4DHJA

The structure of a ceotub1 ubiquitin aldehyde ubc13~ub complex
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
248
structure length
248
Chain Sequence
DQQLKTIEDEQKSVPLVATLAPFSILCAEYDNETSAAFLSKATELSEVYGEIRYIRGDGNCFYRAILVGLIEIMLKDRARLEKFIASSRDWTRTLVELGFPDWTCTDFCDFFIEFLEKIHSGVHTEEAVYTILNDDGSANYILMFFRLITSAFLKQNSEEYAPFIDEGMTVAQYCEQEIEPMWKDADHLAINSLIKAAGTRVRIEYMDRTAAPNGGWHYDIPSDDQQIAPEITLLYRPGHYDVIYKKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin thioesterase otubain-like
publication title The mechanism of OTUB1-mediated inhibition of ubiquitination.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Hydrolase/signaling protein/ligase
total genus 90
structure length 248
sequence length 248
chains with identical sequence E, I, L
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2012-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10275 Peptidase_C65 Peptidase C65 Otubain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1300.20 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases 3 helical TM bundles of succinate and fumarate reductases 4dhjA02
3.30.200.60 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4dhjA01
4DHZA 4FJVA 2ZFYA 1TFFA 3VONA 4I6LA 4DHIB 4LDTA 4DDGA 4DHJA 4DDIA
chains in the Genus database with same CATH superfamily
4DH3A 1YDRE 3ABVC 4QTAA 4L45A 1Q8YA 4AX8A 3EQHA 2PPQA 2V22A 1I44A 2BAKA 3QZGA 4FIJA 4PDYA 4D5KA 3KK8A 4XG7A 4R3PA 4LOPA 5FLFA 5GHVA 3SG8A 3EJ1A 1UNLA 1GAGA 3FPMA 1M7NA 1CKIA 2WQOA 2UW5A 2Y6MA 3IW8A 4X2NA 3EH9A 3LIJA 2VWUA 5C03A 3RK9A 4DBNA 4JDJA 2ITZA 3LZBA 3NGAA 3NNWA 3NWWA 5AP7A 2VO6A 4U40A 3ZXTA 4NM5A 2WHBA 3SFDC 1AQ1A 3QUDA 2OF2A 3CXWA 2EVAA 4IW0A 2BDJA 3ELJA 3ULZA 4AG8A 1KSWA 3KREA 4FKPA 1YHSA 2VTOA 4I6LA 3PA3A 3BU6A 3IECA 1YI6A 2WTJA 2OI4X 