA 4CNHA 2BRBA 3TJDA 1W0XC 3C4FA 1H27A 2PMNX 3BE9A 4R5YA 1PXLA 3FBVA 4XBUA 5HNBA 5HVYA 3AEFC 2UVXA 4H39A 4ITJA 4USDA 3QCQA 2VX1A 1WMKA 2ETMA 2J0KA 3EMGA 2VTMA 3NYXA 2JDTA 3VRZA 5HTCA 4V0GB 1NEKC 5CEKA 4FSNA 4M12A 2JKOA 3R8UA 3AE5C 4BCIA 2EXMA 4DYMA 5IA4A 1Q41A 2NP8A 2OFVA 2NYAA 5D1JA 3UE4A 2OO8X 1XBCA 3DAEA 5HD4A 5EHOA 1R0PA 3SFED 3OZ6A 4ZLYA 2HY0A 3LZBA 4PQNA 5M44A 4O0VA 5HU3A 2FB8A 4XRJA 4M69B 4EOJA 3UG1A 4R7IA 4XOYA 2QNJA 4IB0A 4KAOA 1PF8A 3EN9A 4X2FA 3VRAC 2C6TA 4JL9A 4U79A 2XMYA 4IM0A 2B76C 2WMQA 2ERKA 3Q9ZA 3QRTA 3ZM4A 5J87A 4JS8A 2JEDA 4M14A 3DV3A 4FTLA 1YHSA 3W32A 4E5AX 4IB1A 4LRMA 5ETAA 1B38A 3AQVA 4E5WA 5F1ZA 1YWVA 1WFCA 4G31A 1J7UA 4O81A 2X7GA 2C6OA 3MFRA 2J4ZA 2Z02A 4WRGA 2FSTX 3KY2A 2R3KA 5AIKA 4LI5A 4IC8A 3AMYA 2CSNA 4C0TA 4NZWB 4EH3A 2UUEA 1A06A 5ANEA 1T45A 3G0FA 4ZJIA 2HWOA 3AEBC 4YJUA 5AP7A 2JDOA 3TWJA 2QVSE 3H9OA 5J7HA 3U54A 2UZVA 4WBOA 2BZJA 2V5QA 2Y6OA 5CQUA 3Q52A 2X81A 3PA5A 3O23A 5M4UA 4BKJA 3UQFA 4RIYA 3L1SA 3LM0A 3MBLA 2VTSA 4K9YA 4KBKA 4V0GA 3W0OA 4M15A 1WBNA 1XKKA 4N70A 3FI8A 3CC6A 3MTLA 1J91A 4F9AA 3BU6A 3QL8A 2WQYD 2UZNA 3CLYA 3RPSA 2WU5D 4L01A 3TZMA 3R8VA 1YQ3D 3CEKA 4GFOA 4MYGA 5AP0A 2YDKA 4CZTA 2ITVA 2XRUA 3HRFA 5BVEA 3NAXA 3SV0A 1Y6AA 1PKGA 3CD8A 3FXWA 3H3CA 4PL3A 3SW4A 1YHWA 2ZM3A 2QR7A 3DAJA 3ULZA 2IJMA 1WBPA 5ANDA 3UOHA 3VUHA 3WYXA 4FKUA 3RTPA 3W2QA 3LMIA 2WO6A 4JR3A 4FV0A 4C33A 2EVAA 3IDBA 3E3PA 3NNUA 2W06A 2X2MA 3UJGA 2VUWA 3A8XA 3C1XA 4EYJA 5A54A 1BI8A 3NUXA 5TOZA 1JVPP 3I60A 4TRLA 1PXKA 1XMLA 3DBFA 2IVTA 3DGKA 1ZY5A 3QZFA 5DI1A 4Q9ZA 3BU3A 2QG7A 4IZ7A 4J99A 3F5XA 3CGFA 4HYHA 2A4LA 3ENMA 3TUBA 5I9YA 5HG7A 3Q4UA 3R30A 3R73A 4DH8A 3KC3A 3CR0A 4FTIA 4YO6A 4BYIA 3PPZA 4A9UA 3LJ2A 2P2IA 4J95A 5CZIA 2EWAA 4MXZA 3D2IA 1V0BA 2GQRA 3ABVC 3R1YA 5T68A 4CV9A 5KMJA 3FL5A 3ROCA 4QTBA 3EWHA 4DHZA 2F49A 3MPAA 4NK9A 3ZOSA 3E3BX 3HP5A 1M17A 3R7VA 5KKRB 3VC4A 5M09A 5DPVA 4EQMA 4I5PA 2J0IA 3AMBA 4F99A 5FTOA 3AE6D 4EI4A 3GB2A 3TT0A 4EC8A 2HZ4A 3ET7A 4FA2A 3I6WA 1S9IA 4RVTA 2JIUA 2VTJA 3BEAA 4FV5A 4CMOA 3Q96A 4L3JA 3C13A 4U41A 4XJ0A 1YVJA 1OKWA 2W5BA 4AFEA 4UN0C 5BX0A 2BS3C 4BZOA 4O96A 5LMKA 1B6CB 5LMAA 4RLLA 3UDZA 4RMZA 5DNRA 2WMTA 2JIVA 3NAYA 2QODA 4WNPA 4H1MA 3RI1A 4O2PA 3LCTA 2X6EA 4FVQA 2I1MA 2V7OA 3AEBD 2BFXA 2HOGA 2OXYA 4LM5A 1OIQA 4YLLA 4FX3A 5C03A 4DFBA 5CNOA 5JKGA 3WF9A 1CMKE 1NT2A 4XP0A 3G0EA 4GK2A 4E4LA 2BRMA 4U45A 3QA0A 4FODA 3ATSA 1G8JA 3D7TA 4DFXE 5F94A 4QNAA 3WIKA 4FV3A 5FBNC 3O8UA 3CD3A 5CS6A 2WU7A 1TQIA 5AP3A 1JSUA 4W4YA 2PL0A 1OZ1A 3D94A 2I0HA 4HVGA 3ZXTA 1V0OA 3DBQA 3KL8A 2X8EA 1JBPE 4C2WA 1R1WA 2QO9A 3LLTA 3ZZEA 3FC2A 5CVGA 3QTQA 4YZCA 4MNFA 4AAAA 3SXFA 5I5ZA 1ZYLA 5IQEA 3WYYA 3UVQA 5JT2A 2QD9A 4B99A 4BI0A 1PXNA 3MSSA 4OBQA 3NS9A 1YWNA 4EYMA 2A27A 4YBKA 4O7TA 4WSYA 3ZO1A 5HO8A 4BJJB 2OF2A 3F61A 3W10A 3UPZA 1DI8A 3DDQA 4LUEA 5CEMA 3M1SA 2C4GA 2FA2A 2XRWA 4TYHA 2BRGA 1Q3DA 5ACBC 5HBHA 3PXQA 3AGMA 4FG8A 3QRJA 3E93A 3N9XA 5EQPA 3FL4A 1UU7A 3EB0A 4ZSGA 1OIYA 2OH0E 4KIPA 3TYKA 2GNLA 1FMOE 1XBBA 3OF0A 2X7FA 3NNWA 5AMNA 2C3KA 1PRYA 3H0YA 4PTCA 4D4SA 4DE4A 2C5XA 3ZO3A 4YZNA 5DH3A 2B9FA 3IGOA 1QPEA 4RGJA 3QTIA 4AW2A 3OWPA 3ZDUA 1RW8A 4KX6D 2C5OA 3UOLA 5I0BA 3QUEA 2A1AB 3GC8A 1Y8YA 2J51A 3TV7A 3TZ7A 5D9HA 2CNVA 2XK4A 3I7CA 3BGQA 4FTKA 4HZSA 3S1HA 4IZ5A 4WNMA 3P5KA 3VUIA 2VX0A 2IW9A 2YZAA 4FIEA 3PIZA 5EM7A 3U51A 3DJ5A 4XG6A 4M0YA 3IO7A 1E1VA 2ZM4A 3BHTA 4JXFA 1AQ1A 3B8RA 3JVRA 4FTOA 4IWPA 3SOCA 5E4HA 5HVJA 3WZJA 4AF3A 5CLPA 5JFWA 5CF8A 2YJSA 5FUTA 2XK7A 2BHEA 2X8IA 2XB7A 2VWUA 2J2IB 3OD6X 3POZA 5DT0A 2VNWA 4TWOA 3R9DA 3QUDA 3SX9A 3W55A 4AW1A 4R7BA 4TKSA 2WQBA 3AE8D 5BMSA 5F95A 5HE1A 5L6OA 5M08A 4L46A 4GK4A 1OL1A 1KE7A 5G1XA 3AE7D 5EM6A 4RBLA 5JN2A 2B4SB 2YDJA 4IHPA 5HBEA 3TG1A 2BRHA 2OBJA 5T3QA 4EHZA 5LVMA 