4DHJA

The structure of a ceotub1 ubiquitin aldehyde ubc13~ub complex
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
248
structure length
248
Chain Sequence
DQQLKTIEDEQKSVPLVATLAPFSILCAEYDNETSAAFLSKATELSEVYGEIRYIRGDGNCFYRAILVGLIEIMLKDRARLEKFIASSRDWTRTLVELGFPDWTCTDFCDFFIEFLEKIHSGVHTEEAVYTILNDDGSANYILMFFRLITSAFLKQNSEEYAPFIDEGMTVAQYCEQEIEPMWKDADHLAINSLIKAAGTRVRIEYMDRTAAPNGGWHYDIPSDDQQIAPEITLLYRPGHYDVIYKKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin thioesterase otubain-like
publication title The mechanism of OTUB1-mediated inhibition of ubiquitination.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Hydrolase/signaling protein/ligase
total genus 90
structure length 248
sequence length 248
chains with identical sequence E, I, L
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2012-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10275 Peptidase_C65 Peptidase C65 Otubain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1300.20 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases 3 helical TM bundles of succinate and fumarate reductases 4dhjA02
3.30.200.60 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4dhjA01
4DDIA 4FJVA 3VONA 2ZFYA 1TFFA 4DHIB 4LDTA 4DHJA 4I6LA 4DHZA 4DDGA
chains in the Genus database with same CATH superfamily
5DEWA 1SNXA 1GZOA 2OU7A 5C8NA 5A4QA 4GUBA 3GU5A 5KCVA 3UODA 2WDVD 4O81A 3MA3A 3O71A 4NM5A 4XP2A 5FEQA 3WF8A 3R73A 4YSXC 4C4IA 5DR2A 2FA2A 1JKSA 4LDTA 1H00A 2J0MB 2J90A 3FHIA 2WPAA 5CAPA 5LVPA 3MPTA 3EB0A 4O84A 4XEYA 3PG1A 2Y9QA 5HE3A 4XV2A 3VJOA 1BX6A 4RFMA 2C68A 4C36A 5FXQA 1YOLA 4IAKA 3FLNC 4JQ7A 4P2KA 4ZSGA 1PXNA 4RG0A 4CRSA 3TACA 4L52A 3F3TA 5D9HA 1P2AA 1DS5A 2WOTA 3ENMA 2Z02A 4O0UA 4D2RA 4FKGA 3DQXA 4AE9A 4WBOA 3QA0A 4PQNA 3OEZA 1B6CB 3AD4A 4FZDB 4LMUA 4DGOA 2WDQC 4PUZA 2R3GA 4G3CA 2QOFA 4YZCA 2V55A 4FG9A 2F4JA 4I6BA 2VZ6A 4UALA 3TKHA 4A07A 5IA2A 5L8KA 1ZZLA 3EKNA 1FGIA 2PK9A 2WEIA 2CGWA 3QFVA 2CCHA 3D2KA 3A4PA 3MTLA 3ORKA 3QX2A 4KNBA 4TYJA 3ROCA 2JC6A 5KUPA 4LOQA 4WIHA 5J95A 4RJ8A 4F99A 2J5EA 4HVSA 5I9YA 3KVWA 3HV3A 3OCBA 5G1XA 2WTIA 3E87A 4EUUA 4N57A 4YZDA 4PMMA 1YI3A 3SKCA 2YABA 4FEUA 3AMAA 4FZFB 3NVMB 4WSYA 2Q83A 4Z9LA 5T6KA 5M4FA 4D1SA 1KE5A 5CQWA 1YXVA 3NNXA 4BCIA 2IVVA 4MXOA 4R78A 3ZTXA 5GNKA 2XIZA 1GZNA 3WBLA 4ZZOA 3QL8A 2GFSA 3RAKA 3A4OX 5E4HA 3AEDD 5FTGA 3R1YA 4FTAA 2PZYA 4Y73A 3ZLYA 4EK3A 4FNYA 3LFFA 5AV2A 1V0BA 4PP9A 4C4JA 3E7OA 1PXOA 3CQEA 1ZWSA 5AWMA 2C30A 2Y6MA 3DAEA 4BR3A 5KMOA 1ST0A 3PVUA 2HYYA 5CSXA 5K4JA 3MFRA 2HK5A 4ZOGA 3LCOA 4NH1A 3HDNA 4U9AA 3TL8A 3TTIA 3W18A 3QTWA 4QDEA 5KMLA 5LQFA 2WXVA 4B8MA 2P2HA 3KXHA 5DEYA 4QYYA 2C3JA 1SMHA 2BRMA 2R0UA 4A9YA 3KF7A 3QC9A 3CEKA 4YXDD 3NIZA 3H0YA 3RNIA 1ZMWA 1W83A 5CSPA 5A54A 3AE6D 3VR9C 3RCJA 1H25A 3R2BA 2ITPA 1SM2A 5ETFA 4GIIA 2CPKE 2HW7A 5CSHA 5HLPA 3E3BX 2E9NA 2HZ4A 3C51A 4QNAA 5TOZA 4Y72A 4XCUA 1IG1A 3UJGA 3EN4A 4HVGA 2X39A 1ZOEA 3P5KA 1YXUA 4AUAA 4NKSA 5J7HA 4FK6A 5CVFA 2OICA 3D2IA 3B8RA 4K77A 3DKGA 3I60A 3FPQA 2GNHA 4L7FA 4IAFA 3L9MA 4OTFA 5LVLA 4B7TA 4C59A 3PUPA 4MNFA 3KFAA 3ZFXA 3KN5A 1IASA 5C27A 1IRKA 3LCSA 4ZMFA 2VO6A 3AEDC 4FVPA 2WTJA 3WF7A 5F95A 4JR3A 3ZCLA 4ERKA 4QYEA 4V0GB 3RJCA 3VRAD 2J6MA 2RKUA 1VYWA 3CTJA 1PHKA 2E9UA 4IEBA 5KHXA 1FVTA 4BZNA 5EHOA 3QZIA 4O6LA 1PKGA 5AFVA 4IB3A 4F7JA 5H2UA 3R6XA 5GINE 2YDIA 1E1VA 1UNLA 2GS6A 4PL5A 4V01A 4WKQA 4CSVA 2WB8A 5C1QB 1Q99A 2R3OA 5EDQA 3F2AA 3OY1A 1WVYA 3BHUA 1PMEA 1RE8A 4OBOA 3PP0A 1PMUA 1ATPE 3UYTA 1Y57A 2JKQA 3P4RD 2PVRA 3AGLA 4HJOA 4FKRA 2IWIA 3DOGA 2XRWA 3L9NA 5FP5A 2R3PA 4L42A 5HG9A 3GUBA 3AKKA 4QRCA 3QKMA 2O0UA 4JIAA 4XYFA 3N9XA 2CLXA 1J7UA 2F2UA 4UXQA 4QQ5A 3P5JC 3PPKA 3U6HA 1IA9A 2W1CA 3FMLA 4AOIA 2VTLA 3MIYA 5CSVA 3I7CA 3OZ6A 4APPA 3SVVA 5F9EA 3ORIA 4DEHA 1TKIA 2PYWA 4DDIA 5GJDA 3O50A 4O7TA 1YOMA 2C69A 1Q4LA 2H34A 4AT3A 4DINA 2A1AB 5KBRA 5BUJA 2BFXA 4BCQA 2ZV9A 3A7HA 4PL3A 3EJ1A 5F4NA 2R64A 2G1TA 3RK7A 5ANGA 4CNHA 4CMTA 2PMNX 3QRUA 3W2RA 4MD7E 3UOJA 3E64A 3E8DA 3HNGA 1M2PA 1YDRE 3KRLA 3EN5A 3LOKA 3GCPA 4W4WA 1KWPA 2F2CB 3GU6A 4G34A 3KREA 3GQLA 5IQHA 3FI8A 4FKVA 4W4XA 2EVAA 4UV0A 1BL7A 5BYYA 4FI1A 3UO4A 3OROA 5L2SA 4JJRA 4C58A 4DFXE 2BIKB 4KWPA 5EYDA 3TG1A 2WMRA 2J9MA 3JVSA 4JT3A 4NM3A 1FGKA 3P4RC 5LCJA 5IQDA 4TY1A 5IA0A 3E3PA 4G6LA 2W4KA 3FMHA 4GH2A 4LM5A 4FYOA 4XG2A 3VW6A 1JLUE 2UW0A 4YC3A 4YTNC 2VWUA 4FG7A 2V7AA 5EQPA 4FV7A 4UWBA 5JKGA 2OIQA 5AEPA 2CLQA 2WQEA 3HYHA 4PX6A 4AP7A 3LPBA 4JG6A 2QOLA 4TNDA 3BLQA 4LRKA 2WQYD 3UZRA 4ZK5A 3TWJA 3WF5A 3W0OA 4HW7A 5CXHA 5M53A 4OTDA 4EI4A 2OZOA 4O38A 1Q3DA 4O96A 3ORZA 2WMTA 4DCAA 4E8AA 4YJUA 5HEZA 4FSNA 3RINA 2WS3C 2VU3A 3UIXA 3ZO1A 5K5NA 4EOSA 3MB6A 3QCXA 4IWOA 5DYJA 5CEOA 3F5UA 3TCPA 5HBJA 4WG3A 2G2HA 3KRJA 1YQ4C 3EZVA 3ORNA 3QGYA 2CGVA 1Q8YA 2DUVA 3HP2A 3UGCA 3NW5A 4PNIA 1KE9A 1ZMVA 2ZV7A 2QVSE 3OVVA 4LFIA 4RPVA 4TYHA 3CJFA 2WU2C 5KZIA 3UDZA 3R30A 4ACDA 4E93A 4R7BA 3PSCA 3SW7A 3SAYA 4GKHA 1JOWB 4K9YA 4AOTA 4FIIA 4U43A 2Z8CA 4XHKB 2BFYA 3F7WA 4ZSLA 2VO3A 4GCJA 2XM8A 4CFWA 2QI8A 3UP7A 2X9FA 3GFWA 5HD4A 3MY0A 1GJOA 3VBTA 4AT4A 4PDPA 3N4TA 5KKRB 4EUTA 1Q41A 4TN6A 4KINA 2VTRA 