4ZLOA 5CTPA 4ASZA 1YWVA 3PZEA 2WU6A 5CEIA 2HOGA 2W05A 4BCPA 5M4CA 1H07A 3P4QD 2PL0A 5EW3A 3UQFA 4R7IA 2G9XA 5F1ZA 4DHFA 4AZFA 2KULA 5DN3A 1YDSE 1YOMA 3HP5A 4I6FA 2R3GA 4I5PA 2WNTA 4L00A 5IG1A 4OBQA 2YZLA 3KB7A 3MSSA 3PPJA 4J97A 3ZUTA 1Q3DA 5B7VA 3BYUA 3TACA 2SRCA 4FUYA 4HCTA 3LFAA 3RTPA 4FE2A 4KABA 5EI8A 3W8LA 2UZDA 4KIPA 5BYZA 1ZZ2A 4QMZA 4WG3A 4AZEA 4WIHA 3AECD 5A4QA 3IKAA 1ZY4A 1XWSA 3KK9A 3CIRD 1ZYSA 2XALA 2R2PA 5HLNA 4QOXA 5BYLA 2UVYA 1GIJA 4E5AX 5IEXA 2HXQA 4O0WA 4XCUA 4F9CA 5HE3A 1YRPA 4UALA 3O7LD 2OBJA 3FE3A 4C35A 2QU5A 2OIBA 4FVRA 3RKBA 3R22A 4GUBA 2J0IA 2UZOA 3ENHA 4QYHA 1UV5A 4RFMA 5GNKA 2W1FA 5E90A 3DNDA 1Y91A 4N0SA 4DCEA 4IVBA 4BCGA 5FDPA 4JBVA 4ZS0A 5HBEA 4YSZD 3LXLA 5HEZA 3GB2A 4WG5A 4OTDA 2YFXA 4XG4A 5HBJA 5JSMA 4I0RA 5L2TA 3HLLA 3SV0A 5HE1A 3U51A 4AS0A 2R3FA 4Z55A 4ZTQA 3LJ0A 4Y46A 3GC9A 4ANMA 2AUHA 2VRXA 5LVPA 2XH5A 1JWHA 3ODZX 2QQ7A 2UW8A 4GW8A 2IW8A 5ETAA 1OECA 3FLSA 4DEDA 2BIYA 5FTOA 3NFGB 4LV5A 4Y95A 3ZLXA 3E8EA 2FO0A 1M2QA 3AMYA 2VO7A 4QEBA 5ETIA 5HBHA 4YXDC 5TOZA 3WBLA 3KRLA 3KXXA 3P7AA 4LL5A 1SYKA 3GI3A 3A7FA 4BTMA 4IM3A 1DI8A 3C50A 4GUEA 2QOHA 4IM2A 4IQ6A 4ZSLA 1RDQE 4E4MA 5KMKA 5C01A 3ZHPC 2YIWA 4O82A 2QD9A 4V05A 5J9YA 2YJRA 3R02A 4FNZA 5FEDA 3AE3D 3II5A 4FTIA 3WIKA 3RGFA 4EOQA 3AE2C 5IDPA 2GNLA 3LLTA 5A4CA 1Q99A 3V8SA 4AFJA 5I5ZA 4QYFA 3I79A 2XKEA 3BE9A 2ZM4A 4S30A 2WEVA 4ZY5A 3QQUA 2WQYC 4ZJJA 3TZMA 4BDJA 1E1XA 3PVBA 1FMOE 1PXOA 4RWKA 3BPRA 3RZBA 3W0OA 5CANA 3MY1A 3NPCA 4FSRA 3I5ZA 3OWPA 2V5QA 3FMLA 4FKSA 4BTKA 3PFYA 3FJQE 2GTNA 2GS7A 3QD0A 4LV8A 4MF1A 5B2KA 2YM3A 4TYIA 4MYGA 2P4IA 3A2CA 5KX8A 2VTSA 4DG3E 2OFUA 5IUGA 2ZMDA 3QTXA 3EKNA 3R8ZA 3PPZA 3R7OA 3LFDA 3CEKA 2WMRA 5ANGA 4ZSEA 3AE4D 2QURA 4IEBA 1Q61A 4TT7A 3BEAA 1G8SA 4GK3A 3V5TA 4DINA 4FYOA 4RIOA 2GQRA 4M0ZA 4D28A 4NKSA 4F9WA 