3QLFA 4AA4A 3ORTA 3VJNA 2C5NA 1ZXEA 1KE6A 1ZYSA 2EUFB 4RT7A 4YTCA 5HQ0A 2C3IB 3B8QA 2FGIA 3FXXA 5DWRA 5L8LA 4ZZMA 2PMLX 3E64A 4FSMA 3GC0A 4M13A 3SA0A 3CQUA 2AEGA 2DUVA 2UVZA 4IANA 5AA9A 3NMUF 3EN5A 3P4RD 4FTRA 4NM7A 2ZJWA 3LFCA 3C4WA 5A4CA 2BALA 4GJ2A 3FKOA 1ZMVA 2ZOQA 3RWPA 1IA9A 3JUHA 3QU0A 3QWJA 4IC7A 1XO2B 2QCSA 3NYVA 3S3IA 1P4OA 3OW4A 4ERKA 3LLAA 2BR1A 4B6LA 2YN8A 3P7AA 3UQGA 1J3HA 2WIPA 2WP9C 4Y73A 4DG2E 3QD2B 2Y4PA 4FNWA 4O84A 2BKKA 4F78A 2VWBA 3FMLA 5IA0A 4IAAA 1Q8YA 1FQ1B 2BDJA 3CIKA 3HYHA 4Y85A 1GZKA 3D5WA 3H9FA 4LOQA 5ANGA 4NM0A 5CF6A 5ANKA 3CTQA 5IQBA 5CU3A 3DY7A 3NVMB 4WIHA 2WU2C 3I79A 3QQFA 4XRLA 4FSWA 3DCVA 3ZCLA 3MA3A 2XZSA 2EU9A 2XK8A 5HIDA 4HGLA 4RC4A 3TCPA 3T9IA 1SNXA 3RZBA 2J5EA 4LGHA 4TN6A 4ZSJA 3D9VA 4YJRA 3GCVA 4I6LA 2HZ0A 2VD5A 4YSYC 5IDPA 5LWMA 4G1WA 4O7VA 5E1EA 2YIQA 4JRVA 2FSMX 3ORZA 4C4IA 2ZV2A 3Q6WA 4DEDA 5JH6A 3NFFB 1UWHA 3RPVA 3SKCA 5IDNA 4KSPA 4TPTA 2OZAA 2XNNA 2QOQA 4WUAA 3R2BA 4W4XA 4YZ9A 5CEIA 3W0PA 2XNMA 3FLYA 2HZIA 2W4KA 2XBJA 2VTHA 1ZP0D 4QDEA 5BV3A 5CYIA 3GU4A 3WBLA 5JGBA 4YXDD 4TXCA 4WUNA 1L3RE 4NJDA 4HGSA 2XJ2A 1YKRA 2O63A 3C4ZA 4I4EA 2BIYA 3IW5A 2UZOA 1XMMA 4ANMA 1L0VD 5FP5A 1UWJA 4E4MA 3P79A 2UZBA 4AZEA 4AA5A 4CMTA 1OL5A 3C5UA 4FICA 4K33A 4QQJA 4ZTSA 4BYJA 4EOQA 3CJFA 4FNYA 4QMSA 5FLFA 4ACCA 3DZOA 4ZOGA 3TMOA 3LVPA 3KEXA 1XH7A 5M51A 4YTMD 5M07A 3SXSA 3IW8A 4FTJA 4DGOA 3P9JA 4APPA 3PA4A 1GIIA 3AEAC 4MWIA 2XIXA 4IAKA 1E1XA 4EOOA 5E8UA 3K3IA 4IAYA 4OUCA 4FT0A 1UA2A 2OJFE 4FL1A 3ABVD 4L68A 3SDJA 3HV3A 4IDTA 1Q8ZA 2R0UA 5C2TC 3Q2MA 2B55A 5EOBA 4OTGA 4IAZA 2XNEA 2ZVAA 4HOKA 4UZDA 3VRBD 4K2RA 3LCSA 2W99B 2Z7SA 2W5AA 5IQHA 3PXZA 4F6WA 3MFUA 2R3HA 3D2KA 3D83A 5KUPA 3TUDA 4C7TA 4H3QA 5CAUA 1H07A 3M11A 3IGGA 2CPKE 2VV9A 2XK3A 2IPXA 4GMYA 4EH7A 1WVXA 4K0YA 5B7VA 3EQBA 3NVKI 3KCKA 2PSQA 4YJVA 5KHXA 1NEKD 1H24A 5KHWA 3NW5A 4RWJA 4DFUA 2B52A 4K6ZA 3AE8C 2YM7A 3BLRA 4KKGA 3PXFA 2FVDA 2QG5A 2Y8OA 5KKRC 1J1BA 5LVLA 3SFDD 3SAYA 4AAYA 3AEGC 4F70A 5A6NA 4USEA 3CIRD 1X8BA 2X0GA 3MY1A 3MTFA 5AV3A 1H26A 4FKVA 2A2AA 3UC4A 3O17A 3R9NA 3R7UA 4OLIA 1GIJA 3EYGA 3ETAA 3L8SA 3IG7A 2XS0A 3HX4A 3LXLA 3Q32A 4QNYA 3OTUA 2XNOA 1FVRA 3A61A 4L3LA 4DEHA 5ACKA 2HXLA 1I09A 4E6AA 2HZNA 5CT0A 4EK5A 3VUMA 4DEEA 2H8HA 4UWBA 4ARKA 4APCA 2R3NA 4OT5A 1LEWA 3P08A 4J53A 3UNZA 4IFGA 1H1SA 5BMMA 5IH4A 2RG5A 3FI4A 3PZEA 5HZNA 3VS7A 5FEQA 4RIWA 5HICA 4FGBA 1YXXA 3F3VA 4F7SA 3DKGA 4BVUA 3V5TA 3PIXA 3FPMA 4GVAA 3LAUA 2ZV8A 3ZBXA 3LFAA 4NCTC 4EH2A 4BGHA 5IG1A 2UW9A 3AE4D 3ACKA 3VIDA 1SVGA 5KNJA 4UWYA 5HGIA 2GNFA 4CGAA 3AKLA 3MS9A 1RJBA 3KXXA 4JG7A 4F7NA 4P90A 5AUXA 4F6SA 2VGPA 1XH8A 5FTQA 5DLSA 3F5GA 4WG5A 3RJCA 3PG3A 4RJ5A 3WARA 4JAJA 3HAMA 3VHEA 1G3NA 2VWVA 3LMGA 3LFEA 4QQ5A 5E91A 5EW9A 3UIMA 3FLNC 2XVDA 4MEDA 2OZOA 3UOJA 4FKLA 1U5RA 2J7TA 2CDZA 5TT7A 1REJA 3GQLA 1YQ4D 3LE6A 3KK9A 3NX8A 3PP1A 4QQCA 3PJ2A 4U40A 4I21A 3HKOA 3TACA 4BR3A 4DDGA 4OR5A 3VR8D 4G6OA 3PLSA 3V8WA 4EBWA 4F9WA 3QA8A 3RPRA 2WS3D 1JLUE 1RDQE 3RNIA 3VS0A 3WZUA 3KN6A 4BDAA 3CSVA 5IQDA 2X39A 2R9SA 2PTKA 3GT8A 4PWNA 5FM2A 4AT5A 4J96A 3NYNA 5A4EA 1ZP0C 3FKLA 5KZ0A 3ZUVA 4AX8A 4RJ8A 2FH9A 4FSQA 4BHNA 4L7FA 5LXMA 2JAMA 2WTVA 3TNHA 3R6XA 4KB8A 5E8XA 1CM8A 4GKIA 2AYPA 2KTYA 3VW8A 5HVKA 3GC9A 1IRKA 2XYUA 4O0XA 4AE6A 4LG4A 1REKA 4IE9A 3EQRA 4X3FA 3OEZA 3FPQA 3DBEA 4IFCA 4GJ3A 1XQZA 5AA8A 3N4VA 5CTPA 5K4IA 2PHKA 5AP6A 1WVYA 2BHHA 3TV6A 5CU2A 1K9AA 1LPUA 3W2SA 4QTEA 2OJJA 4G5PA 5E92A 5BVKA 4IWOA 3AE5D 4AGDA 4AU8A 3UZTA 3WZDA 4LOPA 5HNIX 5DBXA 4MUQA 4Z16A 1H1PA 4I5HA 4U0IA 5IA2A 2YCQA 3AE3C 4N0SA 3EN7A 1U4DA 4DH5A 4GW8A 5JFSA 3KMMA 4YSXD 3F3ZA 4I0TA 2PVKA 2R64A 4FTQA 1WBWA 4L9IA 4YTPD 4X2KA 3EJ1A 3RHKA 3AE1D 3NZ0A 3ZLWA 4D5HA 4QMQA 2RF9A 3QTUA 4UXQA 5L2SA 4JIKA 3RK7A 3QCSA 4YU2A 4ITHA 