3DXPA 3FBVA 4EH6A 3SXSA 4Y8DA 2FBWD 4DN5A 3TZ9A 1OIUA 3LMGA 4FJVA 3QKKA 2CCIA 5ANEA 2P0CA 5DT3A 2VWZA 2QO2A 4XG8A 3V5LA 1QPJA 4ASZA 5IA3A 2A0CX 4FTIA 2ITTA 3KULB 5DRBA 3BGZA 3T9TA 2ZMDA 2B0QA 4FKSA 3CSVA 3VJNA 4G1WA 4C34A 4CG8A 1KUTA 2H88D 2XYNA 2YCQA 3F5PA 1APME 4MBIA 1LPUA 4DT8A 3ZS5A 2J4ZA 4IM3A 5CEQA 1ZY4A 4ID7A 3HAVA 3UYSA 1FINA 3P78A 3LXNA 2QC6A 2BMCA 5AAGA 1H07A 4E4MA 1W98A 5L2WA 1YQ3D 3ABVD 4QNYA 2XK4A 5A4CA 1XMLA 3O5AA 4HPUE 4XP0A 3SFED 1LEZA 3PJ8A 4RA4A 4YLKA 4FIGA 1Q8UA 4PDYA 2E9PA 5L6WL 3MS9A 1MRUA 2WTWA 4O86A 5LWNA 3UDSA 5A6OA 4AN9A 1K9AA 3NGAA 2IPXA 2LGCA 3KRXA 4M84A 3VS5A 4EH9A 1G8AA 3W10A 4EK5A 3CD8A 4JX7A 4BZOA 1OVEA 4EC9A 4RZVA 1Q62A 2PVMA 2HWPA 3D7TB 3VUHA 3ZFYA 3GCQA 4PDOA 2BRGA 4TT7A 5I9ZA 5F1ZA 2WTDA 4L8MA 4BBMA 4YZNA 1XMMA 3P23A 5E8VA 3W2QA 3R7YA 4DLIA 1H1PA 4ALWA 5A14A 5FG8A 2FBWC 1ZAOA 3BE2A 2R5TA 5ETIA 4S31A 3RALA 4JL9A 2VTHA 3DNEA 4AXEA 2F49A 2CGUA 2I7QA 3BI6A 3QTSA 2UZWE 4C35A 1YRPA 4WG4A 3QTQA 3DZOA 2HZ0A 2W0JA 3VQUA 3WZEA 1J3HA 4LV7A 4FEXA 4FX3A 1CTPE 3CCNA 3R9RA 2IW9A 4BDDA 5CTPA 2W7XA 3CLYA 4DGLC 5IEVA 5IA5A 3MA6A 4IIRA 4BYIA 1UWJA 2XNOA 3A99A 5HGIA 4IZYA 4RJ3A 2P3GX 3VS6A 2YIRA 4I5HA 4RFYA 3FZSA 3RAWA 3UPZA 4O7YA 4IH8A 3OY3A 3FQEA 2OJGA 4FL2A 4EH7A 5JRQA 5DN3A 3D15A 2XAMA 1YQ3C 2XEZA 3EQPA 4LV8A 3AE1C 2W1HA 1ZZ2A 4UBAA 2E9OA 4CD0A 3NFFB 2RGPA 3ZSHA 4GT5A 5CVGA 4BI0A 4QMXA 5DWRA 3ZRMA 4TWPA 1JSUA 4MCVA 4HGTA 1PKDA 4RX9A 1L0VD 1Q5KA 3SDJA 4EZ5A 1H1QA 4N0SA 3R7IA 4I6QA 3W32A 4FKWA 2XYUA 4N6YA 3CXWA 2XK3A 3TJDA 3UOLA 4O7SA 3CY3A 4X7QA 2PVNA 4HPTE 4BCPA 3AT4A 1IAJA 2VTIA 3FPMA 3Q9YA 5CI6A 4QP8A 1WBPA 2R0IA 3G2FA 3K5UA 2HWOA 4YC8A 4RT7A 4MVFA 5HVKA 2XBJA 3QD4A 4GK3A 4IBMA 1YI4A 5HI2A 3VS3A 1AQ1A 5BQ0A 3SXFA 4RQVA 1NY3A 1YWVA 4LOOA 2Y7JA 1PYXA 3UOHA 4IAYA 2IW6A 2E9VA 3PXZA 5CT0A 4PRJA 2QNJA 2W4JA 4V05A 2XIXA 1PXKA 3PPZA 4GEOA 3R83A 2VWIA 1XBAA 4DFBA 4ANMA 3EYGA 3M2WA 4J71A 2FSMX 3DLSA 3D7ZA 3TIZA 2W5HA 1F0QA 3V5JA 1Q97A 3DU8A 4IADA 4M3QA 3IDCA 4AZTA 2FB8A 3I1AA 2OKRA 3FC1X 3HVCA 2BRBA 2UVZA 1UNGA 3PZEA 3PXKA 2XP2A 5HORA 4PP7A 4KIQA 3MYGA 3VRBC 2VX3A 2OXXA 2WMUA 2XNNA 3EOCA 3ORTA 4JDHA 2PUNA 4C2VA 3R2YA 3D4QA 3AE8C 3VBWA 4TKSA 1XH5A 4WOVA 2VTNA 2BILB 2C0TA 3FY0A 4AT5A 5DH3A 5HIEA 3BL9A 5JMSA 4AA5A 5TF9A 5IUGA 4BJJB 1WBTA 3F3UA 5HTBA 5FDXA 4ZMEA 4Q5HA 4NL0A 4CKJA 4F9WA 4OTIA 4EEVA 3DJ6A 4II5A 2DWBA 3OXTA 3SC1A 2DYLA 4MXCA 3ZFMA 1GZ8A 4IE9A 5ICPA 2VTMA 5JFSA 3U6JA 2C6DA 3C9WA 2YHVA 2ZMCA 3AEGD 5EM6A 3ODZX 4CRLA 1G8KA 1XH6A 3GENA 1OGYA 3IECA 2VX0A 3FMNA 4HNIA 5DLSA 1BMKA 4JDJA 3ZYAA 3QALE 3RGFA 4IX6A 1X8BA 4CFFA 1KOAA 3WZJA 2BDJA 2W9ZB 3OBGA 4BC6A 2IZRA 3BGPA 4FIFA 4FTMA 5B2KA 5KBQA 4BTJA 4TRLA 3VULA 5HQ0A 2GNLA 1QLBC 2WTKB 2BS4C 5M4UA 4XV3A 5E1SA 3BU5A 4YTIA 2JIVA 1ZYCA 2JFMA 5FLFA 3D83A 4AQCA 3F2RA 2WD1A 3C50A 3G0FA 4IZAA 3PSBA 5H3QA 2CKEA 4YO6A 5CENA 3UPXA 5A6NA 5M08A 4YSYC 4J97A 5DOSA 3ZSIA 1Z9XA 2XUUA 3PJ1A 1XBBA 3C4XA 4WG5A 3DBFA 4X3FB 1FVRA 4A9TA 4IWDA 2HW6A 3TNPC 4BGGA 4AAYA 4GG5A 4PDSA 3C5UA 4I5MA 2ITVA 1OL1A 3OUKA 4DEBA 2OW3A 2YM8A 4LUEA 4XMOA 1YDSE 3BE9A 3AECD 4MBLA 3ZLSA 5C4KA 5HU3A 3UQCA 3D5XA 2C47A 1Z5MA 3UP2A 4YJOA 3ZBXA 3TNWA 3R71A 2CNUA 3HRBA 4XV1A 3UIUA 3WF9A 5M56A 4BBEA 1PXPA 3PVBA 3I5ZA 4L01A 1KV2A 3BWFA 2GQGA 3U4UA 3AC1A 2EXCX 4E5WA 4ORKA 5LMKC 3QTZA 5C03A 4F0FA 5A4LA 1U4DA 3WARA 1CM8A 1J7IA 3A7JA 2QR8A 3CD3A 5FGKA 4XG6A 5CSWA 3F82A 5BUEA 1O6LA 2OJJA 3FYJX 3FJQE 3II5A 3MY1A 2QOBA 2EB2A 3DTWA 3QC4A 4QT1A 2UW5A 5EYMA 5IQCA 3OTVA 4YURA 1KOBA 3RK9A 3AE2C 2R3NA 4ZTHA 5CASA 4FT7A 4BBFA 4FT5A 3PLSA 2YM7A 4V0GA 3BYOA 3A7GA 2OSCA 4JBQA 4L68A 3RPOA 2G15A 3UO6A 3MJ1A 1CKIA 3PXRA 2VWXA 4GFGA 4XG9A 3KKVA 4NCTA 1QPEA 1FMOE 3DBDA 4AW2A 4I20A 1Y91A 1R0EA 3BYUA 1U54B 3G33A 2XMYA 2GTNA 4FNWA 4QP1A 4NIFB 4R5SA 1S9IA 3AE5C 3P4QD 2X81A 3CY2A 1V0PA 4IMYA 4U42A 4O7NA 4U97A 2ETRA 4M7IA 2XEYA 3GOKA 4M97A 4F9AA 1M17A 2ZDTA 3Q4TA 1TVOA 3W2OA 4O2ZA 3AE3C 2FSTX 3LFQA 3LFEA 3NX8A 3LKMA 4X3JA 1OMWA 2C5OA 5A4TA 2R7BA 4KBKA 4H1MA 4IX3A 5IEYA 2PPQA 3W16A 3NUUA 3JY9A 4C61A 2JKKA 2WQBA 4DT9A 2GMXA 3EWHA 4GK4A 3RNYA 4BIBA 1PXMA 4FIEA 4C4GA 1BL6A 2BPMA 4ZEGA 5H8BA 3PY3A 4ASEA 1NA7A 4R1VA 5FTQA 2WU5D 1M52A 4LRMA 4W4VA 1VZOA 4G3EA 1H01A 1OL7A 3FL5A 5ANDA 4EZ3A 4UB7A 2O2UA 5C3JD 5FD2A 4FTUA 1NEND 4ZLYA 2OXDA 4U6RA 5AIKA 2WFYA 3LAUA 4NTTA 4ZY6A 5H8GA 2GNGA 2A27A 4RIWB 5B0XA 4FGRA 3MH3A 5KZ0A 4AX8A 3U55A 3VAPA 3O7LD 2IZTA 4DFZE 5LJJA 1H0WA 3KRRA 4O22A 4BTMA 4BCHA 2P2IA 3E92A 4YSXD 4J53A 4RX7A 2XCHA 5HVYA 3Q9ZA 3F3ZA 2B7AA 3OCTA 3AQVA 5ETCA 2JDRA 3QU0A 5DG5A 3T8OA 5AAEA 2X0GA 3PA4A 1JSVA 3S2PA 4KRCA 3BGQA 3UQGA 3E93A 3AEFC 5AV0A 4XOYA 3C4WA 1DAWA 2VWVA 3JYAA 4H3PA 4F6WA 1WBSA 3LFCA 3TI1A 1IEPA 2Z7LA 5CF4A 2PMOX 3PE2A 4I0RA 4I21A 4RWJA 2RFSA 2B54A 4O7WA 3ORXA 1B39A 3NZ0A 2OH4A 3I6UA 3OWLA 3I81A 3R63A 2WDQD 5AP3A 4IVBA 4MXYA 5ACBC 3I4BA 4AGUA 2PWLA 2R3HA 3IDPA 2RFDA 4TWNA 4CZUA 4F6SA 3NRMA 2C6IA 2ONLA 1MUOA 3KRWA 1URWA 4QP3A 2UW3A 2QKWB 3S3IA 4GJ3A 3BX5A 3FV8A 2GPHA 4XUFA 2BAJA 2B9JA 4JQ8A 2W5BA 2PUIA 1H8FA 1OM1A 4U81A 4IB0A 4K33A 2I0VA 4L6QA 4ZAUA 5T3QA 5LMBA 3UNKA 3NYOA 4RC2A 3GC0A 5AP7A 4Y95A 2VTOA 4D9UA 