4F7NA 2JIVA 4FGRA 2UW4A 3FXXA 2VTJA 2QOFA 4O91A 4XV3A 5EW9A 4I5HA 3P08A 3BBWA 3MTLA 3VUDA 4FT9A 4A9YA 1IASA 2O3PA 2XBAA 4XBRA 1CSNA 1XHAA 2Z2WA 2ITTA 4EOSA 3Q3BA 4AGUA 2Z60A 1BX6A 3FZ1A 2VD5A 2XKDA 3P86A 3QC9A 4IZAA 3G51A 1FBNA 3BX5A 3FAAA 4FA2A 5A9UA 3QAME 3VR9C 2Q0NA 3RCJA 4D1XA 2PMLX 2XNBA 3QQLA 4BDEA 4M68A 5EOBA 2PWLA 5I0BA 5CXHA 2EU9A 3LFEA 3GU5A 4L7FA 4BDKA 3CR0A 3PXQA 5EW8A 4B8MA 3UMXA 3HV3A 1Q8WA 5E8XA 4UN0C 4FV7A 4C4IA 4F78A 4XV1A 3FUPA 4ZK5A 4TWNA 3C7QA 3W2SA 4PX6A 1H00A 3HV7A 4WRGA 5IPJA 3P7CA 4DLIA 1ZOGA 4XBUA 2WFYA 3PG3A 2DUVA 1OKVA 4L68A 4RVMA 3JVRA 1ZZLA 2QLQA 3EKKA 3F69A 3QD4A 4TYHB 3LFSA 3IOKA 3PA4A 3DGKA 5LARA 3RM6A 4BIEA 4C58A 4QMXA 4DFLA 1Q8TA 1P5EA 4HGLA 5AADA 5IQDA 3GCSA 4TWOA 2YA9A 5FEQA 5HNGA 2FGIA 3TUDA 5EDPA 3LM0A 4QMYA 3TV7A 2BIKB 3HECA 4JOAA 4OTRA 4FT7A 3HV4A 4QO9A 2W1HA 4BCFA 3HDMA 2YM5A 4YTPD 1CDKA 2BTSA 1MRUA 3K54A 4BCHA 2YIXA 5BUIA 4YO6A 2WOUA 3ZLWA 4FT0A 5EHYA 5C4LA 4O0SA 3KF4A 5AP2A 4D4RA 4I92A 3TI1A 5FM3A 2BALA 4Q2AA 3VS6A 5CEPA 4ZTRA 2REIA 3HZTA 3P4PC 2F7ZE 2G15A 3ZRLA 3P9JA 5DG5A 2PMIA 3F82A 5EYKA 4HCVA 4BTFA 3O8TA 4FZ7A 2ZV2A 4AW2A 4EKLA 3U6IA 2BFYA 3CY2A 2RGPA 3UMWA 2GFSA 2WP9D 2J6MA 4LM5A 3C4ZA 4D2RA 2P2IA 2EXCX 5BYYA 4BI1A 4KUJA 4GSBA 1XH5A 1CM8A 4HYHA 4QRCA 3UIMA 2X0GA 4AT5A 4K33A 3A60A 3Q60A 1H01A 5BVNA 1JOWB 4CMUA 5HO7A 2PSQA 5JGAA 2UZTA 4F09A 2B76C 4ZZNA 3OP5A 2CDZA 4YHTA 4JG6A 4XS2A 4QMSA 1ZYDA 3GC0A 3OT3A 3AE1C 4IAIA 5LWNA 5FP6A 2B9FA 4FTQA 3ALNA 1UNGA 4NW6A 1QCFA 3CPBA 4FOBA 5KBQA 2WIHA 1OIRA 3AC1A 2PUNA 4RIWB 4NH1A 4WSYA 1YXUA 4QTCA 3GCQA 4ZZMA 1J7UA 2RG5A 3KMUA 3BHYA 2DQ7X 3NVMB 2WIPA 3BV2A 4FZFB 4O7WA 3WILA 3NDMA 4RZWA 3CQEA 3DZQA 3MH0A 4N6YA 4MNFA 4RIYB 4DF3A 4E4LA 4H3BA 3EFKA 4EUUA 2PZRA 3RWQA 1OVEA 2WTDA 3LPBA 4OGRA 4F9AA 4IACA 5H3QA 3R8MA 3W0SA 5EI2A 5CAPA 