5DA3A 5H2UA 4PP9A 3VBWA 2C6IA 4R3PA 3FY0A 3MIAA 5L8JA 1YDTE 4HNIA 1CSNA 4GH2A 4NCTA 4J71A 1V1KA 4OTIA 3VRAD 5IA3A 2UW4A 2XM9A 4NFMA 4PTGA 2GQSA 2W1IA 3C0GA 3HA8A 1ZZ2A 3NPCA 1OL2A 4FEVA 4MAOA 5AFVA 2WD1A 2WEIA 3JPVA 4XV2A 3NCGA 3SOAA 1HCKA 1JOWB 4M68A 3I7BA 1YDSE 4TYEA 5CSWA 4OBPA 2OJIA 3PPKA 3EHAA 4AGUA 5C9CA 4BDEA 4CCBA 4L52A 3COHA 1P5EA 3V5WA 1MUOA 3KF7A 3RVGA 4NYEA 5CXZA 2WELA 3OVVA 3MB6A 1NY3A 2JGZA 3CE3A 4AT4A 4QMYA 3ZFYA 3W16A 2C6LA 4FT5A 3UO4A 4EOLA 2ITOA 3R22A 1TQMA 3AEFD 4TYHB 4XG4A 3BQCA 4YTHA 5EG3A 4WRSA 2P2HA 3P1AA 3MVLA 4BY9E 1PKDA 4N4SA 3DQXA 3UO5A 2VU3A 5JRQA 5E8TA 4BJJA 1FGKA 1KUTA 1OL6A 4FC0A 4A4LA 4DGGA 2QQ7A 3HMIA 4FKOA 1YQ3C 2X6DA 4DFZE 2R3OA 3KRJA 3Q3BA 4ZSAA 5DN3A 4HJOA 3H30A 4K8AA 4MTAA 4O91A 4XEYA 2IW6A 1H0VA 3IS5A 5CENA 4RZWA 3KMUA 4BCNA 4HW7A 3NFGB 4BTFA 2YM6A 2WDRC 2YACA 2IVSA 3ZUUA 3GUBA 4EH9A 5CI7A 2JD5A 3LQ3A 3OCGA 3G6GA 3VBXA 3QBNA 5C27A 3QQKA 1A48A 3RAWA 4ASZA 3D5VA 2ERZE 3ORLA 2P33A 1PYXA 4TYJA 1MRUA 4U43A 4RVMA 4EWHA 3TDWA 2YWVA 4IB3A 3VHKA 3F5PA 3EQCA 5KMKA 4RVLA 4EORA 2W4JA 3OXIA 4FI1A 4QP7A 3HV5A 2WTIA 2IWIA 2OJ9A 2R3RA 4ZAUA 3QC9A 4IMYA 4D9TA 3QRUA 4C58A 2QOHA 2VTLA 2Q0BA 3FHRA 3I81A 4XG7A 3II5A 4XBRA 1Q4LA 4BBEA 4F1OA 5A9UA 3DTCA 5IUGA 1YOJA 1KFYD 4E73A 5AEPA 4I3ZA 1R39A 5M53A 2B0QA 1XJDA 4AOTA 3ZRLA 4D0XA 1OGUA 4X6QC 2F2UA 4QP2A 4W8EA 4Y95A 5M4CA 4K18A 4K1BA 1KV1A 4EBVA 3QZGA 1JWHA 3R8PA 1Y57A 3QRIA 4F64A 2XKFA 4FEXA 4YLJA 3OP5A 2R0IA 5CY3A 5L2WA 4YO4A 2OK1A 1M52A 3E63A 2J90A 3O51A 3UODA 3E92A 5EI8A 4O7RA 4M97A 2YCRA 4JBPA 4PF4A 2XK9A 2WTKC 4LV8A 2PVNA 1ZLTA 3GGFA 1FMKA 1DI9A 1U5QA 3GCPA 4DT9A 3GENA 2PU8A 3BU5A 3M42A 4AP7A 4XG3A 3F2AA 2O8YA 4IVDA 3Q6UA 2IVUA 4YZMA 5ETCA 2EB3A 5JQ5A 2YM3A 4ZS0A 3A2CA 1IASA 3AC5A 3R8MA 5LCJA 1G5SA 4YJNA 4YNEA 4D1ZA 5BVDA 3R7OA 3ZEPA 3UNKA 2W1CA 4NFNA 3ANQA 3KFAA 3MI9A 3I6UA 5CANA 5F4NA 2O2UA 4CT2A 5KO1A 2FSOX 2LGCA 3W0SA 2C6MA 2GTMA 4MBJA 4QP9A 4ZSEA 3SFDC 4A9TA 4E8AA 4QO9A 1F0QA 3TNIA 2CN5A 4O22A 4YSXC 2QO2A 3A60A 1GOLA 3IECA 3W0MA 4R6VA 2I0VA 4C3RA 2OLCA 1F3MC 5HLPA 3FSFA 5AUYA 4YR8A 2QKWB 3GEQA 1OPKA 4YSZD 3F88A 3VN9A 2RFNA 4AZSA 2JITA 2W7XA 1FVTA 3F82A 3UIBA 4EJNA 5IF1A 2CN8A 4LFIA 3VS2A 1BMKA 3AEEC 1UV5A 2AC3A 3C0HA 4JRNA 3DXNA 4BTKA 1OBGA 3AC8A 4H58A 2BPMA 2HELA 4JR7A 5CWZA 3H10A 4FEQA 4ZTRA 3GOPA 3IDPA 2F7EE 3K2LA 3I4BA 3MVHA 3R9OA 5GJGA 3ELJA 2WEVA 3AE4C 4QYEA 5DRBA 3O7LB 3D7TB 3V6SA 4CZUA 1Q8WA 4O0RA 4L53A 2ITPA 2WQOA 3P7BA 4WBBB 4LQMA 2BKZA 1FOTA 4MQ1A 3MWUA 2XALA 2GU8A 5GNKA 3BV2A 2OW3A 4QMTA 3H4JA 3P23A 2YZLA 3CQEA 5HCXA 1IA8A 3FAAA 3F9NA 3FMHA 3HAVA 4A7CA 4BCKA 5L2IA 2GFSA 2YM8A 3OMVA 4BC6A 4ZIMA 2RGPA 2OF4A 1O6LA 5EYKA 5AM7A 3ODYX 3BV3A 5DE2A 4EH8A 1SNUA 1YXUA 3D15A 3C4EA 3FMDA 4JAIA 4BTJA 3A7HA 4MXXA 5GJDA 2C68A 3VR8C 1W7HA 3L8PA 3JYAA 3ZLYA 1M7QA 1WBVA 2WMBA 3PJ8A 2O65A 4FT7A 3V04A 5CSHA 2CGUA 4JI9A 5FXRA 3C51A 4R3CA 2G2IA 4A9RA 4E6DA 4N6YA 2PVYA 2JIIA 3ML1A 3SG9A 1IR3A 3JY9A 2H6DA 3O50A 3R02A 4IZAA 4PTEA 3DKOA 2Z60A 5FEDA 3UDTA 5LVOA 2HK5A 2V22A 3QD3A 4J1RA 4DINA 2HAKA 4F09A 4U42A 4UXLA 4BBMA 3UYSA 3BGPA 3SRVA 4C4HA 5D7VA 5BYYA 4JQ8A 3E88A 1FINA 4AT3A 5FEEA 4QMPA 4DEIA 5C8MA 3NR9A 2WAJA 3GU8A 1J1CA 4ERWA 3AE2C 1QPCA 4FV7A 3NIZA 2G2FA 3VS1A 4G16A 2JDSA 3DNDA 4ITIA 2WMWA 3VW6A 3ZLXA 3ZRMA 2G01A 1GJOA 2QOLA 3NNXA 3UTOA 4FV6A 5JFVA 3AC4A 5C3JD 2UW6A 5IQGA 4FEWA 4BICA 2WU5C 3KXGA 4EJ7A 1STCE 4E93A 5HLNA 1IEPA 2V0DA 5AUWA 5JMSA 2BCJA 4OBOA 4D2RA 5C2TD 2JBPA 3NW6A 4NWMA 1JAMA 3QAME 2PVHA 4DBNA 2VWYA 5LMBA 1ZOGA 2WP9D 5HE2A 2BDFA 3P4SD 2PUPA 3QQJA 3KMWA 5HORA 1VR2A 2XUUA 4IZYA 2DS1A 5ICPA 4DCEA 4ZS4A 3G2FA 2JLDA 4TT7A 2WQEA 4NH1A 2BAQA 4PL5A 5DHJA 4CRLA 2PVFA 3FZRA 3W0RA 3Q4CA 4KRDA 5BVNA 2XK6A 2YABA 3AECD 3EN6A 5JZJA 1LUFA 4FYNA 3UZRA 2WHBA 4BF2A 5BYLA 