3QTUA 3QRIA 3ZUVA 2CSNA 5C3JC 4FV6A 5EM8A 2ITZA 1NENC 2ZV8A 3OXZA 5L3AA 5J1WA 3Q32A 5EKOA 2JDOA 2LAVA 3AXWA 1PJKA 4A7CA 3Q4CA 5LARA 4IFCA 3R21A 1MRYA 3MH1A 4C37A 4BDKA 4I4EA 4R7IA 3FYKX 4GFMA 3LQ5A 4U44A 4C38A 4DLJA 3IS5A 4WUNA 1Q61A 1GIIA 3QTIA 4NCTC 4JAJA 1QCFA 3ALNA 1CDKA 3H9OA 4ZIMA 4YSMA 3IPHA 4G3GA 4FT0A 1GOLA 2ZV2A 2WMQA 1UU3A 5J8IA 3UNJA 1GY3A 2JKOA 3Q2MA 1UU7A 3SRVB 4HYUA 4TYGA 4RC3A 4RLLA 2YACA 5DT4A 3P4PC 2PL0A 3VRZA 3W0QA 4DG2E 4FV3A 5JEBA 5J9YA 2XALA 4PMTA 3TNHA 2NPQA 4FIHA 4NJ3A 3H30A 2IO6A 4C7TA 3CE3A 3KULA 3RZBA 3FKLA 4O0YA 4ACHA 3V5QA 2C1AA 4CMUA 3UE4A 1A48A 2CHLA 5E8XA 4CCUA 3NUPA 2NNWB 4BTFA 2UW7A 3EL7A 4FEVA 3PVWA 4AZFA 4CV9A 3QD3A 1AGWA 4FTCA 4QQTA 1RW8A 5M4CA 3G9NA 5EOLA 3OEFX 1XHAA 3VR9D 3HRCA 3H9RA 3NEWA 5CI7A 4YNEA 3W0SA 4QP9A 4MUQA 4PF4A 2PMLX 2RFEA 3D5VA 3W0RA 2UZTA 3ZO2A 3C1XA 4UY9A 3TV4A 4M15A 5J1VA 3DBEA 3O8TA 4MD8E 1OKZA 3RAIA 3AEAC 1FVVA 3VBXA 1XH7A 5AJQA 3W0NA 5D7AA 3H0ZA 5HESA 3F61A 2XF0A 4M8TA 4BDCA 2GDOA 3PVGA 4O27B 2GHGA 4FODA 2WMVA 5A3XA 3M11A 3MN3A 4F7NA 4S33A 2VD5A 5E8SA 5JH6A 4NFNA 2XIKA 3LXKA 4F7LA 2CNQA 2BR1A 1FBNA 4QTDA 3I5NA 2OJ9A 3D7TA 4RX8A 2KULA 4FG8A 3AE9C 2YISA 5BNJA 5CXZA 3MFUA 4HVDA 3CPCA 3UIBA 4CCBA 3O51A 3R8LA 2ITNA 3R8MA 1TQPA 4E7WA 4JBVA 2R2PA 1NVRA 3AE7C 3NUSA 4QTCA 4EOLA 3PJ2A 3W2SA 4K18A 3QA8A 4TWCA 4BVUA 5DE2A 4FK3A 3RTPA 3TEIA 1M14A 3TV7A 2WQNA 2H96A 2ONLC 4RJ4A 4X2KA 4NT4A 4OT5A 2VO0A 1A9UA 4EH2A 4GT4A 4U0IA 5EOBA 3QWJA 2VTJA 4O6EA 4I5CA 5IQIA 4FTLA 5EDRA 4YJTA 5HE1A 5BMMA 4AOJA 2Q0BA 4U41A 3PXQA 2CJMA 3LIJA 3FI3A 2W06A 3BQRA 1Y6BA 4CGAA 2XNEA 4IACA 4IANA 4L3LA 4U3YA 4DH7A 4I3ZA 4IVCA 3K54A 3EQCA 5E8TA 3MIAA 4DEGA 4GYGA 4EOJA 3P9JA 3OW4A 4MBJA 5EFQA 3FZTA 4FV4A 5HICA 4DG3E 4WNOA 4IM2A 1URCA 3BYMA 5DPVA 4DHJA 2JDTA 3H9FA 3G9LX 4XRLA 4D55A 4KD1A 3AKLA 2O63A 1M7QA 3GQIA 3KEXA 3VHKA 3F9NA 3ZOSA 4EJNA 4F4PA 4YZ9A 4G16A 5DNRA 3S95A 5CU0A 3DB8A 3PIYA 4G31A 1O6KA 3HECA 5AIRA 3F6XA 3GU4A 3ROYA 4RWLA 1SNUA 2VGPA 2WMAA 2PVLA 3R7VA 3BEAA 3DAJA 4DGMA 4FL1A 2W4OA 4PTCA 3SXRA 2REIA 3OF0A 4P5QA 4XJ0A 3R7UA 3FHRA 3MDYA 1REKA 3QQJA 4R6VA 2Y4IB 1PMVA 2RF9A 3IW4A 4OTGA 4B9DA 4IZ7A 4E6CA 3PPJA 2XH5A 1MRVA 5CU3A 3CP9A 4EJ7A 3MVJA 1OL5A 4FV5A 4ENXA 5IISA 4RWIA 2CDZA 5CU4A 2EWAA 3Q96A 4S32A 4FKJA 3R1SA 4BHNA 5AUVA 4NJDA 4YTND 1J1BA 4IW0A 5GIOE 3C0HA 2O3PA 2UZNA 3P79A 3OOMA 4BDEA 5HHWA 2ITQA 2J0KA 3PRIA 3VBQA 2IW8A 2J0JA 5EHYA 1PW2A 4ZTQA 3A7IA 4HYIA 2JBPA 4JVGA 3KL8A 2C0OA 1YXSA 2GNIA 2UZLA 5FUTA 4AN2A 4QMYA 4OT6A 3THBA 5GHVA 3QHRA 3BZ3A 2QKRA 3RP9A 5AP2A 4RWKA 3R7OA 4UXLA 4D9TA 4BJJA 3I79A 4XG4A 4ACCA 2FYSA 2VUWA 4FUYA 3P86A 5D10A 3JS2A 2WS3D 1Q3WA 3HX4A 5AP0A 4ERWA 4IZ5A 3DLZA 1YKRA 2OWBA 4UZDA 4I0SA 2BRNA 3FXXA 3IW7A 3MFSA 3NUXA 3R04A 3FAAA 4FTRA 5CF5A 1YQ4D 1OITA 3DK7A 5DR9A 2H8HA 3AC2A 4AN3A 4RJ6A 2WU2D 2YJSA 2BDWA 3PE1A 5M57A 4AW5A 3IW5A 1GIHA 4HYSA 4QMPA 1BLXA 3R1QA 3MGYA 5IQFA 2PMIA 3QGWA 3KF4A 3O8UA 3TTJA 3AT2A 1FPUA 2WKMA 2XK9A 3IONA 3BLRA 5A9UA 4C62A 5CX9A 2VV9A 4ASXA 1P4OA 3UOKA 1ND4A 2VWYA 3UVQA 4L46A 4I4FA 2JITA 3P7BA 5FEEA 3BPRA 3OUNB 5IPJA 3NFGB 3ZLXA 2UW4A 4FV2A 4FYNA 4ARKA 2W5AA 2JDSA 1UWHA 5IZFA 2OBJA 4QOXA 2G9XA 1M2RA 3ETAA 4MYGA 3W2CA 4I93A 4PTEA 4YHFA 3GNIB 3JR1A 5HO8A 3FEGA 3BEGA 3NAXA 4PNKA 4RQKA 4JOAA 3QQFA 2BTRA 4NW6A 4RRVA 2GU8A 2H89D 3BYVA 2XIRA 4OLIA 3I6WA 4DFUA 1CKJA 3OWJA 2HIWA 3NYVA 1V0OA 5EW8A 4FSWA 4DH5A 3CQWA 1Q8WA 3D14A 1P5EA 4D58A 2G01A 4JS8A 4EC8A 1RJBA 5HX8A 2PE2A 5AP5A 2CMWA 2HZIA 3FKNA 3HDMA 4F78A 3SFDC 3M42A 4JR7A 4NM7A 5JZJA 2GCDA 5KHWA 4YJPA 2WQOA 5M55A 3Q53A 5JQ5A 5EYKA 4JG8A 5AP6A 4U79A 3FKOA 3ZSGA 1Q24A 1G3NA 3LQ3A 5EM5A 2B53A 3ZC6A 3D5WA 4LOPA 2PVHA 2A2AA 2VTSA 3P7CA 5ANOA 3LXLA 3CQUA 3LM0A 3ZZEA 4YJSA 3DNDA 4FKTA 4OBQA 2OJIA 4D5KA 2J51A 2GS7A 4FZ7A 2WTVA 4FSMA 3OW3A 1OB3A 5AP4A 3GOPA 4BKJA 4NSTA 5E7RA 5L8JA 3QZHA 4XG7A 2WQMA 4ACMA 2V22A 4FEQA 3EIDA 4ZJJA 3FLWA 5ITAA 4RJ7A 1QL6A 4AGWA 4D4SA 4ZTNA 1UU8A 3BLAA 4GT3A 1UNHA 3C0GA 3HMNA 3ZH8A 3PIXA 3R9HA 3V8SA 4PY1A 2PVFA 3WIGA 4H39A 4MX9A 1U54A 4L45A 2QHNA 3C4CA 2F7ZE 3ENHA 4XP3A 3C0IA 3FLSA 3DPKA 2H89C 1ZXEA 3BYSA 4FSTA 4HZRA 3WOWA 4BDFA 2UUEA 4O82A 5JRSA 2XAOA 3T3UA 1MP8A 4YSJA 2O64A 4FTJA 4KIOA 4FEWA 4M67A 4RIYB 4J8MA 4M0YA 3R9DA 1PRYA 1UA2A 2YJRA 1KE6A 5L6PA 2ZOQA 4LL0A 3AE1D 2I0EA 3ERKA 1PXIA 2WIHA 3OCSA 1KF6D 2X4ZA 2XJ0A 2XJ1A 3GC7A 2C5XA 2WMSA 2Y4PA 4L3PA 4DGGA 2QO7A 5K9IA 3NCGA 4TYIA 4KS8A 3TXOA 2VTPA 4IM0A 3DKFA 3HMPA 5E8WA 1KSWA 4E6DA 4USFA 1R3CA 3FWQA 1GZKA 3EZRA 4FSUA 5K5XA 3UZTA 5HG5A 5BUIA 3H3CA 2WU6A 3ZMMA 5EHLA 2F57A 3R8VA 4UWCA 1U46A 2ZDUA 4AZSA 3VWAA 1R1WA 2PE1A 3HV5A 4WNPA 3QCSA 3O23A 3NUAA 5D11A 4GJ2A 4CFMA 1CKPA 2AYPA 2ITXA 4FT3A 5E91A 4F6UA 3NVKI 5ANJA 4ZJVA 4M12A 3KK8A 3ZXZA 3NUYA 4GV1A 5CQUA 1VEBA 2UW6A 2PU8A 4X6QC 5CZIA 3FMJA 4N70A 2X8EA 3LJ1A 5HTCA 4YHTA 3FMKA 4QMVA 2OK1A 3DZQA 2B9IA 3GCSA 2XKFA 3R01A 4FTTA 3PY1A 5IQGA 1VR2A 2PE0A 4FKUA 3VIDA 1OL2A 2X6EA 5IUHA 3VF9A 4WRSA 2JAVA 1WFCA 4ZTMA 3PWDA 2ZB1A 4J98A 5AUYA 3PDTA 4K2RA 3VRBD 1ZY5A 4NU1A 2J50A 4O7RA 4YJRA 5KMMA 4GKIA 4L44A 1OUKA 4F9CA 5I4NA 3AE8D 3DB6A 4FC0A 3UIMA 5C8KA 3DDQA 4Y85A 3BRBA 4B4LA 