2BFXA 3DFCB 4O7VA 4M8TA 4AGDA 4DH1A 3OG7A 3DJ7A 2OFVA 2XANA 4LRJA 5M06A 1YQ3D 3JVSA 4U3YA 2UZBA 2R3JA 4IHPA 5AFVA 3UNKA 4YGAA 5HIEA 2VTMA 5H8EA 5LJJA 4FNXA 3NUPA 3VUKA 2A19B 4D4SA 1W84A 1XQZA 3RI1A 4DTKA 4EOLA 3HV6A 2WD1A 3LAUA 5E9EA 5IQEA 3C0HA 5HGIA 3ORIA 3OW4A 3ZO3A 4IFCA 5E8VA 2R3NA 4XV2A 5LQFA 4FYNA 4NL0A 2OJ9A 1OI9A 1WVXA 4GFGA 3AG9A 4RA5A 3F3TA 4FR4A 2ERKA 5HKMA 3W2QA 3AEGC 3HL7A 4CFNA 3F66A 5EDRA 3MY5A 4JG8A 3GU7A 3VBXA 4IVAA 4IX6A 2G2IA 3OY3A 1QMZA 1S9IA 5DE2A 3VUMA 2PULA 3GCPA 2UW7A 2YCQA 5BMMA 2XYNA 5CF5A 4YTND 3LMHA 4UWBA 5DBXA 3G9NA 3PSBA 3VW8A 5KKRB 2O8YA 2XK4A 1M17A 1KOBA 4AF3A 2X1NA 4BIBA 1IAJA 1TKIA 2WKMA 1BYGA 3DU8A 1B6CB 4FEVA 4C3FA 4G3DA 3MIYA 2VGPA 2VWIA 4R7BA 2H89D 1RW8A 4F0GA 2IVSA 4BDDA 4C7TA 1GZNA 3KL8A 4DT9A 2YJSA 3ORNA 2QC6A 5EH0A 5BMSA 3QLGA 4GT4A 2EWAA 4AA4A 3KRWA 3LLAA 2BAJA 4XP3A 3ACKA 4GK4A 4I23A 5FTQA 3ZEPA 4QMQA 2G1TA 3VF9A 3KXNA 4FKGA 3NR9A 4OTHA 2OH0E 4YC3A 4YXDD 3E62A 1H1SA 3CJFA 1FVTA 3EFLA 3CD8A 4BBEA 1DM2A 1BL7A 3EQIA 3FSFA 5ANJA 5A4TA 2JKMA 1VZOA 3DJ5A 2W5AA 4OW8A 3AE6D 2BTRA 4M13A 5EKOA 4X0MA 1OGYA 3NNUA 4QQ5A 5JFXA 2GS2A 4KINA 2X7GA 3F5GA 3NYXA 4IWDA 4LRMA 3E93A 1FPUA 2VTAA 4RVLA 5CEQA 4LI5A 3AE2D 3GC7A 2PZYA 1STCE 4IAZA 5AP1A 5DVRA 4GG7A 4BGHA 3C4WA 4TNDA 3FLNC 4NIFB 1Q5KA 3EN6A 3MJ2A 3BZ3A 5I9UA 4KS7A 3TNQB 2J9MA 5EM7A 5LMAA 4IWOA 3GCUA 3H9OA 4F65A 4YMJA 4X6QC 3QBNA 1R3CA 2A2AA 3VR8C 3FY0A 2ITWA 4EJ7A 2CGWA 3LFNA 4FKIA 2XUUA 4HGSA 5AP5A 4USEA 3C5IA 3AC4A 1R0PA 2VO3A 3W0RA 2C3KA 3Q96A 2WDRD 1G8JA 2W17A 2GFCA 3S4QA 3C0IA 4O0UA 4CFUA 4DLJA 3QA0A 3R73A 3NX8A 3SHEA 1NVQA 2DYLA 5IISA 3AD6A 3MA6A 5HI2A 3BGZA 4I21A 2QOOA 3KU2A 3NAYA 4BCNA 4NM7A 3UZTA 4U8ZA 3VRBD 5EQEA 2R3OA 1P4OA 5D7VA 5ACKA 2OJGA 3V3VA 2XRWA 4EZ7A 2YM6A 4A9UA 1PYXA 4DAWA 1PXPA 3PY1A 3BU3A 3G33A 3LQ5A 5I9ZA 