1Q5KA 3RNYA 2UZLA 5CF5A 1DS5A 3KGAA 2XKEA 4F0IA 3AE9D 3BZ3A 5LCKA 5FP6A 4FSYA 3W33A 3POOA 4LRJA 4RFMA 4AXEA 1LEZA 4BCJA 3ZC5A 4PX6A 2WMAA 3MH3A 2RFDA 3IK3A 2QURA 4HVIA 4X2NA 5IQCA 4YPSA 3AOXA 3RWQA 4DEAA 1H1WA 4AGCA 5E90A 3UZPA 1WZYA 3O0GA 5IZFA 3MYGA 2Y4IB 4M7IA 4WO5A 1XHAA 3K3JA 5EKNA 4GVJA 3HEGA 4NKAA 2UW7A 5BQ0A 5CVFA 5HG9A 2VRXA 2C0IA 4O82A 4ACGA 2FSLX 2CGWA 3GOKA 4FV4A 4MNEA 4A07A 4BCQA 5J1VA 4IAIA 4ANBA 3LXPA 4G34A 4L45A 2DQ7X 4QP8A 2C3JA 3COMA 4QMXA 2QU6A 3PG1A 5DT3A 4DGLC 3FV8A 3ZU7A 2R3PA 3GNIB 1Q8UA 1NENC 3FMJA 4RJ4A 4XHKB 2OKRA 5LMKC 3A7IA 3O8PA 4E6QA 3VVHA 4FZ6A 4CFFA 4F08A 5A14A 5G6VA 4F4PA 4GU9A 2XARA 3GI3A 4DHJA 4QMWA 1K2PA 3AKKA 4FKTA 5FXQA 2XIZA 4EK6A 1OPJA 2C6KA 1YW2A 4FIGA 4TWCA 3NGAA 3OW3A 4CFWA 3HRBA 4LUDA 3V5JA 4F1MA 5BNJA 3WE4A 4X3FB 4ZZOA 4MXYA 4NL0A 2GNIA 5I9WA 1VYZA 2ZM1A 3V5QA 5C8KA 3AE7C 1PY5A 2ITYA 2CNQA 2QHNA 4ALWA 2C1AA 3AT3A 4XMOA 4EOPA 4RA5A 1H08A 3COIA 4E7WA 5EDQA 4FIIA 4TY1A 5ETIA 1SM2A 4XOZA 3WZEA 1BYGA 2QOBA 4F9BA 2IZRA 2Z2WA 5B0XA 1ZAOA 4MX9A 1PXPA 4FOCA 3UO6A 1TVOA 3BBWA 4BZNA 4C3PA 3HV4A 3KVWA 4G9CA 4LV5A 4RA4A 5CT7A 4CD0A 5CAPA 3AD5A 5DR6A 1P14A 4II5A 1V0PA 2WQMA 4BGGA 1WAKA 3QTRA 2QO7A 4R1YA 5FQDC 3MB7A 3NUNA 4RQKA 2ITXA 4MHAA 1OKVA 5JGAA 1TKIA 5J9YA 1QL6A 3TZ9A 2VO0A 2I7QA 1GAGA 3OTVA 4Z7GA 4G3EA 4ZLZA 4B4LA 1SYKA 1P4FA 1CKJA 1ZYDA 3AC3A 3AT2A 2H96A 1R78A 3CBLA 2NRYA 3D5XA 3R9HA 3WF5A 3ZHPC 1AD5A 4FKQA 3R28A 4TTHB 2WDQD 3RALA 1J7IA 4EH6A 3V5LA 5HI2A 3UP2A 3FC1X 4AOJA 3ZO2A 2BVAA 2XANA 3TI1A 3PXYA 2GCDA 2PZIA 2VX3A 1KWPA 4RWLA 4I0SA 3BYSA 3BLHA 4WHZA 3OXZA 4FR4A 2JKKA 1ST0A 2W1FA 3N51A 5CU4A 3U4UA 3OCSA 3SQQA 3ALNA 3BRBA 1M7NA 3PSBA 4U8ZA 4BIDA 2GQGA 4YSYD 4GKHA 4EOSA 3N4UA 4YC6A 3QKKA 5HTBA 4E20A 4XV3A 1OGYA 4H3PA 1JSVA 3VBVA 3GQIA 4C37A 3OWJA 3Q4ZA 4EKKA 2B7AA 4D5KA 4R5SA 2WDRD 5HBJA 3BBTB 4ACDA 3W0QA 2YAAA 4L6QA 3VF8A 3E87A 1NA7A 4S2ZA 3R63A 4V01A 4GUBA 5TR6A 5ITAA 2J0LA 1QCFA 1QLBC 4P4CA 3RPOA 4TL0A 4DFYA 3U6IA 3ORIA 2R4BA 4MNEB 2HIWA 5AX3A 3WF8A 3OHTA 4IJ9A 3UBDA 4R3RA 3LFNA 2OSCA 4QMUA 1O6KA 1CDKA 5JQ8A 2XM8A 3PUFC 1YOMA 1PHKA 4FGRA 5L2TA 4I93A 4X6RA 4YSJA 4U3ZA 4AW0A 4GIIA 4AZFA 2PY3A 2QOIA 3LIJA 4H3BA 3KKVA 2DWBA 3PUPA 4O7YA 4U7ZA 4RX5A 4CKRA 3GU6A 5FDXA 4BDGA 3RHXA 3SD0A 2Z7QA 5JEBA 3HNGA 4HPTE 3QTXA 4QTCA 2OJGA 4OTHA 3TKIA 1E7PC 2IO6A 1CKPA 3HUBA 3IQ7A 2GHMA 2C5YA 3HRCA 5HEZA 4FTAA 3P5JC 3OT8A 3QRKA 4RX8A 1JNKA 1W8CA 3SXRA 4EHGA 1Y6BA 1O6YA 2R3MA 3FYJX 3OT3A 4PNKA 2HYYA 2O64A 1Q97A 3K5UA 4EUTA 5EM8A 4JQ7A 5E8ZA 4BDHA 4QYHA 2YIYA 3V5PA 2HCKA 2WB8A 3FZ1A 3HUCA 4YJSA 4LOOA 5HIBA 3AEGD 4DC2A 3P86A 4I6FA 2QHMA 4YNOA 1S9JA 4NU1A 2X4ZA 4QP4A 4QOXA 3ZDIA 5HX6A 2Y7JA 3RCJA 4BDJA 4EZ7A 3LFQA 2LAVA 3W2OA 4GT4A 2H88C 5HIEA 4AA0A 3PSCA 5C4KA 5IMEA 3PVWA 4G3DA 3GU7A 3ITZA 5HG8A 4LGGA 4KABA 4I92A 4BN1A 3T3UA 4G2FA 5B2MA 4KKEA 4HYIA 1SZMA 3ORNA 4YBJA 4DHFA 2WS3C 3RK9A 3AECC 3O96A 4P5ZA 4XG2A 2J50A 3CS9A 3FKNA 4J98A 4FKJA 4IWQA 2ZV7A 3UMXA 3DFAA 4RSSA 4BIEA 3QX2A 2ZMCA 3E8DA 5LWNA 4HVHA 2GPHA 4D2SA 1R3CA 4TW9A 4TZRA 5A4QA 3AEDD 4ZSLA 3HECA 1NVSA 3AEED 3KCFA 4ZTNA 5IA5A 2O5KA 3G33A 5DIAA 2XAOA 3TNQB 4XUFA 3DQWA 4YTFA 5AAEA 4F1TA 1YI6A 2OZAB 4HCTA 4XG9A 4X7QA 2ACXA 5EHYA 4BDFA 3MJ2A 3E7OA 4JBOA 2UW0A 4PL4A 4I24A 4XLVA 3MH0A 2E2BA 2UZUE 4X3FC 3EIDA 4FL3A 5FXSA 3CPCA 1GZOA 3HLLA 3NNVA 4EQCA 3OOMA 3EFWA 2BTSA 2H89D 1G8AA 4V04A 5D12A 3FLWA 3V8SA 2XF0A 4D1XA 4YURA 2QOFA 4IVBA 1Z5MA 5M4FA 4D28A 2QU5A 2I0YA 3QALE 1Z9XA 3VONA 4FEUA 2RG6A 2NPQA 4U6RA 4X2GA 3SG8A 3QTWA 4E4XA 5M4IA 3P4QD 4JIAA 3D14A 4YXDC 4PMTA 2CLQA 2GMXA 4M84A 4BZDA 3PWDA 5CSPA 4ZJVA 3NUPA 3EH9A 2HWPA 3GBZA 4CFXA 2IZUA 2I0EA 1IG1A 4RIXB 2PZYA 4M8TA 4CKJA 5KBRA 3W18A 2YHVA 1DM2A 3VUDA 5CI6A 3R04A 2HXQA 2R3IA 3DXPA 3AE9C 3DDPA 3HL7A 4DG3E 