3AG9A 1KF6C 3V6SA 4QEBA 4WHZA 3KY2A 2VTAA 2BTSA 4GU9A 5IEXA 1XH8A 4Q5EA 4YSZC 3KXNA 4TTHB 4C0TA 4QYGA 3KK9A 2GHMA 3PXYA 2ZJWA 3E88A 3RK5A 1O6YA 2QOIA 2XK8A 3ACKA 3OWPA 5LXMA 3G51A 2O65A 4QMSA 3L1SA 2CNVA 3KCKA 3O8PA 4QTEA 3RKBA 4YR8A 4DBXA 2C6MA 4LL5A 3VQHA 3EQBA 3KQ7A 1EH4A 3F5XA 1WZYA 3BU3A 5KX8A 4JDKA 3PZHA 4C33A 2FVDA 5AUTA 4DTAA 5JN2A 5CNNA 5B7VA 2W1ZA 4YT0C 3MBLA 5EG3A 2WMBA 3TM0A 2CN8A 4RIXB 2BRHA 4IVAA 5EH0A 3UTOA 4FTOA 4IQ6A 4G3FA 4AZWA 4ZLOA 3ORLA 3S0OA 5ANIA 4KS7A 4DC2A 4FV0A 3V8WA 2P33A 5FEDA 4XX9A 3IK3A 5L8LA 3BV3A 3QBNA 2OF4A 3NSZA 5DA3A 3GBZA 3SG9A 3TYKA 3WIKA 4YSYD 4CKIA 3KU2A 4DGNA 3SRVA 4FNZA 4UEUA 2JIIA 4GMYA 1YWRA 4ITHA 4NKAA 3FZ1A 3IOPA 4K0YA 1JBPE 1H08A 4FA2A 4N6ZA 3AC4A 1G5SA 4JBOA 4NTSA 1H24A 3HMOA 2KTYA 2W99B 3RVGA 2W1IA 3RWPA 4AA0A 2ACZC 4ITJA 5AX9A 1ZRZA 2IZSA 2QCSA 2VWBA 2YM3A 3SV0A 3ZRLA 4BCOA 2UVXA 4DYMA 3BBWA 3PTGA 2FUMA 5E8YA 3D94A 3F69A 5E1EA 5BVKA 2BIYA 4W4YA 4I24A 3BHYA 3V6RA 2WDRC 4D1XA 3O0GA 3TN8A 1HCLA 2HZNA 2X7OA 4B0GA 4UZHA 2G2FA 4AXFA 4S30A 3M1SA 5EI2A 4ZZNA 3Q6WA 1PF8A 4BGQA 5HE0A 5CANA 1YXXA 5HO7A 4BYJA 2HXLA 2W05A 3R9OA 1M7NA 5LMAA 4TZRA 3CC6A 3ULZA 5C4LA 4V04A 1O9UA 2XARA 3VUIA 5E92A 5HE2A 4EORA 4YTHA 2QOHA 4F63A 3SHEA 3SD0A 3Q3BA 4J7BA 3VONA 3ANQA 3AE2D 4MQ1A 2PUPA 5BVDA 3CIRC 1H1WA 4APCA 3N51A 2C6OA 4U45A 5CAVA 3EFJA 3VN9A 2R3JA 2J5FA 2YDJA 3TUCA 2OIDA 2PVJA 3CJGA 3GU7A 1BUHA 5KMNA 2WAJA 1YVJA 4F65A 3KMMA 3FMMA 3R28A 4F1MA 4LUDA 4IX5A 4X6RA 3ATTA 4YU2A 2XK6A 3C13A 4WUAA 5JQ8A 5L6OA 1K2PA 4EYMA 4EOOA 3AE5D 5A46A 4F9BA 1WMKA 1XO2B 3RHXA 5M51A 2R3QA 3UZPA 4IAAA 3LMIA 4KUJA 2CGXA 5HIDA 4YPSA 3PRFA 4M69B 5FRIA 4F7SA 3AE3D 2BS2C 3MWUA 4E4XA 3B2WA 5IH6A 3PG3A 2C5VA 2FGIA 2B4SB 2WEVA 3LFAA 4P4CA 4ANSA 1H26A 4AG8A 4FICA 4FUXA 4UWYA 4QMWA 4WA9A 5CT7A 3TUDA 4XNEA 3ZXTA 5AADA 4RSSA 2X6DA 2OF2A 2R7IA 2BALA 4HCVA 1NXKA 4RMZA 3FLQA 3TNIA 3VBYA 4AZVA 4DTKA 3WE4A 4EHZA 5AA8A 4XLVA 3Q9XA 3HEGA 4YHJA 3MV5A 2XM9A 4F0GA 3CTQA 3VHEA 4C4HA 3Q9WA 1DI9A 4EHEA 5HKMA 2YA9A 2ZYBA 3PA5A 3AKJA 4H3BA 3N4UA 3PXFA 2DQ7X 5JGDA 5E8UA 4TNBA 3G6HA 3E62A 3KN6A 3PUFC 3O96A 4WBBB 4FIJA 4ZY4A 4CLIA 4L3JA 4EHVA 3AE4C 4J99A 1A06A 3TT0A 5BMSA 3V5PA 1FQ1B 1GNGA 2GS2A 3L8VA 2X9EA 5CVHA 4DHZA 3P08A 1R0PA 3Q2JA 3GC9A 3W8QA 3U6IA 3ZUUA 3BU6A 3AEFD 1H1RA 2YIYA 3EN6A 4EOQA 2ZM3A 4Z3VA 3I0OA 2OXYA 2Q0NA 1KFYD 2J2IB 3CR0A 2XKCA 5TO8A 5IA4A 1W82A 1ZLTA 3VUGA 2QONA 4WT6A 3WYXA 4YJQA 2I6LA 3QKLA 4ZJIA 3P4SD 5DRDA 3AMBA 3NR9A 3ORPA 4E73A 5JFXA 2EB3A 4BDIA 1JVPP 1VJYA 4FGBA 3IO7A 5J9LA 3IDBA 3QXPA 1R78A 3GU8A 4Y5HA 5JFVA 2VTTA 3PWYA 4GSBA 3VVHA 3LCDA 3Q52A 5AP1A 4R77A 1P14A 4DF3A 3QUPA 4YTMC 1WBOA 4AWIA 4F64A 4CFNA 4IB5A 3QTXA 5HLNA 4HZSA 4KX6C 1XQZA 4LGHA 4RVKA 3OFMA 4U5JA 3AEED 2W17A 3RM6A 1J7LA 2XRUA 1YDTE 3SX9A 1G8JA 4NM0A 3BKBA 4KBCA 2W96B 4G9RA 4EWHA 2ZM4A 4CLJA 1I09A 4JBPA 4DDGA 3HP5A 2ITUA 4KKGA 3F3VA 1ZOYC 2OH0E 4AXCA 1VYZA 2X2KA 4FKPA 2IJMA 3NS9A 2C6KA 3QQHA 1UV5A 3FC2A 1JPAA 4U40A 5HCZA 3EQDA 4AS0A 4O2PA 4EK6A 3KCFA 1TFFA 4NFMA 1TQMA 2F9GA 4YMJA 4IDTA 4A4XA 3IW8A 3A2CA 2ITWA 3ODYX 3NDMA 5AM7A 2B1PA 2BHHA 3UG2A 2YAKA 3H4JA 4IDVA 3HA6A 1XKKA 2OO8X 3CGOA 5G6VA 1KFYC 4ANQA 4ZSEA 3L8PA 2PVKA 3FZPA 4QP7A 1SVHA 2C3LA 4JXFA 3P4PD 2FSOX 3SW4A 3P4SC 5HD7A 4EZ7A 4FOBA 4JAIA 3HV7A 5AV3A 3KVXA 3FL4A 1IAHA 3DDPA 4AZEA 2XA4A 4EONA 3CKXA 3RWQA 3A60A 3W0PA 1OECA 2X2LA 4MHAA 3HMIA 3TZMA 5AX3A 4IC7A 4DHFA 4E20A 3AGMA 4U7ZA 4MKCA 2R3MA 1LUFA 4D4YA 2OGVA 3QQGA 3QLGA 4JX3A 2DS1A 3EFLA 5BVNA 2P55A 3OD6X 5FP6A 4BHZA 1DM2A 1YHVA 2XIYA 2YCRA 3AEEC 2UV2A 3D9VA 3LFSA 4X2GA 3UQFA 4DBNA 5I9XA 2ZFYA 1U5RA 1SVEA 3JUHA 4JDIA 4KKEA 1OBGA 2XS0A 3FLZA 3FLYA 3Q5IA 3WZUA 4CZTA 3AEAD 5LVNA 3V5TA 5HBEA 5AUWA 4CTCA 5M09A 2VNYA 1B38A 1KE7A 3ZC5A 1J91A 4Z7HA 5CAOA 1LR4A 4FSZA 3O2MA 3T9IA 1Y8GA 4EOIA 4Z7GA 2YCFA 3HLLA 5CALA 1ZP0C 5EQYA 3EFWA 3BL7A 3ET7A 4PMSA 4OUCA 4OTWA 3QD2B 4AW1A 3IGOA 4JI9A 5FXRA 4F1TA 2C5YA 4D5HA 4BCFA 2B52A 3AE9D 3HA8A 3BELA 4GRBA 3F5GA 4G9CA 3S1HA 4DCEA 2QOQA 3GFEA 3NCZA 3FSFA 3WILA 5L2IA 3EQRA 2WP9D 3RPYA 3SLSA 4A9RA 4AA4A 3G90X 1JNKA 3RPVA 3W2PA 3AE7D 1BI7A 4ALVA 4ENYA 5D41A 4F9YA 4MNEB 1YOJA 2Y0AA 4U8ZA 3BIZA 4DFYA 3FI2A 1H0VA 4ZZMA 3KB7A 4HOKA 4I94A 4RA5A 1Q8TA 3AC3A 3COHA 4O0TA 3U9NA 4AE6A 5B2LA 4X2NA 3S00A 3HUCA 2XKEA 3GCUA 2RG6A 1IA8A 2QOCA 4BDBA 2JKMA 5EYCA 5IH4A 1ZOGA 3IKAA 4IJPA 5HLWA 3K3JA 5A4EA 3KMUA 4AGCA 5C2TC 3ZRKA 4RIYA 1NEKC 4B99A 5AA9A 4LQMA 3FSKA 4FR4A 3BHHA 2JDVA 3H10A 3NIEA 4NZWB 4U80A 5EI8A 4ZS4A 4QPSA 4TPTA 3QYZA 4F08A 4O0RA 3EQIA 5BVWA 4KAOA 3OG7A 3NAYA 1PYEA 4ZS0A 1UKIA 3NMUF 4GK2A 4HCUA 5AM6A 3MVLA 1ZYSA 4IWQA 3UG1A 2AEGA 4DFLA 4DEEA 3QZGA 2VAGA 3R8ZA 3U4WA 4YJVA 3I7BA 4C2WA 4EH8A 4EYJA 2NYAA 2FSLX 3VUDA 2X7GA 4G6NA 3HV6A 1DI8A 5D7VA 2H9VA 3MI9A 4X2FA 5M44A 3ZDUA 2R3KA 4XBUA 4J8NA 3DXNA 4MAOA 5CEKA 1XBCA 5I9VA 3EHAA 5EQEA 5JFWA 3SOCA 4CXAA 1OKWA 2OZAB 2WP9C 3AT3A 3R02A 2YZLA 4EK4A 3G6GA 5CF6A 3NYXA 2QURA 3REPA 5LVOA 2WDVC 4A06A 4ALUA 2QU5A 4ACGA 1ZARA 2WHBA 4FL3A 3NNWA 4DEIA 3BV2A 4KKHA 4CEGA 1RQQA 2VGOA 2Z7QA 5M07A 2XNGA 4IJ9A 1NVQA 4XBRA 3RCDA 1F3MC 4ZTSA 2NP8A 4GFOA 5CU2A 4W8EA 3RM7A 3ZZWA 4EOMA 