1VYWA 1Y6AA 3UGCA 5JGBA 5CSHA 3NMUF 2RFSA 3MH2A 1GZ8A 1UKHA 2OWBA 3FWQA 2AYPA 1HCLA 5J9LA 2OG8A 3MYGA 4KBCA 4MX9A 3VONA 2C1BA 3SC1A 2GS6A 3ZC5A 4NZWB 1DS5A 4YBJA 4N57A 4GU9A 4XG2A 3V04A 1WBSA 3NIEA 3O23A 4K0YA 4TYJA 3BEGA 2I1MA 4YJNA 4FSWA 4FKWA 3TIYA 1DAYA 3UQCA 2W9ZB 3FHRA 3RPSA 1KWPA 2WZJA 4CTBA 3GBZA 5AV4A 4TYHA 4BI0A 4EHGA 1NEKC 2XNEA 3S3IA 3D9VA 3WF9A 3IG7A 5LVLA 3MVJA 4DG2E 3F7ZA 4CFMA 2PU8A 2JLDA 3H0YA 1YOJA 2VNWA 4O96A 4TWCA 3OOGA 4YHJA 3ZCLA 3NUXA 3ORKA 4GYGA 3OCBA 4FBXA 4GG5A 4I5MA 3ZTXA 4C33A 4YTMC 1ZOYC 5H8GA 5K4IA 2Z8CA 5CAUA 1LEWA 2JKQA 3FLZA 3ZLSA 4FIFA 1P4FA 4FTNA 5HICA 3ZBFA 4EUTA 4I5CA 1UNHA 4DHIB 4PY1A 4CMTA 5DT4A 4DEBA 2Z7SA 3MTFA 1OPJA 3QFVA 4FK3A 2B7AA 4WHZA 5CU4A 5HO8A 1YXSA 2E9PA 4HVDA 2VGOA 5DYJA 2WMQA 3G90X 3OF0A 3UO4A 3S2PA 2Y9QA 4HJOA 3R2YA 4PNIA 4C34A 2W1CA 4YJSA 2I7QA 1MRYA 2CHLA 3BYOA 3DK6A 1IR3A 5AP4A 5FXQA 2YITA 1ND4A 3CPCA 3O8UA 4ZSAA 4ZS4A 3ENMA 3U54A 2H88D 4IZ5A 4PMPA 2A27A 4DEHA 5DNRA 1ZP0C 4G3FA 1U54B 3TDVA 5CENA 3F5XA 4AGWA 4H1JA 3REPA 4QMPA 3CSVA 3BYSA 5M53A 3MPTA 4EZ5A 3VBTA 4HW7A 4JR7A 3R8LA 2OKRA 3RCDA 2XJ2A 2B9HA 4DEEA 2FSLX 3SRVB 3AEAD 2C0OA 2NRUA 4UYAA 3AXWA 2XP2A 2P55A 3E5AA 1KE5A 3ZMMA 5HD4A 5CVFA 2WDQC 2IG7A 4FKJA 3MS9A 4D1SA 5BPYA 3OZ6A 3R8PA 4RIWA 4J71A 1VEBA 4AQKA 1FGIA 2RL5A 4BDHA 4Z7GA 3C4XA 4ALVA 4JVGA 2YDJA 3L8PA 3PSDA 2LGCA 5G1XA 2HZNA 3UC4A 3DV3A 3SX9A 1J7IA 3V8TA 4LGGA 2UVZA 5CEKA 2J90A 5ACBC 2GHMA 4U42A 2QKWB 4RIYA 1V1KA 3IS5A 2HW6A 3FLYA 3JXWA 2VX0A 3EN7A 4LQMA 4YURA 2YM7A 4JBQA 4D1ZA 5I9YA 5DLSA 4HVSA 2ONLC 4FTCA 4G3EA 5AV2A 1XH7A 4FV1A 1NXKA 5AAGA 1PMVA 2WXVA 4G9CA 4QYYA 4O86A 3DBFA 3FEGA 4RWIA 3I5NA 4ZXTA 5K3YA 3DFAA 4GRBA 5CSVA 4HVGA 3BHUA 2YZAA 5DPVA 4K2RA 2OJIA 4UZHA 1E1VA 4RX8A 2BVAA 3E3BX 3UNJA 2ONLA 2XNNA 4I6HA 4EH3A 3W2CA 1OBDA 1JBPE 