3NUUA 5C1QB 2WPAA 3VBQA 1J7LA 4FKSA 4S32A 4XNEA 3QZIA 3QD4A 4JX7A 4B8LA 4TNBA 5LQFA 4FSRA 2W96B 4NTSA 5ANIA 2WMRA 2XAMA 3C7QA 3ZXZA 3LKMA 3W0NA 3B2TA 4TNDA 5IUIA 3R7IA 5L3AA 2PVJA 4FT3A 3DU8A 3HDNA 2B53A 3SC1A 2REIA 1UU9A 3EFLA 4RFYA 3TV4A 4DTKA 3UYTA 5BUJA 5I9VA 3CIRC 3H9RA 1R0EA 1U54A 4QRCA 1WVWA 3GU5A 3PDTA 4C34A 2BTRA 3PYYA 4D4VA 4Y8DA 4RX9A 2VO6A 3PE1A 3MW1A 1WBSA 3C4XA 4FKRA 4C2VA 4W4VA 5DVRA 3R21A 3AE6C 2WU2D 1PXOA 1ST4A 2VGOA 2WIHA 3A8WA 4DAWA 3ANRA 3I0QA 2PK9A 3K5VA 3QQLA 5BVFA 4QYYA 5CSXA 2RIOA 4FSUA 2GNJA 3NWWA 1GZNA 3PFQA 4LMNA 4LL0A 2ZFYA 3EZRA 4C62A 2WMUA 1VEBA 1PYEA 2RFEA 3QZHA 1Z57A 3W2RA 3ZH8A 5CALA 5GINE 4GYIA 1OUYA 3WF7A 4AN2A 4YTIA 3ORXA 3U9NA 4RQVA 2QOOA 4D1SA 3JS2A 4KBCA 5TKDA 5H3QA 3HMMA 4BB4A 2JAVA 4RLKA 5HO7A 1XH6A 3ACJA 3FMMA 2C3LA 3ORPA 4S33A 2F57A 4K11A 3F7ZA 2R7BA 3HA6A 4ENYA 3LMHA 1K3AA 4KIOA 4CCUA 1HCLA 3IW7A 1OITA 3DOGA 2R3QA 4MK0A 1GIHA 2YIRA 4O38A 4GFMA 2BZIB 3ALOA 5CU6A 1GNGA 3BLQA 2XCHA 4AXAA 3F7WA 5KE0A 2J5FA 3SVVA 4S31A 2E9VA 2NNWB 2PZ5A 4BDDA 3LPBA 4FKWA 3OEFX 3CTJA 5FRIA 4BTMA 2O3PA 3EKKA 2YCFA 3LFSA 3VUGA 4NW5A 4DEBA 4IACA 2RL5A 4AOIA 3Q5ZA 2X4FA 1ZMUA 5AM6A 2OU7A 1PMVA 3DLZA 3A4OX 3E8EA 3PXKA 2CCIA 3E5AA 3W1FA 2AC5A 4D4YA 1XH5A 1KFYC 3PE2A 4GCJA 1KE5A 3RINA 4QDVA 5EYMA 2YJRA 4Q5EA 4CFNA 4DLIA 3FI2A 3Q9XA 4AS0A 4EUUA 2UZTA 3EL8A 3PFYA 3QFVA 4H1JA 3UG2A 4RC2A 4ACMA 4RJ6A 3AT4A 3LFDA 3LJ0A 3DZQA 4RC3A 2OIQA 4RIYB 1SMHA 3D7ZA 2PPQA 3MY5A 4YZDA 5J9ZA 4C35A 5JSMA 4Z9LA 4DF3A 3R83A 3KREA 3LCKA 4XG8A 4USFA 3FLQA 4FIHA 4RRVA 5M57A 4Q5HA 4W4WA 4KRCA 4KS7A 3FZTA 3QLGA 3PY3A 5EK7A 4KINA 4WA9A 4EC9A 4QTAA 1ZWSA 3PA3A 4JG8A 4KIQA 4YT0D 2P55A 2ZDTA 3P4PC 3QX4A 4I5MA 1TQPA 3ZYAA 4F63A 3MGYA 3G51A 1SVHA 2UVYA 2UZEA 1UKHA 4KD1A 1FBNA 5HNGA 3QKLA 3L9NA 4MXCA 3ERKA 4AACA 2WXVA 4RWIA 2BROA 2XJ1A 4DLJA 3PRFA 5LARA 3AMAA 4FZAB 5HX8A 2IG7A 3C9WA 5IPJA 3HDMA 3U8WA 1ERKA 4Y5HA 4PDPA 3OUKA 3AD4A 4IB5A 4UALA 5D11A 3RKBA 3GFEA 3MN3A 3F3WA 2OGVA 4N6ZA 4NIFB 2UV2A 5IEYA 4O0SA 4F7JA 2VN9A 5EFQA 2W9ZB 5AV4A 2G15A 4DN5A 4IM3A 4KKHA 2BFYA 3TIYA 2W1GA 4XV1A 4LDTA 3OFMA 5E8SA 5KMNA 5IQAA 3ORMA 1YOLA 4IX4A 4LRKA 4KS8A 4O6EA 3U55A 2YIWA 1XWSA 1OVEA 3TXOA 5CASA 3C4CA 4C4FA 2JDRA 3FQEA 3GCSA 4CMUA 3PP0A
chains in the Genus database with same CATH topology
2ZV9A 3EQHA 3EOCA 4FV1A 5BUEA 5E8WA 4UWCA 3P78A 2JFMA 3BHHA 3UDSA 4PV0A 1FVVA 3BI6A 4EH4A 2BRNA 3CGOA 4HNFA 1XH4A 1XBAA 4JDIA 2CNUA 2BILB 3R1SA 2XP2A 4O0WA 3PIYA 4QMVA 3AXWA 4A9YA 2XBAA 4UYNA 1PMEA 1YI4A 4WKQA 3C50A 1KOAA 2ITUA 4GG7A 4L44A 3IOKA 5DYJA 2JKQA 4ORKA 3TKUA 2QOCA 4TWPA 4FL2A 4M3QA 1YWRA 2HW6A 3EKNA 1GY3A 5L8KA 3DNEA 3QXPA 4ZZNA 2PE0A 4QPAA 4Q2AA 1OBDA 3KIOC 4KBAA 3BX5A 5IEXA 2Z7LA 5KZIA 3ZO4A 2C69A 3ZSIA 5A46A 4ASXA 3R7YA 1KOBA 2KULA 4GG5A 4YHFA 4BDIA 3R1QA 2EXCX 2ESMA 1UVRA 4FZ7A 1BKXA 2PUIA 2UW3A 4MVFA 3GCUA 1W83A 3FY2A 1IAHA 5CX9A 3CPBA 3FXZA 3T8OA 4F6UA 4X21A 2VO7A 4ZXTA 2C0OA 5EI6A 4JJRA 4OGRA 5L6PA 3SRVB 4FMQA 4MWHA 2XYNA 4P5QA 3VUKA 3W8LA 2CKOA 3BPRA 3FZSA 3PVBA 4PP7A 2CKQA 3NDMA 3QGWA 5IQIA 4PDOA 1WBTA 4ZMFA 4J97A 5EDRA 3A99A 3QTSA 4CTBA 2ITQA 3KB7A 1ZRZA 4AGWA 2WQNA 4ANLA 2WTJA 5A4LA 4QMLA 3IDCA 1CTPE 4IX5A 4Y5QA 3ZLSA 2ZAZA 4EWQA 4FE2A 4IWDA 4QP6A 4QTDA 3KRWA 3UIUA 2WFYA 3V51A 3FDNA 3LCOA 1Y91A 3UVPA 1H01A 2XNGA 4QP3A 5EH0A 5GJFA 4AXDA 2VTQA 1ZARA 2ZMDA 3L8XA 2ONLC 3L9PA 2VAGA 3KXNA 4LMUA 1E9HA 4F9YA 4PMMA 2GHLA 2YEXA 4G6NA 3BE2A 4TWNA 4AFJA 3LXNA 4IVCA 5EHLA 4FYOA 2YM5A 4RZVA 3FMKA 3GXLA 4A06A 4C4GA 5IQFA 1QMZA 3G9NA 3W2PA 4EL9A 5K4JA 3UQCA 4WT6A 4HPUE 1NW1A 2CGXA 4WOVA 4FVPA 2OI4X 4LV7A 2GS7A 5EKOA 4AXCA 5AUUA 1H4LA 4MF1A 4UX9A 2PVRA 2ITZA 3MIYA 4YJOA 2J6MA 5C01A 4YJPA 3FYKX 3ZSHA 3EN4A 3KXMA 4IBMA 3KU2A 4O86A 5D41A 5KMOA 4FIFA 1PMUA 4BDCA 1G8KA 5IH6A 5IA1A 