1U59A 3OTUA 3VS1A 3COKA 3PP1A 2JEDA 3EN9A 3TZ7A 4D2SA 4MWIA 2A19B 2YWPA 5E90A 1QMZA 3ZM4A 2JGZA 1OPJA 2UZDA 4O0SA 4RC4A 2V7OA 3WI6A 5IH5A 3NUNA 3QZFA 4G5PA 2VTQA 4RZWA 3WZKA 3CGFA 3LVPA 5AAFA 3RMFA 2PULA 5EM7A 4CFUA 4L43A 3W0MA 2RIOA 4AFJA 5CAUA 3HZTA 4JRNA 2Z60A 4CFXA 3I0QA 3V51A 4GVJA 2R9SA 4BCMA 4E6AA 4E26A 4YZBA 5BYZA 2I0HA 2NO3A 3L9PA 5GJFA 4AFEA 3DT1A 2QG7A 5HBHA 4RGJA 4CQEA 3MH2A 5FBOA 4EQUA 1L8TA 4KRDA 5KKRC 4R5YA 5JK3A 5LVMA 5K3YA 1H27A 3VNTA 3HV4A 3K2LA 3QRTA 5H8EA 1YQJA 3D5UA 2UZOA 4L7SA 5AUUA 5JGAA 5IU2A 3ITZA 3QTRA 2JFLA 1J1CA 3UVPA 4RIXA 3L9LA 3L8SA 1JKTA 5CY3A 3P0MA 1V1KA 4QPAA 2W1FA 2XNMA 4O91A 3W55A 3ID6C 4RVMA 4QMTA 4BTKA 5FDPA 4ZLZA 1H1SA 2EU9A 3MPAA 3O7LB 3PYYA 4H1JA 2QLUA 1JKKA 2VRXA 3V5WA 2GQRA 3QWKA 5EW3A 3DJ7A 5CAQA 3QAME 5EKNA 4G6OA 4DEDA 4GVAA 3EQFA 4IAIA 3NW6A 4I6HA 2V62A 3GCVA 2OG8A 4QMMA 4FBXA 3TIYA 2WU7A 1ZYLA 3QRJA 4PV0A 4FE2A 5IF1A 3ZU7A 4L9IA 4ANLA 5CLPA 4S2ZA 3TDWA 4YGAA 2B76D 2BKZA 3DK3A 3G15A 2XK7A 4Q2AA 4YUQA 3IOKA 5DI1A 3TUBA 2G2IA 3A8XA 5M06A 1WBVA 3MW1A 3E63A 4K1BA 1WBWA 4J1RA 4AAAA 4EBVA 4EKLA 4CVAA 1NVSA 3SFDD 1XH9A 2BZHB 3LFNA 4I41A 4QMLA 4R3PA 4YXDC 4BDJA 4FSYA 3VS2A 4QDVA 3VC4A 3AE6C 4EL9A 4F1OA 4MQ2A 4ZTRA 1KV1A 4FKOA 3ACJA 3N4VA 4H58A 3D0EA 4FZ6A 4MD9E 5I9UA 3PFQA 4O7LA 2HENA 1GIJA 2XZSA 1Z57A 2VN9A 2VWWA 3BLHA 3CBLA 5CYIA 4DHIB 5HG8A 1E7PC 3IQ7A 3F7ZA 4OR5A 4QO9A 4YZMA 3KGAA 5HU9A 5T68A 2NRUA 3NPCA 3FI4A 4IC8A 2BVAA 3GT8A 3R00A 1CMKE 2C3KA 2EXMA 4B8LA 2HY0A 4TYEA 4WD5A 2RL5A 5IUIA 3FDNA 4Y5QA 3DFAA 4WNKA 4O21A 1W0XC 2ERKA 2WZJA 3KIOC 3VUMA 4DA5A 4JG7A 3WZDA 3A8WA 3VRAC 3Q6UA 5TR6A 2B9FA 2YN8A 3AC5A 2UVYA 4Z55A 3LZBA 4BCGA 5CNOA 4LYNA 2ZAZA 1PY5A 3FZRA 4RX5A 4X3FA 4PMPA 2J0IA 2PHKA 1UVRA 3RHKA 1NT2A 3VR8D 2PVYA 4LRJA 2F7EE 4OBPA 4QTAA 3LFDA 3UMWA 2B76C 3EMGA 4O0VA 4D4RA 1LP4A 5AV1A 5HNBA 3AC8A 3TKIA 2UZBA 1BYGA 3ZONA 3P7AA 2B9HA 3QXOA 4M14A 1KE8A 1BKXA 4Q9ZA 4JRVA 3ZO4A 2HY81 3MH0A 4A4OA 4DH3A 3WF6A 2JLDA 5CZHA 4S34A 4CG9A 3BWJA 4BDHA 1T45A 3DY7A 3DXQA 5EK7A 1OI9A 2C3IB 3LJ0A 4WO5A 4GUEA 3VS7A 3WE8A 4BN1A 3JPVA 3QCQA 2B55A 4YPDA 3GXLA 3P4KA 5JT2A 3QCYA 4M13A 3TJCA 3U51A 4Y46A 3MTFA 2PZRA 3HKOA 3Q60A 5BVFA 3SA0A 4ZY5A 4FTQA 3Q5ZA 1YI6A 3GGFA 4JMQA 3OBJA 3SOAA 4XRJA 4C4EA 4YNOA 3B8QA 2HAKA 3WYYA 1Y6AA 3C4ZA 4FOCA 5D1JA 4USDA 3HMMA 3L8XA 2Z7SA 4QYHA 3DBQA 4AQKA 2BHEA 3C7QA 4QMNA 3KA0A 3PA3A 5I9WA 4AXAA 5CF8A 3K3IA 4K11A 4O83A 5C8MA 3ZDIA 4NWMA 1OIRA 2OFVA 5C01A 2QODA 3QUDA 4CT2A 5FTOA 3VUKA 4YLJA 2BKKA 1JWHA 5C9CA 1E1XA 2RFNA 2XNPA 3GC8A 3OT3A 4FT9A 3O17A 4GL9A 4EK8A 1IR3A 4F09A 5C26A 3NNUA 1S9JA 2Y6OA 2WMXA 2I40A 4HGEA 4YBJA 3VR8C 4C3PA 4DAWA 2C4GA 4BI1A 4B6LA 4H05A 1BI8A 3DKCA 3PIZA 5LOHA 1JQHA 2UZUE 4FKQA 3VS4A 1OKVA 4NYEA 3NYNA 5IQEA 1FOTA 1SZMA 5DBXA 3V01A 4R3CA 1XR1A 2XVDA 3JXWA 5CEIA 5KMKA 2YFXA 4TW9A 3UVRA 3LM5A 3TV6A 4RVTA 4L00A 2BAKA 4YSZD 2SRCA 4XG3A 5JZNA 1W7HA 5EI6A 2WQYC 2FH9A 3R8UA 3NLBA 4I6LA 3R9NA 4FTKA 3EH9A 4EOKA 2PTKA 3QX4A 5DFPA 1PXLA 3E8NA 4EH4A 4QMUA 3EYHA 2WTCA 3QHWA 5HCXA 2WTKC 3DA6A 1YWNA 1PMNA 3ZBFA 3NW7A 3W33A 4RIWA 2BROA 5DVRA 3KXMA 4HVHA 2UZEA 3IGGA 3A61A 2JIUA 4YT0D 2AUHA 3OWKA 3E8EA 4YO4A 4LV5A 2WMWA 2QD9A 3U54A 2YITA 2UW9A 3KXZA 4CMOA 4CFVA 1GAGA 1MQBA 5DT0A 5FBNC 4D4VA 4EWQA 4YTCA 1XH4A 3UMXA 4X3FC 4A9SA 3SGCA 1OPLA 3MJ2A 4JIKA 3ANRA 5IQAA 1NW1A 4RBLA 4BCNA 5LWMA 3IG7A 3MB7A 2GQSA 2R3RA 2X1NA 2FO0A 3QRKA 3COMA 3R1NA 2W9FB 4P7EA 4RFZA 1OUYA 3LLTA 4ONAA 4E1ZA 4E4NA 3LQ8A 1YXTA 4HGLA 1HCKA 4X0MA 5EW9A 5I5ZA 5L2TA 4DH8A 2OLCA 4ZSAA 3LMHA 4KSPA 2XJ2A 4FZAB 4MXAA 2ACZD 2QOKA 4N4SA 3FZOA 4C3RA 5HX6A 3OHTA 4NUSA 4L67A 2XB7A 1QPCA 5KMIA 2X4FA 4IAZA 2E2BA 5HVJA 3PLAE 1OIYA 5IMEA 4R7HA 1WCCA 2WDRD 4PTGA 3GP0A 4QQCA 1OL6A 1W84A 2YAAA 1ERKA 3DAKA 4ASDA 4E5BA 2IVTA 4EQMA 4I23A 3DQWA 4TXCA 1FMKA 5B2MA 2H88C 1QPDA 5HZNA 3DGKA 3CTHA 4L53A 5BVEA 3W8LA 1HOWA 2XBAA 2YM5A 2ZVAA 4JNWA 4DH1A 2PSQA 3F2NA 2W1DA 5J5SA 2PY3A 4U3ZA 1ST4A 3HGKA 2W1EA 4YTFA 3AD5A 3RPRA 1UKHA 5AMNA 3C4FA 4M68A 3SG8A 3ABVC 3BQCA 1SVGA 4MF1A 3TNQB 4OTRA 1OIQA 2R3FA 3SFEC 2BZJA 5M4IA 5DR6A 3V3VA 2QQ7A 4MXXA 4I5PA 3E7VA 4MTAA 1P4FA 3ML1A 4KB8A 2IZUA 3KMWA 3PFYA 4O7ZA 4RVLA 2GSFA 5ACKA 2HELA 3P1AA 3CIRD 4G2FA 3UC4A 5BVOA 2WELA 4IB1A 5ETAA 5BX0A 4IX4A 4NW5A 4AU8A 2V0DA 4QYFA 4E6QA 3DV3A 3KXXA 1TQIA 5LMKA 1MQ4A 4CKRA 2CKOA 4J96A 5HNIX 4DG0E 1AD5A 2J0LA 3OP5A 5TT7A 3GB2A 1DAYA 1REJA 2NRYA 3DFCB 4HGSA 3UO5A 4WRGA 1JSTA 5AV4A 5IQBA 3ALOA 5KNJA 4BRXA 4Q9SA 4EBWA 4RIOA 3HUBA 4MNEA 2WOUA 4LGGA 2QHMA 4FV8A 5E9EA 2WIPA 5IA1A 5KE0A 5GIPE 2O8YA 4FKIA 1M2QA 4LI5A 3QLFA 3UNZA 2XANA 3R8PA 4XS2A 3RPSA 4P5ZA 3BHVA 3MESA 4QTBA 2BZKB 2CKPA 5D12A 3NWWA 4YP8A 4BIEA 1E9HA 4BI2A 1WVXA 3UBDA 3OS3A 2QOOA 4C4FA 2OI4X 2JD5A 4ZP5A 3ZLWA 3ZEWA 4FSQA 2GNFA 5E8ZA 5AUZA 3UDBA 3VS0A 4YTPD 1OGUA 4P90A 1ZYJA 3BCEA 3OC1A 3QD0A 1WBNA 2C5NA 3EQHA 2BZIB 2VNWA 3LHJA 4YJNA 4DTBA 1OBDA 1YHSA 2IG7A 2OIBA 3ELJA 4FV9A 4OW8A 3HRFA 3JY0A 5TKDA 3U8WA 4BB4A 2XCKA 1UU9A 5DGZA 2C6LA 4XH6A 5EDPA 4CTBA 5CEPA 2XKDA 1L0VC 2UZVA 2YZAA 4RLKA 4FKLA 4KBAA 2ETMA 3MFTA 4XLIA 4XV9A 3SQQA 3R7EA 5K4IA 4K6ZA 2XNBA 1I44A 1U5QA 2AC5A 2I0YA 3PJ3A 