4WBBB 1YKRA 3TUCA 3QKMA 4HGTA 4U97A 4CLJA 2WMTA 4QPAA 2ITPA 4CKRA 4EH7A 4S34A 1V0BA 3K3JA 4Y5QA 2PVNA 3AE7C 3R8UA 3RVGA 3FMJA 4FZ6A 1H1PA 4IAKA 2IVTA 3LCTA 4EKKA 4F9YA 3OROA 4H05A 1WBPA 1XMLA 4U3ZA 4ONAA 4FSNA 1AGWA 3R1YA 4CSVA 3RAHA 3DXNA 3A62A 3DAJA 4ZOGA 3SQQA 3M1SA 3AEEC 3RMFA 5LCKA 3DB8A 2FBWC 2J5FA 5E1EA 1PF8A 3KVXA 4EQMA 1PXMA 3LKMA 3DKFA 4CT2A 1I09A 3QHWA 1ZYJA 4BGQA 5CSPA 3Q52A 4RC3A 5CALA 3EN9A 4RLKA 3LMIA 1IAHA 5C8MA 4DTAA 3L9NA 3QTUA 4LUDA 1QLBC 3ET7A 4JI9A 4DA5A 4G34A 4K6ZA 4EK6A 3IW4A 4QDEA 4YTCA 1YXVA 2PVHA 2YAAA 2KTYA 3DKCA 4MWHA 1OL5A 3AE9C 3NCZA 4FKOA 4Y83A 4N70A 5FRIA 2ACXA 1KFYC 3ZFXA 2XA4A 3DCVA 5HNIX 3PLAE 3DXQA 2CLQA 4DG0E 2BROA 5CY3A 2QU6A 4JIAA 5DR9A 4BRXA 1FQ1B 2Z7RA 2WTWA 2BKKA 5IQAA 4AXDA 2XNGA 4IFGA 4LV7A 1W98A 2YEXA 5JFWA 2FSMX 2I0EA 3W2PA 3SAYA 4TRLA 4RJ4A 4NT4A 4NFMA 4H1MA 2OZOA 4PP7A 5C4KA 3OD6X 4D4YA 4UZDA 4D2SA 3KIOC 2Z02A 4H3QA 3ZUVA 2ZDUA 1YXXA 3QRTA 4O2ZA 5E1SA 3FXZA 4A9RA 5CAOA 4CQEA 4UB7A 1REKA 4L3JA 3HA6A 4V0GB 4KA3A 4G6OA 1ZXEA 3NW6A 2VTNA 3V5LA 2CKQA 5IH6A 5GIOE 4BCJA 1R1WA 3H0ZA 1DI9A 4U7ZA 4FSMA 3VBQA 4O6EA 3LJ1A 3WARA 4F1OA 2ITNA 4QP9A 3JYAA 4BR3A 3MFRA 3PUFC 3VNTA 4WUAA 3QWKA 4C4GA 3CCNA 1ZRZA 5E4HA 3LFQA 5EYMA 5IEYA 1FGKA 5EFQA 3CC6A 2G01A 3F3UA 4XMOA 5F9EA 2VZ6A 4KX6C 3CKWA 3U6JA 4ZLZA 4UWYA 3QGYA 2H9VA 2QOBA 5IU2A 2X6EA 3FBVA 3D2IA 5IUIA 2CN8A 1VJYA 4EK4A 4BCMA 5CVHA 1JNKA 2JIIA 5F20A 1H27A 1BMKA 1GY3A 2CPKE 2X81A 3W8QA 5HVJA 2X6DA 4OT6A 5CVGA 4BJJB 4GFOA 5DRDA 3P23A 4F7LA 4L42A 5CS6A 4JDHA 5CSXA 4YUQA 5J1VA 5AUXA 2VAGA 4OT5A 4GU6A 2WU2C 3NYNA 4J52A 1Q8ZA 3HX4A 4EORA 3U9NA 2C6IA 1WFCA 3LM5A 4F4PA 4IWQA 3HNGA 3DBCA 3FKOA 3NLBA 4ZMFA 5HX6A 2R64A 2C3JA 3HYHA 1ZMUA 4YNOA 4B7TA 2W9FB 4TNBA 3MB6A 3PWYA 2VN9A 1JPAA 2ERZE 2ZV8A 5TR6A 3RJCA 5KMJA 3K5VA 3BKBA 2F7EE 3PRFA 