4DDIA 3I5NA 3V01A 3JY0A 3LCDA 4ID7A 4PY1A 3PRIA 4RFZA 2QOKA 4QEBA 2G9XA 3GP0A 4CG9A 5HLWA 1YXSA 4HVSA 3QXOA 3S0OA 4L8MA 3VBTA 4EHEA 4J8MA 3F5UA 2J9MA 1JKSA 4G9RA 4ZJJA 3REPA 2PZRA 3R9RA 5LVPA 3TEIA 4OTFA 2ZB1A 2XJ0A 3BKBA 4D4RA 4AWIA 4YC3A 1ZOEA 3QYWA 1OUKA 1QPJA 4R1VA 5AUTA 1MP8A 3LOKA 4F7LA 5EQYA 3UNJA 1VJYA 3ENHA 3DB6A 4P7EA 2PE2A 2WTDA 5FGKA 1OPLA 3RM6A 5H9BA 4B9DA 3QHRA 3WZKA 5E7RA 3R7EA 5I4NA 2QLUA 4I4FA 4HVDA 4S30A 5DR2A 3MPTA 3CP9A 3O2MA 3MV5A 4RIWB 3TNWA 1XH9A 3DK6A 4ACHA 5AV0A 4ENXA 2PUNA 4HCVA 4ASDA 2UZWE 2VNYA 1URWA 4GUEA 2F2CB 4O83A 4KUJA 4IX6A 2XNPA 4C4JA 3I0OA 5EW3A 4O0YA 3THBA 4JMQA 1JSTA 3F2NA 3CCNA 3AGLA 3MVJA 4IAFA 4IIRA 5C4LA 3MA6A 2R7IA 1YXVA 3LJ1A 2F7XE 3KULA 4YGAA 1NVRA 4JOAA 4E1ZA 5HCYA 2VTPA 4G5JA 4GYGA 4GSBA 4L7SA 3TNPC 4ZTQA 3KXZA 5E9EA 5BUIA 4UV0A 1P2AA 3KN5A 3PJ1A 3ZM9A 4FVRA 5D10A 3KK8A 3DFCB 3DPKA 2W4OA 2ZDUA 4RIOA 3O5AA 2X7OA 3CY2A 1YHVA 1M2PA 2PULA 5EYCA 3K54A 4UYAA 4ZY5A 4ZTLA 2VTIA 4NT4A 4EK3A 2E9PA 3F69A 4RJ3A 3TTJA 4RPVA 3BELA 5CQWA 3BL9A 3Q60A 4Y72A 4PDSA 4JBQA 2WOTA 3I5ZA 4JG6A 5CVHA 3ZZWA 4AQKA 4JNWA 3IW6A 2HW7A 2XNBA 2GFCA 3CXWA 1AGWA 4BCGA 1XR1A 2PVMA 3FWQA 3TUCA 3LQ8A 4CSVA 5M56A 4B0GA 2YA9A 2ZB0A 4FV2A 3UP7A 4E5BA 2X2LA 4Y83A 1O9UA 1BL7A 3P4KA 4C59A 2C30A 4JBVA 2NRUA 5D7AA 3ZMMA 3R0TA 3E62A 4Y46A 1H8FA 2Y9QA 5C8NA 1ZOHA 3EQPA 3N4TA 2VO3A 2WTCA 1PW2A 2BAJA 3FUPA 3VF9A 5CEOA 4ANQA 3ZUTA 4V05A 1WBOA 4G17A 4HGEA 3L9MA 4OW8A 3S00A 2W9FB 2JC6A 5IU2A 2WMXA 3R8LA 2OXDA 2OG8A 3C0IA 4CLJA 5FTGA 1YXTA 4BI2A 4FNZA 5EDPA 3OC1A 3TKHA 4ANSA 5KX8A 2F9GA 5E1SA 3QYZA 4WD5A 5JFXA 4YHTA 4XH6A 5M55A 3UMWA 1OM1A 4XLIA 4I41A 5GIOE 1APME 1WCCA 1Q99A 2VTAA 3E8CA 1KV2A 4H05A 1PJKA 4IQ6A 1OI9A 1U46A 3A62A 2UZDA 4EH5A 2Q0NA 2W1EA 4IM2A 4YJTA 4G6LA 4C38A 4G3GA 3OCTA 4U80A 5AUVA 3SHEA 4AZWA 4O7LA 4BRXA 4E6CA 3G6HA 4H36A 4MH7A 2C6DA 3R8ZA 3FJQE 4GIHA 4NJ3A 4NW6A 4OTRA 3SGCA 3QKMA 2OIBA 1M2RA 4L43A 5GHVA 1H0WA 4EOIA 5JK3A 4MBIA 2BZHB 1FGIA 4YZBA 3MESA 4HYUA 3LXKA 5AV2A 3O8TA 3A7GA 3VQHA 3V3VA 1PXMA 2VWZA 5A6OA 5BPYA 3KRXA 2YITA 4CFMA 4WNOA 4C4EA 1KSWA 4NTTA 3KULB 2X8DA 3A7JA 2GNHA 3IKAA 1BX6A 2W5HA 4CLIA 3H0ZA 5K5NA 5B2KA 3DB8A 1UNLA 5C26A 1RQQA 2WGJA 4W8DA 1DAYA 3PVGA 2W0JA 2BMCA 2QKRA 2CMWA 3DK3A 3DLSA 4J7BA 4J52A 3VULA 4UBAA 4UZHA 2Y4IC 1F5QA 1EH4A 2GNGA 2PVLA 2YM4A 5DT4A 4I0RA 2QLQA 5E8YA 4DFNA 4F9CA 2W1HA 4CRSA 5JGDA 2OWBA 4CFVA 2YWPA 4O6LA 3I1AA 5AP2A 5KMMA 3MJ1A 3PZHA 2GDOA 1H00A 2B1PA 4CVAA 5K3YA 4GT3A 4D0WA 3D5UA 3VS4A 4YP8A 4EK8A 3BL7A 3NEWA 3V6RA 3JXWA 3QF9A 4U81A 3UVRA 3ZEWA 1H28A 3NYOA 3OWLA 5F9EA 2VTNA 2B9HA 1UNGA 3HMNA 4O7WA 5AIRA 4JDJA 2GSFA 3PY1A 3BHUA 3QQGA 4MCVA 2YISA 5AWMA 3QCXA 4P2KA 4KNBA 2VTOA 5KCVA 4FJVA 1PXJA 3Q9YA 2UW5A 4WNKA 2OFUA 4N57A 4ZTHA 1DAWA 4I5CA 5ANJA 3R71A 5EW8A 2IW8A 1OKZA 3IONA 3KRRA 3BYVA 4AE9A 4I6QA 4GK3A 5DFPA 3VS5A 2GS2A 3R00A 3RCDA 4RVKA 4X2JA 3DBDA 4AZTA 1PMNA 4PMPA 1ND4A 3U4WA 1ZZLA 3DKCA 5LOHA 3GFWA 2EB2A 3HP2A 4CXAA 1OL7A 5DRDA 1MQ4A 3L8VA 3MY0A 5EYDA 4ALVA 1OECA 2XKDA 3PWYA 4EKLA 3BCEA 4O0TA 3EFJA 5AP4A 3OROA 3VJOA 2CCHA 3G90X 5J9LA 3Q9WA 1VYWA 4EONA 4IX3A 4ZK5A 4ZEGA 4MXAA 2IZTA 5LVNA 4R7HA 2WMVA 2WU6A 3UOKA 4JT3A 4O7NA 3V8TA 4OTWA 4JQEA 3BLAA 1URCA 1OIRA 3EFKA 4FKPA 1M2QA 1W98A 2ONLA 2J0MB 4LYNA 4DITA 3EQGA 4A4OA 5HHWA 2YAKA 2VWXA 3QWKA 4C61A 1W84A 4ZY6A 4FZFB 4KSQA 3PTGA 4EQUA 4GV1A 5I9XA 3IOPA 2WTKB 3LW0A 4FKGA 3F3UA 2NO3A 2WKMA 4OTDA 2BUJA 5HKMA 3COKA 3QD0A 3NIEA 1SVEA 4I22A 4U97A 5I9UA 2ETKA 4DH1A 4B7TA 4MBLA 4GEOA 4DA5A 1H1RA 2A0CX 2ETRA 3W8QA 2V55A 5FD2A 3FZPA 4CKIA 3HV6A 3F2RA 3OWKA 4XCUA 3TJCA 3Q53A 3FQHA 2C0TA 4O2ZA 1UNHA 2WMSA 2F7ZE 1IAJA 3GC7A 4NKSA 4BCHA 4MXOA 5CAOA 4O27B 3NUAA 4CQEA 4FTTA 5FM3A 4DTBA 2HY81 4FUYA 3OXTA 1L8TA 3IW4A 2RFSA 3NCZA 4Z3VA 3C5IA 