3AE4D 2X8DA 2X2MA 4H3QA 4HNFA 4YLLA 3E5AA 2GTMA 2WGJA 4YBKA 3A62A 4BGHA 2OZAA 2PZIA 3F66A 4KSQA 5FXSA 3GI3A 3FXZA 2BAQA 4OTQA 3T3VA 3C4EA 1XWSA 4BDAA 4BICA 3QQKA 3G5DA 3KC3A 4Y83A 4BF2A 3LXPA 2BCJA 3ZEPA 4KA3A 4KIPA 4QP2A 3BBTB 3IW6A 3LFBA 2YEXA 4MK0A 4WNMA 4CV8A 3VO3A 4BZDA 3AOXA 3OT8A 3K5VA 4G5JA 4DITA 2PUUA 3A7FA 3POOA 4UYAA 3FMDA 3LCTA 3TDVA 3U87A 4D1ZA 3MPMA 2Y8OA 4QP6A 3RAHA 3C5IA 1Y8YA 5CS6A 5GJGA 4DEAA 5KMJA 3FUPA 4FVQA 4MEDA 3ZO3A 2CKQA 4I6FA 4AGDA 4YTPC 4A4LA 1LEWA 2Z7RA 3G0EA 4J95A 2CN5A 3PJCA 3OXIA 4FNXA 4YTMD 1Q8ZA 4BCKA 4PWNA 2WO6A 2IVUA 3ORMA 4KX6D 2WNTA 4BIDA 3FMEA 2Z2WA 3AD6A 3KXGA 3R22A 4D28A 3F3WA 3HL7A 2YIXA 2I1MA 4O7VA 2VX1A 3DK6A 1WAKA 3JVRA 3VBVA 4ZXTA 4F70A 2O5KA 5AUXA 4QMOA 1XJDA 1CSNA 1T46A 2ACXA 2P4IA 4I92A 4DE4A 4E5AX 4R1YA 1ZOYD 2X7FA 4FTNA 4QMQA 3DS6A 4HCTA 4D0WA 3AEGC 3FY2A 3ZM9A 2V5QA 2H6DA 4I0TA 4JLCA 4BDGA 4OTHA 2BS3C 2BUJA 4HYHA 4ZTLA 3VF8A 4TYHB 5F94A 3OOGA 1JAMA 2AC3A 3AMYA 3CIKA 4TWOA 5F20A 5FM2A 4BY9E 4UX9A 4XOZA 5IDNA 3Q4UA 4FMQA 5KO1A 1PXJA 4BCJA 3EFKA 3NNVA 4RJ5A 1L3RE 2QG5A 2C6EA 4ZSJA 2JAMA 5HIBA 2YWVA 4UN0C 2QR7A 4IVDA 5CWZA 5J87A 4AXDA 5BYLA 4MXZA 3MY5A 4IHPA 5IDPA 2ZM1A 1H4LA 4D0XA 3S4QA 4C02A 3FQSA 4H36A 4AF3A 1VLRA 4AW0A 4G3DA 3DKOA 4GU6A 4EKKA 1R39A 4FVRA 2BDFA 3W1FA 4FSRA 3FE3A 4QMZA 2HCKA 2YIWA 3DJ5A 4GS6A 2IN6A 2QO9A 4QP4A 2YDKA 2OJFE 4EOPA 3BHTA 2C0IA 2R3IA 4I1ZA 4J52A 2IVSA 3QF9A 3R0TA 3EL8A 5ANKA 4MWHA 4AACA 3AECC 2EUFB 3MVMA 5IG1A 3GEQA 2RG5A 3E8CA 3VW8A 4PL4A 5FQDC 4A9UA 1RDQE 3VRYA 2C6TA 4EQCA 3ZUTA 3ATSA 3EKKA 3EN7A 2ITYA 3TMOA 3LCKA 3LW0A 4KABA 2W1GA 3TKUA 4MH7A 3V04A 1ZMUA 3DCVA 3COIA 1YHWA 3CS9A 2YCSA 4EHGA 5CU6A 1ZP0D 1WVWA 4OGRA 2R3LA 3ULIA 5BPYA 1OZ1A 2JBOA 4DFNA 2X8IA 3AEBD 5DIAA 4EH5A 5LCKA 2YIQA 2VO7A 4JQEA 4QQJA 1F5QA 5FM3A 5I0BA 4E4LA 3FXWA 4GG7A 3U9CA 3Q4ZA 1SYKA 1G8SA 1ZOHA 2UW8A 3LE6A 4Z16A 2A4LA 2F7XE 5HNGA 3F88A 2PZ5A 3POZA 1H28A 4M0ZA 4O0WA 5HG7A 4GIHA 4NK9A 1STCE 1W8CA 3UC3A 3MVHA 3QQUA 4O0XA 2YM4A 4GYIA 4IFGA 4LMNA 3GVUA 2GFCA 2ERZE 3QYWA 4LG4A 3RI1A 4EH3A 5J9ZA 4ANBA 4USEA 3P4QC 3B2TA 4GW8A 4IWPA 5C2TD 2GNJA 3LLAA 4HVIA 4TL0A 2ITOA 4F0IA 3DTCA 1NEKD 2HXQA 2YERA 3PY0A 4FV1A 3DBCA 4X2JA 4K8AA 3V8TA 3LJ2A 5DHJA 4X21A 3OCGA 2R4BA 4ITIA 1OKYA 3CPBA 2ESMA 3FQHA 3HAMA 4G17A 2OFUA 3QQLA 4I22A 5HCYA 5IMXA 4C3FA 4W8DA 3PSDA 3CKWA 5BV3A 2GHLA 3QUEA 2C1BA 1K3AA 2J7TA 5CEMA 3TZ8A 5JSMA 2HOGA 2ETKA 2QU6A 3UDTA 3MSSA 2ZB0A 4YC6A 4CT1A 2PZPA 1OPKA 2WU5C 1JKLA 4UYNA 2QLQA 1ZYDA 3ZHPC 3OMVA 5JGBA 3Q04A 5H9BA 2YM6A 3AEBC 2Y4IC 1YW2A 4R3RA 3EQGA
chains in the Genus database with same CATH topology
5DEWA 1SNXA 1GZOA 2OU7A 5C8NA 5A4QA 4GUBA 3GU5A 5KCVA 3UODA 4O81A 3MA3A 3O71A 4NM5A 4XP2A 5FEQA 3WF8A 3R73A 4C4IA 5DR2A 2FA2A 1JKSA 4LDTA 1H00A 2J0MB 2J90A 3FHIA 2WPAA 5CAPA 5LVPA 3MPTA 3EB0A 4O84A 4XEYA 3PG1A 2Y9QA 5HE3A 4XV2A 3VJOA 1BX6A 4RFMA 2C68A 4C36A 5FXQA 1YOLA 4IAKA 3FLNC 4JQ7A 4P2KA 4ZSGA 1PXNA 4RG0A 4CRSA 3TACA 4L52A 3F3TA 5D9HA 1P2AA 1DS5A 2WOTA 3ENMA 2Z02A 4O0UA 4D2RA 4FKGA 3DQXA 4AE9A 4WBOA 3QA0A 4PQNA 3OEZA 1B6CB 3AD4A 4FZDB 4LMUA 4DGOA 4PUZA 2R3GA 4G3CA 2QOFA 4YZCA 2V55A 4FG9A 2F4JA 4I6BA 2VZ6A 4UALA 3TKHA 4A07A 5IA2A 5L8KA 1ZZLA 3EKNA 1FGIA 2PK9A 2WEIA 2CGWA 3QFVA 2CCHA 3D2KA 3A4PA 3MTLA 3ORKA 3QX2A 4KNBA 4TYJA 3ROCA 2JC6A 5KUPA 4LOQA 4WIHA 5J95A 4RJ8A 4F99A 2J5EA 4HVSA 5I9YA 3KVWA 3HV3A 3OCBA 5G1XA 2WTIA 3E87A 4EUUA 4N57A 4YZDA 4PMMA 1YI3A 3SKCA 2YABA 4FEUA 3AMAA 4FZFB 3NVMB 4WSYA 2Q83A 4Z9LA 5T6KA 5M4FA 4D1SA 1KE5A 5CQWA 1YXVA 3NNXA 4BCIA 2IVVA 4MXOA 4R78A 3ZTXA 5GNKA 2XIZA 1GZNA 3WBLA 4ZZOA 3QL8A 2GFSA 3RAKA 3A4OX 5E4HA 5FTGA 3R1YA 4FTAA 2PZYA 4Y73A 3ZLYA 4EK3A 4FNYA 3LFFA 5AV2A 1V0BA 4PP9A 4C4JA 3E7OA 1PXOA 3CQEA 1ZWSA 5AWMA 2C30A 2Y6MA 3DAEA 4BR3A 5KMOA 1ST0A 3PVUA 2HYYA 5CSXA 5K4JA 3MFRA 2HK5A 4ZOGA 3LCOA 4NH1A 3HDNA 4U9AA 3TL8A 3TTIA 3W18A 3QTWA 4QDEA 5KMLA 5LQFA 2WXVA 4B8MA 2P2HA 3KXHA 5DEYA 4QYYA 2C3JA 1SMHA 2BRMA 2R0UA 4A9YA 3KF7A 3QC9A 3CEKA 3NIZA 3H0YA 3RNIA 1ZMWA 1W83A 5CSPA 5A54A 3RCJA 1H25A 3R2BA 2ITPA 1SM2A 5ETFA 4GIIA 2CPKE 2HW7A 5CSHA 5HLPA 3E3BX 2E9NA 2HZ4A 3C51A 4QNAA 5TOZA 4Y72A 4XCUA 1IG1A 3UJGA 3EN4A 4HVGA 2X39A 1ZOEA 3P5KA 1YXUA 4AUAA 4NKSA 5J7HA 4FK6A 5CVFA 2OICA 3D2IA 3B8RA 4K77A 3DKGA 3I60A 3FPQA 2GNHA 4L7FA 4IAFA 3L9MA 4OTFA 5LVLA 4B7TA 4C59A 3PUPA 4MNFA 3KFAA 3ZFXA 3KN5A 1IASA 5C27A 1IRKA 3LCSA 4ZMFA 2VO6A 4FVPA 2WTJA 3WF7A 5F95A 4JR3A 3ZCLA 4ERKA 4QYEA 4V0GB 3RJCA 2J6MA 2RKUA 1VYWA 3CTJA 1PHKA 2E9UA 4IEBA 5KHXA 1FVTA 4BZNA 5EHOA 3QZIA 4O6LA 1PKGA 5AFVA 4IB3A 4F7JA 5H2UA 3R6XA 5GINE 2YDIA 1E1VA 1UNLA 2GS6A 4PL5A 4V01A 4WKQA 4CSVA 2WB8A 5C1QB 1Q99A 2R3OA 5EDQA 3F2AA 3OY1A 1WVYA 3BHUA 1PMEA 1RE8A 4OBOA 3PP0A 1PMUA 1ATPE 3UYTA 1Y57A 2JKQA 2PVRA 3AGLA 4HJOA 4FKRA 2IWIA 3DOGA 2XRWA 3L9NA 5FP5A 2R3PA 4L42A 5HG9A 3GUBA 3AKKA 4QRCA 3QKMA 2O0UA 4JIAA 4XYFA 3N9XA 2CLXA 1J7UA 2F2UA 4UXQA 4QQ5A 3P5JC 3PPKA 3U6HA 1IA9A 2W1CA 3FMLA 4AOIA 2VTLA 3MIYA 5CSVA 3I7CA 3OZ6A 4APPA 3SVVA 5F9EA 3ORIA 4DEHA 1TKIA 2PYWA 4DDIA 5GJDA 3O50A 4O7TA 1YOMA 2C69A 1Q4LA 2H34A 4AT3A 4DINA 2A1AB 5KBRA 5BUJA 2BFXA 4BCQA 2ZV9A 3A7HA 4PL3A 3EJ1A 5F4NA 