5DH3A 3KC3A 4J96A 3THBA 4A07A 4RX5A 5C2TC 5KHXA 4QTDA 2QO7A 3GNIB 2P2HA 3UYSA 2FSOX 1Q24A 3T9IA 4YSYD 5B0XA 1Q62A 2A1AB 3FYKX 3UZPA 5EYDA 3BBTB 4JDKA 1HCKA 5F4NA 4AN2A 2BRMA 4ARKA 4EH5A 3L9MA 3HEGA 2UW3A 3QWJA 5KNJA 3D94A 4GH2A 4RIXB 5BV3A 3OY1A 1CKPA 2WDVC 5BQ0A 3VBWA 1Q3WA 3AQVA 2XK8A 2E2BA 2JBOA 4AGCA 4CKIA 4JRVA 3RAKA 4QPSA 1W8CA 3TTIA 3UQGA 2V62A 2ITYA 1YI4A 4YLLA 2JDSA 3EQFA 5GJDA 2I0HA 4QP7A 4I4EA 3V8WA 4QMLA 3I60A 1A9UA 3R28A 4QP4A 3AKKA 5CNNA 4TL0A 1KE8A 3QKKA 3AC2A 3JY0A 3UDZA 3PTGA 1H24A 1L0VC 2BUJA 4YTMD 1ZOYD 2J50A 3ZOSA 2CNQA 5HNBA 4KKEA 4NSTA 4H3PA 4EQUA 5AP3A 1Q97A 4E20A 5IMEA 4LG4A 3AEDD 1UWHA 2WB8A 5M4UA 5KE0A 1NENC 2I40A 4IWPA 3R8VA 3ZYAA 4IJ9A 1B39A 5HESA 1FINA 1U54A 3HGKA 4RJ5A 1J7LA 3UBDA 3UC3A 4ENYA 4J99A 2YIQA 4RFZA 3AC8A 4MH7A 2Q83A 4FV2A 5HIDA 2ZM1A 4AXEA 3HUBA 5FD2A 3C0GA 4O0XA 5ICPA 2JD5A 5L3AA 3E8NA 4R78A 4RT7A 3SRVA 3TG1A 5CU6A 4EOOA 4GIIA 4A06A 5KMNA 3TWJA 1BL6A 4CKJA 4WNMA 4GL9A 3OEZA 2VWBA 4C36A 3ZSHA 4F6UA 4K77A 2HAKA 4E73A 4IM0A 2DS1A 1SNXA 2JBPA 2YCRA 1H1QA 3C13A 3GENA 3G15A 3GQIA 4S2ZA 4AFEA 5LVOA 4DH7A 3I4BA 2F2UA 3Q4ZA 4JAIA 4AA0A 4IIRA 2R3HA 4FG7A 4X3JA 5D1JA 1JSUA 4PTEA 2E9OA 5HCYA 3TJCA 2ETRA 3W0PA 3MESA 4PWNA 4YHFA 1VR2A 2QVSE 1ZAOA 4YSJA 4WBOA 2W06A 5AM7A 3GVUA 4ACCA 5TO8A 3S95A 3KCKA 2B4SB 4R5YA 4BHZA 4TN6A 2IZSA 5DIAA 4G6NA 5IMXA 4YBKA 3PXYA 2FYSA 4ZJVA 5K4JA 4FG8A 4L01A 4GMYA 2PVJA 4CXAA 4FUXA 2J2IB 5L6OA 4LOQA 2WGJA 2GNHA 2BKZA 5HHWA 3QKLA 4BZDA 3CTHA 3UDBA 2QG5A 4O7TA 4BDFA 4DGGA 4AOJA 1RJBA 4L43A 2WMBA 4QP3A 5AIRA 4AN9A 2XB7A 3LE6A 2HWPA 2PY3A 1Q8UA 2XZSA 4MHAA 4OBPA 3R71A 4GJ3A 4YSXC 3L8SA 1XR1A 4QYGA 2IW6A 1L3RE 3SFEC 4FKLA 3DK7A 3HV5A 2BS4C 3QA8A 4K18A 3SG9A 2FSTX 5FG8A 4BVUA 4D4VA 3T9TA 2H8HA 3E88A 2O65A 4IVCA 4MTAA 1YWNA 5HVYA 4RSSA 4X2FA 5AUZA 1ERKA 3H9FA 