5T6KA 4C36A 4UEUA 3EQDA 3OCBA 1ZY4A 4FTNA 4AN9A 4FG9A 4LL5A 4DGMA 2GHGA 5CSVA 4YLKA 4BHZA 4CG8A 4ZLOA 1Q8TA 5AX9A 3O7LD 4GT5A 4YMJA 3KXHA 4TYIA 5KMLA 3HMOA 5A3XA 3RPYA 4FTCA 3AKJA 2OICA 2PMIA 4XP3A 3NUYA 4I6HA 4PDYA 4YJQA 2H9VA 3OBGA 4M67A 3S2PA 5CEPA 4M0ZA 3RP9A 4IJPA 1VZOA 4FK6A 3PVUA 4FTUA 2CKPA 3QCYA 2B54A 2YDIA 2FO0A 4I6BA 2VTRA 2JBOA 3NRMA 2W17A 4HCUA 5CU2A 4FG7A 4BGQA 4QPSA 5CXHA 4R77A 5DEYA 5ETFA 3WILA 1NVQA 2PZPA 5CNNA 3ZSGA 2XEYA 4O7SA 4FK3A 2ITNA 5H8EA 5AUZA 1ATPE 5FG8A 4AG8A 3FI3A 2WTWA 4BI1A 5ANOA 4EK4A 2BIKB 2XA4A 3Q04A 4HYSA 5AAGA 3BYUA 3BEGA 3OY1A 3FHIA 4R78A 4YHJA 5HD7A 3BQRA 4ZMEA 4OTQA 3HVCA 3HV7A 4GS6A 3E8NA 2X9EA 4ALUA 2WOUA 2FUMA 5J5SA 3PJ3A 2YIXA 4QT1A 3DAKA 5KBQA 4EZ3A 2Y6MA 1KE8A 4NUSA 4RG0A 5DGZA 4Z55A 2XIKA 3ATTA 3BGZA 3DT1A 4MD8E 4FSTA 3SLSA 5A4TA 3EQIA 3ROYA 4FT9A 3GCQA 2C47A 4IEBA 3UC3A 5K9IA 2CKEA 3RAHA 2E9OA 4DBXA 3NSZA 4XYFA 3BHYA 3QQHA 4FV9A 2WZJA 4PRJA 3VQUA 5TF9A 3ZFXA 4BIBA 4C3FA 2E9NA 2VZ6A 4BCOA 4MKCA 5L6WL 4ZTMA 5J1WA 3WF6A 5FBOA 3RK5A 5DG5A 5GIPE 5H8BA 4QQTA 2OXXA 4AUAA 4XP2A 4FV8A 3F66A 3HGKA 4JX3A 4XV9A 4EHVA 1T46A 4F65A 5BVOA 5KMIA 3VS6A 3BIZA 3ORKA 3LM5A 3OS3A 3FMEA 5EOLA 1RE8A 1ZYJA 3F6XA 3TZ8A 4MQ2A 1LR4A 2B9IA 2HENA 4GRBA 4JVGA 4ONAA 4QMOA 5CF4A 3FE3A 2IN6A 3CJGA 1JQHA 4IDVA 2A19B 2W1ZA 3LHJA 4AQCA 3W2CA 2R2PA 4WG3A 3ZRKA 1U54B 1G8SA 2I6LA 2JDVA 2BAKA 4IADA 2XEZA 3S4QA 3KRLA 3Q4TA 4QMNA 3M2WA 2JFLA 2CJMA 2OH4A 4DT8A 4C02A 4IW0A 4CFUA 4U44A 1H25A 5TO8A 2IZSA 2DYLA 5DR9A 3FSKA 3MFTA 4JDHA 1LP4A 1A9UA 3LFFA 1CKIA 4DFLA 1HOWA 2P4IA 3U6HA 3PPJA 3VWAA 2XCKA 3A4PA 2QONA 4F0GA 1QPDA 5IISA 4BDKA 1W82A 4KA3A 4S34A 3A7FA 4A4XA 3U6JA 4FBXA 3OY3A 3PSDA 2V62A 1MQBA 2I40A 4GU6A 3JR1A 5AJQA 4ZP5A 2GS6A 3KA0A 3ULIA 3LQ5A 3UDBA 3UGCA 5B2LA 4AW5A 1M14A 3ZC6A 1B39A 5HE3A 2VWWA 3FZOA 4ASEA 4EZ5A 2ZYBA 3AC2A 4HGTA 2PE1A 4EOMA 3CTHA 4HZRA 4L3PA 1KE9A 2GTNA 4DCAA 3WI6A 4G3CA 4DG0E 2YFXA 3CKXA 3PY0A 3QC4A 3OOGA 3OG7A 1BUHA 2VTTA 4JLCA 1ZYCA 2R3FA 1TFFA 4RX7A 1JKKA 2C5VA 1BL6A 3MH2A 5E8VA 1GZ8A 5FDPA 3R2YA 3CQWA 2B9JA 2F4JA 3KF4A 3BYMA 3QGYA 3Q5IA 3RM7A 1YI3A 4AZVA 3DJ6A 3KVXA 4JDKA 3OUNB 3SW7A 3NW7A 1YQJA 3R1NA 4FOBA 4U5JA 3VNTA 3R01A 3QUPA 5HCZA 5M06A 2R3GA 4YSMA 3DJ7A 5AP1A 2G1TA 4X3JA 4FUXA 3DTWA 5LJJA 4BDBA 1OB3A 1Q62A 3TN8A 3RAIA 2PWLA 3RGFA 3DK7A 4QYGA 1MRVA 1BLXA 2R3LA 4DH7A 5JRSA 3QTZA 4BCMA 2IVVA 4A9SA 2BZKB 5AV1A 1I44A 2R5TA 5F20A 4XS2A 5AAFA 4YUQA 4J8NA 2X9FA 3E7VA 4D55A 3VAPA 2W1DA 3TM0A 5CZHA 2C1BA 2CGVA 3BWJA 1MRYA 1PXIA 4KWPA 4GL9A 2Q83A 2Z8CA 2FYSA 3FLSA 4F0FA 4D58A 3HZTA 1UU3A 4I94A 4K77A 3T3VA 2YCSA 3MPMA 1JPAA 2QI8A 3JVSA 2RKUA 3ZFMA 3MDYA 2XIYA 2YERA 3WIGA 3VS3A 3DA6A 3FMNA 2C6EA 3F3TA 3L9LA 2UW8A 5HESA 2Y0AA 4YC8A 3G15A 5HG5A 3ZTXA 3AD6A 2XIRA 1FPUA 1ZMWA 2CHLA 4UY9A 4D9UA 2W05A 3DBCA 5CEQA 3AC1A 4RWKA 4UB7A 5IEVA 4PMSA 4RIXA 3ZONA 3P0MA 4E4NA 2O0UA 3EL7A 4BCPA 3NLBA 4CEGA 2P0CA 3VO3A 5BVWA 2X2KA 3EZVA 4TYGA 5DOSA 5EQEA 3IPHA 4EOKA 5HU9A 4L00A 1OIUA 4B8MA 2QC6A 3ID6C 5JZNA 4FIJA 5IUHA 1Y8GA 2PYWA 4U9AA 3NUSA 4L67A 3U87A 1YRPA 2V7AA 3MVMA 5CAVA 3ZS5A 2AUHA 3MH1A 4E26A 3EYHA 3FLZA 4FZDB 3TL8A 4CTCA 5CAQA 3TDVA 4X0MA 5I9ZA 4NM3A 3O71A 4G3FA 1Q61A 4NM5A 1Q24A 4QMZA 2G2HA 2X1NA 2XKCA 2E9UA 5EM5A 5AP5A 2CLXA 2J0JA 3G9LX 3TIZA 4YPDA 3T9TA 4O7ZA 5BYZA 4FKIA 3P7CA 2ITTA 3RMFA 4DEGA 4U3YA 4PUZA 4FTMA 4EEVA 5DEWA 4DTAA 3LFBA 4FNXA 4DGNA 2PMOX 2PUUA 3FQSA 4IVAA 2VWIA 3CKWA 3HMPA 1OKYA 3PXRA 3PLAE 4CT1A 3D0EA 4O0UA 4I1ZA 4CV8A 4IH8A 2WNTA 5K5XA 1NXKA 3UIXA 4FSZA 4Q9SA 3Q2JA 2BDWA 1JKTA 5H8GA 3WE8A 4DH3A 3ODZX 2Z7RA 4AXFA 3DXQA 3MFSA 4ZY4A 2H34A 3UPXA 3AG9A 2R3JA 1JKLA 4L42A 4RJ7A 1Q3WA 1U59A 3BYOA 3CY3A 3TTIA 3VBYA 4WG4A 1YDRE 4BCFA 3GVUA 2JKMA 1H1QA 3BHVA 4OT6A 4QP1A 3B2WA 3DKFA 4QYFA 5EI2A 1OMWA 