2R64A 2G1TA 3RK7A 5ANGA 4CNHA 4CMTA 2PMNX 3QRUA 3W2RA 4MD7E 3UOJA 3E64A 3E8DA 3HNGA 1M2PA 1YDRE 3KRLA 3EN5A 3LOKA 3GCPA 4W4WA 1KWPA 2F2CB 3GU6A 4G34A 3KREA 3GQLA 5IQHA 3FI8A 4FKVA 4W4XA 2EVAA 4UV0A 1BL7A 5BYYA 4FI1A 3UO4A 3OROA 5L2SA 4JJRA 4C58A 4DFXE 2BIKB 4KWPA 5EYDA 3TG1A 2WMRA 2J9MA 3JVSA 4JT3A 4NM3A 1FGKA 5LCJA 5IQDA 4TY1A 5IA0A 3E3PA 4G6LA 2W4KA 3FMHA 4GH2A 4LM5A 4FYOA 4XG2A 3VW6A 1JLUE 2UW0A 4YC3A 2VWUA 4FG7A 2V7AA 5EQPA 4FV7A 4UWBA 5JKGA 2OIQA 5AEPA 2CLQA 2WQEA 3HYHA 4PX6A 4AP7A 3LPBA 4JG6A 2QOLA 4TNDA 3BLQA 4LRKA 3UZRA 4HW7A 4ZK5A 3TWJA 3WF5A 3W0OA 5CXHA 5M53A 4OTDA 4EI4A 2OZOA 4O38A 1Q3DA 4O96A 3ORZA 2WMTA 4DCAA 4E8AA 4YJUA 5HEZA 4FSNA 3RINA 2VU3A 3UIXA 3ZO1A 5K5NA 4EOSA 3MB6A 3QCXA 4IWOA 5DYJA 5CEOA 3F5UA 3TCPA 5HBJA 4WG3A 2G2HA 3KRJA 3ORNA 3EZVA 3QGYA 2CGVA 1Q8YA 2DUVA 3HP2A 3UGCA 3NW5A 4PNIA 1KE9A 1ZMVA 2ZV7A 2QVSE 3OVVA 4LFIA 4RPVA 4TYHA 3CJFA 5KZIA 3UDZA 3R30A 4ACDA 4E93A 4R7BA 3PSCA 3SW7A 3SAYA 4GKHA 1JOWB 4K9YA 4AOTA 4FIIA 4U43A 2Z8CA 4XHKB 2BFYA 3F7WA 4ZSLA 2VO3A 4GCJA 2XM8A 4CFWA 2QI8A 3UP7A 2X9FA 3GFWA 5HD4A 3MY0A 1GJOA 3VBTA 4AT4A 4PDPA 3N4TA 5KKRB 4EUTA 1Q41A 4TN6A 4KINA 2VTRA 3DXPA 3FBVA 4EH6A 3SXSA 4Y8DA 4DN5A 3TZ9A 1OIUA 3LMGA 4FJVA 3QKKA 2CCIA 5ANEA 2P0CA 5DT3A 2VWZA 2QO2A 4XG8A 3V5LA 1QPJA 4ASZA 5IA3A 2A0CX 4FTIA 2ITTA 3KULB 5DRBA 3BGZA 3T9TA 2ZMDA 2B0QA 4FKSA 3CSVA 3VJNA 4G1WA 4C34A 4CG8A 1KUTA 2XYNA 2YCQA 3F5PA 1APME 4MBIA 1LPUA 4DT8A 3ZS5A 2J4ZA 4IM3A 5CEQA 1ZY4A 4ID7A 3HAVA 3UYSA 1FINA 3P78A 3LXNA 2QC6A 2BMCA 5AAGA 1H07A 4E4MA 1W98A 5L2WA 4QNYA 2XK4A 5A4CA 1XMLA 3O5AA 4HPUE 4XP0A 1LEZA 3PJ8A 4RA4A 4YLKA 4FIGA 1Q8UA 4PDYA 2E9PA 5L6WL 3MS9A 1MRUA 2WTWA 4O86A 5LWNA 3UDSA 5A6OA 4AN9A 1K9AA 3NGAA 2IPXA 2LGCA 3KRXA 4M84A 3VS5A 4EH9A 1G8AA 3W10A 4EK5A 3CD8A 4JX7A 4BZOA 1OVEA 4EC9A 4RZVA 1Q62A 2PVMA 2HWPA 3D7TB 3VUHA 3ZFYA 3GCQA 4PDOA 2BRGA 4TT7A 5I9ZA 5F1ZA 2WTDA 4L8MA 4BBMA 4YZNA 1XMMA 3P23A 5E8VA 3W2QA 3R7YA 4DLIA 1H1PA 4ALWA 5A14A 5FG8A 1ZAOA 3BE2A 2R5TA 5ETIA 4S31A 3RALA 4JL9A 2VTHA 3DNEA 4AXEA 2F49A 2CGUA 2I7QA 3BI6A 3QTSA 2UZWE 4C35A 1YRPA 4WG4A 3QTQA 3DZOA 2HZ0A 2W0JA 3VQUA 3WZEA 1J3HA 4LV7A 4FEXA 4FX3A 1CTPE 3CCNA 3R9RA 2IW9A 4BDDA 5CTPA 2W7XA 3CLYA 4DGLC 5IEVA 5IA5A 3MA6A 4IIRA 4BYIA 1UWJA 2XNOA 3A99A 5HGIA 4IZYA 4RJ3A 2P3GX 3VS6A 2YIRA 4I5HA 4RFYA 3FZSA 3RAWA 3UPZA 4O7YA 4IH8A 3OY3A 3FQEA 2OJGA 4FL2A 4EH7A 5JRQA 5DN3A 3D15A 2XAMA 2XEZA 3EQPA 4LV8A 2W1HA 1ZZ2A 4UBAA 2E9OA 4CD0A 3NFFB 2RGPA 3ZSHA 4GT5A 5CVGA 4BI0A 4QMXA 5DWRA 3ZRMA 4TWPA 1JSUA 4MCVA 4HGTA 1PKDA 4RX9A 4EZ5A 1Q5KA 3SDJA 1H1QA 4N0SA 3R7IA 4I6QA 3W32A 4FKWA 2XYUA 4N6YA 3CXWA 2XK3A 3TJDA 3UOLA 4O7SA 3CY3A 4X7QA 2PVNA 4HPTE 4BCPA 3AT4A 1IAJA 2VTIA 3FPMA 3Q9YA 5CI6A 4QP8A 1WBPA 2R0IA 3G2FA 3K5UA 2HWOA 4YC8A 4RT7A 4MVFA 5HVKA 2XBJA 3QD4A 4GK3A 4IBMA 1YI4A 5HI2A 3VS3A 1AQ1A 5BQ0A 3SXFA 4RQVA 1NY3A 1YWVA 4LOOA 2Y7JA 1PYXA 3UOHA 4IAYA 2IW6A 2E9VA 3PXZA 5CT0A 4PRJA 2QNJA 2W4JA 4V05A 2XIXA 1PXKA 3PPZA 4GEOA 3R83A 2VWIA 1XBAA 4DFBA 4ANMA 3EYGA 3M2WA 4J71A 2FSMX 3DLSA 3D7ZA 3TIZA 2W5HA 1F0QA 3V5JA 1Q97A 3DU8A 4IADA 4M3QA 3IDCA 4AZTA 2FB8A 3I1AA 2OKRA 3FC1X 3HVCA 2BRBA 2UVZA 1UNGA 3PZEA 3PXKA 2XP2A 5HORA 4PP7A 4KIQA 3MYGA 2VX3A 2WMUA 2OXXA 2XNNA 3EOCA 3ORTA 4JDHA 2PUNA 4C2VA 3R2YA 3D4QA 3VBWA 4TKSA 1XH5A 4WOVA 2VTNA 2BILB 2C0TA 3FY0A 4AT5A 5DH3A 5HIEA 3BL9A 5JMSA 4AA5A 5TF9A 5IUGA 4BJJB 1WBTA 3F3UA 5HTBA 5FDXA 4ZMEA 4Q5HA 4NL0A 4CKJA 4F9WA 4OTIA 4EEVA 3DJ6A 4II5A 2DWBA 3OXTA 3SC1A 2DYLA 4MXCA 3ZFMA 1GZ8A 4IE9A 5ICPA 2VTMA 5JFSA 3U6JA 2C6DA 3C9WA 2YHVA 2ZMCA 5EM6A 3ODZX 4CRLA 1G8KA 1XH6A 3GENA 1OGYA 3IECA 2VX0A 3FMNA 4HNIA 5DLSA 1BMKA 4JDJA 3ZYAA 3QALE 3RGFA 4IX6A 1X8BA 4CFFA 1KOAA 3WZJA 2BDJA 2W9ZB 3OBGA 4BC6A 2IZRA 3BGPA 4FIFA 4FTMA 5B2KA 5KBQA 4BTJA 4TRLA 3VULA 5HQ0A 2GNLA 2WTKB 5M4UA 4XV3A 5E1SA 3BU5A 4YTIA 2JIVA 1ZYCA 2JFMA 5FLFA 3D83A 4AQCA 3F2RA 2WD1A 3C50A 3G0FA 4IZAA 3PSBA 5H3QA 2CKEA 4YO6A 5CENA 3UPXA 5A6NA 5M08A 4J97A 5DOSA 3ZSIA 1Z9XA 2XUUA 3PJ1A 1XBBA 3C4XA 4WG5A 3DBFA 4X3FB 1FVRA 4A9TA 4IWDA 2HW6A 3TNPC 4BGGA 4AAYA 4GG5A 4PDSA 3C5UA 4I5MA 2ITVA 1OL1A 3OUKA 4DEBA 2OW3A 2YM8A 4LUEA 4XMOA 1YDSE 3BE9A 3ZLSA 4MBLA 5C4KA 5HU3A 3UQCA 3D5XA 2C47A 1Z5MA 3UP2A 4YJOA 3ZBXA 3TNWA 3R71A 2CNUA 3HRBA 4XV1A 3UIUA 3WF9A 5M56A 4BBEA 1PXPA 3PVBA 3I5ZA 4L01A 1KV2A 3BWFA 2GQGA 3U4UA 3AC1A 2EXCX 4E5WA 4ORKA 5LMKC 3QTZA 5C03A 4F0FA 5A4LA 1U4DA 3WARA 1CM8A 1J7IA 3A7JA 2QR8A 3CD3A 5FGKA 4XG6A 5CSWA 3F82A 5BUEA 1O6LA 2OJJA 3FYJX 3FJQE 3II5A 3MY1A 2QOBA 2EB2A 3DTWA 3QC4A 4QT1A 2UW5A 5EYMA 5IQCA 3OTVA 4YURA 1KOBA 3RK9A 2R3NA 4ZTHA 5CASA 4FT7A 4BBFA 4FT5A 3PLSA 2YM7A 4V0GA 3BYOA 3A7GA 2OSCA 4JBQA 4L68A 3RPOA 2G15A 3UO6A 3MJ1A 1CKIA 3PXRA 2VWXA 4GFGA 4XG9A 3KKVA 4NCTA 1QPEA 1FMOE 3DBDA 4AW2A 4I20A 1Y91A 1R0EA 3BYUA 1U54B 3G33A 2XMYA 2GTNA 4FNWA 4QP1A 4NIFB 4R5SA 1S9IA 4U42A 2X81A 3CY2A 4IMYA 1V0PA 4O7NA 4U97A 2ETRA 4M7IA 2XEYA 3GOKA 4M97A 4F9AA 1M17A 2ZDTA 3Q4TA 1TVOA 3W2OA 4O2ZA 3LFEA 2FSTX 3LFQA 3NX8A 3LKMA 4X3JA 1OMWA 2C5OA 5A4TA 2R7BA 4KBKA 4H1MA 4IX3A 5IEYA 2PPQA 3W16A 3NUUA 3JY9A 4C61A 2JKKA 2WQBA 4DT9A 2GMXA 3EWHA 4GK4A 3RNYA 4BIBA 1PXMA 4FIEA 4C4GA 1BL6A 2BPMA 4ZEGA 5H8BA 3PY3A 4ASEA 1NA7A 4R1VA 5FTQA 1M52A 4LRMA 4W4VA 1VZOA 4G3EA 1H01A 1OL7A 3FL5A 5ANDA 4EZ3A 4UB7A 2O2UA 5FD2A 4FTUA 4ZLYA 2OXDA 4U6RA 5AIKA 2WFYA 3LAUA 4NTTA 4ZY6A 5H8GA 2GNGA 2A27A 4RIWB 5B0XA 4FGRA 3MH3A 5KZ0A 4AX8A 3U55A 3VAPA 3O7LD 2IZTA 4DFZE 5LJJA 1H0WA 3KRRA 4O22A 4BTMA 4BCHA 2P2IA 3E92A 4J53A 4RX7A 2XCHA 5HVYA 3Q9ZA 3F3ZA 2B7AA 3OCTA 3AQVA 5ETCA 2JDRA 3QU0A 5DG5A 3T8OA 5AAEA 2X0GA 3PA4A 1JSVA 3S2PA 4KRCA 3BGQA 3UQGA 3E93A 5AV0A 4XOYA 3C4WA 1DAWA 2VWVA 3JYAA 4H3PA 4F6WA 1WBSA 3LFCA 3TI1A 1IEPA 2Z7LA 5CF4A 2PMOX 3PE2A 4I0RA 4I21A 4RWJA 2RFSA 2B54A 4O7WA 3ORXA 1B39A 3NZ0A 2OH4A 3I6UA 3OWLA 3I81A 3R63A 5AP3A 4IVBA 4MXYA 5ACBC 3I4BA 4AGUA 2PWLA 2R3HA 3IDPA 2RFDA 4TWNA 4CZUA 4F6SA 3NRMA 2C6IA 2ONLA 1MUOA 3KRWA 1URWA 4QP3A 2UW3A 2QKWB 3S3IA 4GJ3A 3BX5A 3FV8A 2GPHA 4XUFA 2BAJA 2B9JA 4JQ8A 2W5BA 2PUIA 1H8FA 1OM1A 4U81A 4IB0A 4K33A 2I0VA 4L6QA 4ZAUA 5T3QA 5LMBA 3UNKA 3NYOA 4RC2A 3GC0A 5AP7A 4Y95A 2VTOA 4D9UA 3QTUA 3QRIA 3ZUVA 2CSNA 4FV6A 5EM8A 4CTBA 2ITZA 2ZV8A 3OXZA 5L3AA 5J1WA 3Q32A 5EKOA 2JDOA 2LAVA 3AXWA 1PJKA 4A7CA 3Q4CA 5LARA 4IFCA 3R21A 1MRYA 3MH1A 4C37A 4BDKA 4I4EA 4R7IA 3FYKX 4GFMA 3LQ5A 4U44A 4C38A 4DLJA 3IS5A 4WUNA 1Q61A 1GIIA 3QTIA 4NCTC 4JAJA 1QCFA 3ALNA 1CDKA 3H9OA 4ZIMA 4YSMA 3IPHA 4G3GA 4FT0A 1GOLA 2ZV2A 2WMQA 1UU3A 5J8IA 3UNJA 1GY3A 2JKOA 3Q2MA 1UU7A 3SRVB 4HYUA 4TYGA 4RC3A 4RLLA 2YACA 5DT4A 2PL0A 3VRZA 3W0QA 4DG2E 4FV3A 5JEBA 5J9YA 2XALA 4PMTA 3TNHA 2NPQA 4FIHA 4NJ3A 3H30A 2IO6A 4C7TA 3CE3A 3KULA 3RZBA 3FKLA 4O0YA 4ACHA 3V5QA 2C1AA 4CMUA 3UE4A 1A48A 2CHLA 5E8XA 4CCUA 3NUPA 2NNWB 4BTFA 2UW7A 3EL7A 4FEVA 3PVWA 4AZFA 4CV9A 3QD3A 1AGWA 4FTCA 4QQTA 1RW8A 5M4CA 3G9NA 5EOLA 3OEFX 1XHAA 3HRCA 3NEWA 3H9RA 5CI7A 4YNEA 3W0SA 4QP9A 4MUQA 4PF4A 2PMLX 2RFEA 3D5VA 3W0RA 2UZTA 3ZO2A 3C1XA 4UY9A 3TV4A 4M15A 5J1VA 3DBEA 3O8TA 4MD8E 1OKZA 3RAIA 1FVVA 3VBXA 1XH7A 5AJQA 3W0NA 5D7AA 3H0ZA 5HESA 3F61A 2XF0A 4M8TA 4BDCA 2GDOA 3PVGA 4O27B 2GHGA 4FODA 2WMVA 5A3XA 3M11A 3MN3A 4F7NA 4S33A 2VD5A 5E8SA 5JH6A 4NFNA 2XIKA 3LXKA 4F7LA 2CNQA 2BR1A 1FBNA 4QTDA 3I5NA 2OJ9A 3D7TA 4RX8A 2KULA 4FG8A 2YISA 5BNJA 5CXZA 3MFUA 4HVDA 3CPCA 3UIBA 4CCBA 3O51A 3R8LA 2ITNA 3R8MA 1TQPA 4E7WA 4JBVA 2R2PA 1NVRA 3NUSA 4EOLA 4QTCA 3PJ2A 3W2SA 4K18A 3QA8A 4TWCA 4BVUA 5DE2A 4FK3A 3RTPA 3TEIA 1M14A 3TV7A 2WQNA 2H96A 2ONLC 4RJ4A 4X2KA 4NT4A 4OT5A 2VO0A 1A9UA 4EH2A 4GT4A 4U0IA 5EOBA 3QWJA 2VTJA 4O6EA 4I5CA 5IQIA 4FTLA 5EDRA 4YJTA 5HE1A 5BMMA 4AOJA 2Q0BA 4U41A 3PXQA 2CJMA 3LIJA 3FI3A 2W06A 3BQRA 1Y6BA 4CGAA 2XNEA 4IACA 4IANA 4L3LA 4U3YA 4DH7A 4I3ZA 4IVCA 3K54A 3EQCA 5E8TA 3MIAA 4DEGA 4GYGA 4EOJA 3P9JA 3OW4A 4MBJA 5EFQA 3FZTA 4FV4A 5HICA 4DG3E 4WNOA 4IM2A 1URCA 3BYMA 5DPVA 4DHJA 2JDTA 3H9FA 3G9LX 4XRLA 4D55A 4KD1A 3AKLA 2O63A 1M7QA 3GQIA 3KEXA 3VHKA 3F9NA 3ZOSA 4EJNA 4F4PA 4YZ9A 4G16A 5DNRA 3S95A 5CU0A 3DB8A 3PIYA 4G31A 1O6KA 3HECA 5AIRA 3F6XA 3GU4A 3ROYA 4RWLA 1SNUA 2VGPA 2WMAA 2PVLA 3R7VA 3BEAA 3DAJA 4DGMA 4FL1A 2W4OA 4PTCA 3SXRA 2REIA 3OF0A 4P5QA 4XJ0A 3R7UA 3FHRA 3MDYA 1REKA 3QQJA 4R6VA 2Y4IB 1PMVA 2RF9A 3IW4A 4OTGA 4B9DA 4IZ7A 4E6CA 3PPJA 2XH5A 1MRVA 5CU3A 3CP9A 4EJ7A 3MVJA 1OL5A 4FV5A 4ENXA 5IISA 4RWIA 2CDZA 5CU4A 2EWAA 3Q96A 4S32A 4FKJA 3R1SA 4BHNA 5AUVA 4NJDA 1J1BA 4IW0A 5GIOE 3C0HA 2O3PA 2UZNA 3P79A 3OOMA 4BDEA 5HHWA 2ITQA 2J0KA 3PRIA 3VBQA 2IW8A 2J0JA 5EHYA 1PW2A 4ZTQA 3A7IA 4HYIA 2JBPA 4JVGA 3KL8A 2C0OA 1YXSA 2GNIA 2UZLA 5FUTA 4AN2A 4QMYA 4OT6A 3THBA 5GHVA 3QHRA 3BZ3A 2QKRA 3RP9A 5AP2A 4RWKA 3R7OA 4UXLA 4D9TA 4BJJA 3I79A 4XG4A 4ACCA 2FYSA 2VUWA 4FUYA 3P86A 5D10A 3JS2A 1Q3WA 3HX4A 5AP0A 4ERWA 4IZ5A 3DLZA 1YKRA 2OWBA 4UZDA 4I0SA 2BRNA 3FXXA 3IW7A 3MFSA 3NUXA 3R04A 3FAAA 4FTRA 5CF5A 1OITA 3DK7A 5DR9A 2H8HA 3AC2A 4AN3A 4RJ6A 2YJSA 2BDWA 3PE1A 5M57A 4AW5A 3IW5A 1GIHA 4HYSA 4QMPA 1BLXA 3R1QA 3MGYA 5IQFA 2PMIA 3QGWA 3KF4A 3O8UA 3TTJA 3AT2A 1FPUA 2WKMA 2XK9A 3IONA 3BLRA 5A9UA 4C62A 5CX9A 2VV9A 4ASXA 1P4OA 3UOKA 1ND4A 2VWYA 3UVQA 4L46A 4I4FA 2JITA 3P7BA 5FEEA 3BPRA 3OUNB 5IPJA 3NFGB 3ZLXA 2UW4A 4FV2A 4FYNA 4ARKA 2W5AA 2JDSA 1UWHA 5IZFA 2OBJA 4QOXA 2G9XA 1M2RA 3ETAA 4MYGA 3W2CA 4I93A 4PTEA 4YHFA 3GNIB 3JR1A 5HO8A 3FEGA 3BEGA 3NAXA 4PNKA 4RQKA 4JOAA 3QQFA 2BTRA 4NW6A 4RRVA 2GU8A 3BYVA 2XIRA 4OLIA 3I6WA 4DFUA 1CKJA 3OWJA 2HIWA 3NYVA 1V0OA 5EW8A 4FSWA 4DH5A 3CQWA 1Q8WA 3D14A 1P5EA 4D58A 2G01A 4JS8A 4EC8A 1RJBA 5HX8A 2PE2A 5AP5A 2CMWA 2HZIA 3FKNA 3HDMA 4F78A 3M42A 4JR7A 4NM7A 5JZJA 2GCDA 5KHWA 4YJPA 2WQOA 5M55A 3Q53A 5JQ5A 5EYKA 4JG8A 5AP6A 4U79A 3FKOA 3ZSGA 1Q24A 1G3NA 3LQ3A 5EM5A 2B53A 3ZC6A 3D5WA 4LOPA 2PVHA 2A2AA 2VTSA 3P7CA 5ANOA 3LXLA 3CQUA 3LM0A 3ZZEA 4YJSA 3DNDA 4FKTA 4OBQA 2OJIA 4D5KA 2J51A 2GS7A 4FZ7A 2WTVA 4FSMA 3OW3A 1OB3A 5AP4A 3GOPA 4BKJA 4NSTA 5E7RA 5L8JA 3QZHA 4XG7A 2WQMA 4ACMA 2V22A 4FEQA 3EIDA 4ZJJA 3FLWA 5ITAA 4RJ7A 1QL6A 4AGWA 4D4SA 4ZTNA 1UU8A 3BLAA 4GT3A 1UNHA 3C0GA 3HMNA 3ZH8A 3PIXA 3R9HA 3V8SA 4PY1A 2PVFA 3WIGA 4H39A 4MX9A 1U54A 4L45A 2QHNA 3C4CA 2F7ZE 3ENHA 4XP3A 3C0IA 3FLSA 3DPKA 1ZXEA 3BYSA 4FSTA 4BDFA 4HZRA 3WOWA 4YSJA 2UUEA 4O82A 5JRSA 2XAOA 3T3UA 1MP8A 2O64A 4FTJA 4KIOA 4FEWA 4M67A