5HE0A 1UKIA 4I23A 3S95A 3VRYA 5IH5A 2P3GX 4MD7E 3KQ7A 3DS6A 3QHWA 1UU8A 4O21A 4DHIB 3OBJA 4PNIA 5AADA 3ZBFA 3FEGA 3PJCA 1BI7A 5J8IA 2OIDA 4QMMA 5CU0A 3U9CA 4XX9A 4Z7HA 2SRCA 3D4QA 3G5DA 4NSTA 5J95A 2XH5A 4I20A 3EQFA 4MD9E 5IMXA 3RAKA 4BBFA 4AN3A 1VLRA 3QQUA 2ITWA 3WOWA 2QR8A 4GFGA 3BWFA 4CNHA 2BRBA 3TJDA 1W0XC 3C4FA 1H27A 2PMNX 3BE9A 4R5YA 1PXLA 3FBVA 4XBUA 5HNBA 5HVYA 2UVXA 4H39A 4ITJA 4USDA 3QCQA 2VX1A 1WMKA 2ETMA 2J0KA 3EMGA 2VTMA 3NYXA 2JDTA 3VRZA 5HTCA 4V0GB 5CEKA 4FSNA 4M12A 2JKOA 3R8UA 4BCIA 4DYMA 2EXMA 5IA4A 1Q41A 2NP8A 2OFVA 2NYAA 5D1JA 3UE4A 2OO8X 1XBCA 3DAEA 5HD4A 5EHOA 1R0PA 4ZLYA 3OZ6A 5M44A 2HY0A 3LZBA 4PQNA 4O0VA 5HU3A 2FB8A 4XRJA 4M69B 4EOJA 3UG1A 4R7IA 4XOYA 2QNJA 4IB0A 4KAOA 1PF8A 3EN9A 4X2FA 2C6TA 4JL9A 4U79A 2XMYA 4IM0A 2WMQA 3QRTA 2ERKA 3Q9ZA 3ZM4A 5J87A 4JS8A 2JEDA 4M14A 3DV3A 4FTLA 1YHSA 3W32A 4E5AX 4IB1A 4LRMA 5ETAA 1B38A 3AQVA 4E5WA 5F1ZA 1YWVA 1WFCA 4G31A 1J7UA 4O81A 2X7GA 2C6OA 3MFRA 2J4ZA 2Z02A 4WRGA 2FSTX 3KY2A 2R3KA 5AIKA 4LI5A 4IC8A 3AMYA 2CSNA 4C0TA 4NZWB 4EH3A 2UUEA 1A06A 5ANEA 1T45A 3G0FA 4ZJIA 2HWOA 4YJUA 3TWJA 5AP7A 2JDOA 3UIBA 2QVSE 3H9OA 5J7HA 3U54A 2UZVA 4WBOA 2BZJA 2V5QA 2Y6OA 5CQUA 3Q52A 2X81A 3PA5A 3O23A 5M4UA 4BKJA 3UQFA 4RIYA 3L1SA 3LM0A 3MBLA 2VTSA 4K9YA 4KBKA 4V0GA 3W0OA 4M15A 1WBNA 1XKKA 4N70A 3FI8A 3CC6A 3MTLA 1J91A 4F9AA 3BU6A 3QL8A 2UZNA 3CLYA 3RPSA 4L01A 3TZMA 3R8VA 3CEKA 4GFOA 4MYGA 5AP0A 2YDKA 4CZTA 2ITVA 2XRUA 3HRFA 5BVEA 3NAXA 3SV0A 1Y6AA 1PKGA 3CD8A 3FXWA 3H3CA 4PL3A 3SW4A 1YHWA 2ZM3A 2QR7A 3DAJA 3ULZA 2IJMA 1WBPA 5ANDA 3UOHA 3VUHA 3WYXA 4FKUA 3RTPA 3W2QA 3LMIA 2WO6A 4JR3A 4FV0A 4C33A 2EVAA 3IDBA 3E3PA 3NNUA 2W06A 2X2MA 3UJGA 2VUWA 3A8XA 3C1XA 5A54A 1BI8A 3NUXA 5TOZA 1JVPP 3I60A 4TRLA 1PXKA 1XMLA 3DBFA 2IVTA 3DGKA 1ZY5A 3QZFA 5DI1A 4Q9ZA 3BU3A 2QG7A 4IZ7A 4J99A 3F5XA 3CGFA 4HYHA 2A4LA 3ENMA 3TUBA 5I9YA 5HG7A 3Q4UA 3R30A 3R73A 4DH8A 3KC3A 3CR0A 4FTIA 4YO6A 4BYIA 3PPZA 4A9UA 3LJ2A 2P2IA 4J95A 5CZIA 2EWAA 4MXZA 3D2IA 1V0BA 2GQRA 3R1YA 5T68A 4CV9A 5KMJA 3FL5A 3ROCA 4QTBA 3EWHA 4DHZA 2F49A 3MPAA 4NK9A 3ZOSA 3E3BX 3HP5A 1M17A 3R7VA 5KKRB 3VC4A 5M09A 5DPVA 4EQMA 4I5PA 2J0IA 3AMBA 4F99A 5FTOA 4EI4A 3GB2A 3TT0A 4EC8A 2HZ4A 3ET7A 4FA2A 3I6WA 1S9IA 4RVTA 2JIUA 2VTJA 3BEAA 4FV5A 4CMOA 3Q96A 4L3JA 3C13A 4U41A 4XJ0A 1YVJA 1OKWA 2W5BA 4AFEA 4UN0C 5BX0A 4BZOA 4O96A 5LMKA 1B6CB 5LMAA 4RLLA 3UDZA 4RMZA 5DNRA 2WMTA 2JIVA 3NAYA 2QODA 4WNPA 4H1MA 3RI1A 4O2PA 3LCTA 2X6EA 4FVQA 2I1MA 2V7OA 2BFXA 2HOGA 2OXYA 4LM5A 1OIQA 4YLLA 4FX3A 5C03A 4DFBA 5CNOA 5JKGA 3WF9A 1CMKE 1NT2A 4XP0A 3G0EA 4GK2A 4E4LA 2BRMA 4U45A 3QA0A 4FODA 3ATSA 1G8JA 3D7TA 4DFXE 5F94A 4QNAA 3WIKA 4FV3A 5FBNC 3O8UA 3CD3A 5CS6A 2WU7A 1TQIA 5AP3A 1JSUA 4W4YA 2PL0A 1OZ1A 3D94A 2I0HA 4HVGA 3ZXTA 1V0OA 3DBQA 3KL8A 2X8EA 1JBPE 4C2WA 1R1WA 2QO9A 3LLTA 3ZZEA 3FC2A 5CVGA 3QTQA 4YZCA 4MNFA 4AAAA 3SXFA 5I5ZA 1ZYLA 5IQEA 3WYYA 3UVQA 5JT2A 2QD9A 4B99A 4BI0A 1PXNA 3MSSA 4OBQA 3NS9A 1YWNA 4EYMA 2A27A 4YBKA 4O7TA 4WSYA 3ZO1A 5HO8A 4BJJB 2OF2A 3F61A 3W10A 3UPZA 1DI8A 3DDQA 4LUEA 5CEMA 3M1SA 2C4GA 2FA2A 2XRWA 4TYHA 2BRGA 1Q3DA 5ACBC 5HBHA 3PXQA 3AGMA 4FG8A 3QRJA 3E93A 3N9XA 5EQPA 3FL4A 1UU7A 3EB0A 4ZSGA 1OIYA 2OH0E 4KIPA 3TYKA 2GNLA 1FMOE 1XBBA 3OF0A 2X7FA 3NNWA 5AMNA 2C3KA 1PRYA 3H0YA 4PTCA 4D4SA 4DE4A 2C5XA 3ZO3A 4YZNA 5DH3A 2B9FA 3IGOA 1QPEA 4RGJA 3QTIA 4AW2A 3OWPA 3ZDUA 1RW8A 2C5OA 3UOLA 5I0BA 3QUEA 2A1AB 3GC8A 1Y8YA 2J51A 3TV7A 3TZ7A 5D9HA 2CNVA 2XK4A 3I7CA 3BGQA 4FTKA 4HZSA 3S1HA 4IZ5A 4WNMA 3P5KA 3VUIA 2VX0A 2IW9A 2YZAA 4FIEA 3PIZA 5EM7A 3U51A 3DJ5A 4XG6A 4M0YA 3IO7A 1E1VA 2ZM4A 3BHTA 4JXFA 1AQ1A 3B8RA 3JVRA 4FTOA 4IWPA 3SOCA 5E4HA 5HVJA 3WZJA 4AF3A 5CLPA 5JFWA 5CF8A 2YJSA 5FUTA 2XK7A 2BHEA 2X8IA 2XB7A 2VWUA 2J2IB 3OD6X 3POZA 5DT0A 2VNWA 4TWOA 3R9DA