5AA9A 1YQ4D 5BVKA 2E9VA 3C4FA 4JR3A 2GQSA 4ITJA 3PXZA 2XK9A 1OPKA 3TNIA 3ZRMA 5J1WA 3NZ0A 5C8KA 3OMVA 2W99B 3AEBC 4A9SA 5CZHA 1GZKA 1H26A 2JDOA 3I0OA 2ZJWA 2XF0A 2H34A 3EN4A 3Q32A 4OTGA 5H9BA 4BCKA 5JRQA 1HOWA 3ALOA 3PP1A 3ANQA 5J9ZA 2O2UA 4O38A 3ORLA 3POZA 3WE4A 4EK3A 4CNHA 4YO4A 2XNPA 4NCTC 3SXSA 2FBWD 2HENA 3GFWA 1FOTA 3B8QA 4U80A 4FV8A 3UDSA 4TYGA 3CTJA 5H8BA 3W1FA 4G31A 5A4LA 3R63A 3QC4A 3GT8A 3DAEA 3Q4TA 3VRAC 3H9RA 3UO6A 5AEPA 1U59A 2A4LA 1ZOHA 1FVVA 4LYNA 4OTQA 3V5QA 5IQGA 2A0CX 4ITIA 1RQQA 2Y8OA 3KKVA 5L8LA 4MAOA 5CU0A 3BLQA 5IA5A 5LMKC 5EOLA 2J0MB 3ORPA 1ZLTA 2R7IA 2VTRA 5ANIA 5E92A 4C37A 3UE4A 4WUNA 4XRJA 4E7WA 3AEFD 3PJ2A 3TT0A 4G3CA 3NRMA 3MGYA 4I93A 4Z16A 4M15A 3R01A 4W8DA 1KFYD 2W4JA 5HX8A 4DHZA 3AD5A 4LOOA 3FL4A 3LJ2A 1PYEA 3GGFA 4K8AA 5E8ZA 3OVVA 3RWPA 3T3VA 5M09A 5EKNA 2ESMA 4PMTA 3BLRA 4V0GA 3F5UA 1U46A 4YZ9A 1TQMA 2CNUA 4NYEA 3W2RA 1KUTA 5LMKA 2PMNX 3MV5A 4O7ZA 1PHKA 2QOKA 2IJMA 2PUUA 4EH4A 4ZMEA 4TY1A 3FYJX 4XRLA 2WQBA 2J51A 3IONA 4YT0D 3I1AA 3KXHA 4O0TA 3VS4A 3GQLA 4QMUA 2XK6A 3FHIA 1URWA 2BS3C 4AU8A 2BS2C 3B2WA 3BHTA 3H10A 2OO8X 4KIOA 4BZNA 3D7ZA 5BVFA 4MXAA 3MIAA 4JQEA 2ITQA 2F2CB 1IA9A 2QHNA 4EHEA 3ABVD 3RALA 3M2WA 4I0TA 5L2SA 4FKQA 2R5TA 1JKTA 4FTMA 1OL2A 2PVRA 2BZKB 4PRJA 5LWMA 5A6NA 3COIA 2OLCA 4DBXA 3JUHA 4YJRA 4FVQA 2BAQA 2RG6A 4K1BA 5AX3A 2VTHA 4R3CA 2NO3A 4BJJA 4ZAUA 1ATPE 4B0GA 4C4JA 4CFVA 5K9IA 3EQBA 3A7IA 2PZ5A 5HCZA 4KSPA 3AOXA 1BI8A 2YAKA 4KX6D 4X2JA 4YNEA 4ZP5A 3ZFMA 2OU7A 5DT3A 4O7RA 2WU5C 1W83A 3NW5A 3NW7A 3SFDD 3N4VA 5AIKA 2XIRA 4FG9A 2XAOA 2X39A 2HZ4A 2BDWA 4AQCA 4PL4A 1X8BA 4YJPA 3TJDA 4LGHA 2Z7LA 4AXAA 3AE5C 2JDVA 4ZZOA 4P90A 3D0EA 3HKOA 3Q6UA 5E8YA 4FKVA 4BC6A 1QPJA 3KGAA 4TTHB 1PY5A 4TZRA 4YR8A 2CGUA 3QALE 3GCVA 2C4GA 4MXXA 2W4OA 4U43A 4AN3A 2WU2D 4G2FA 2GMXA 4FL3A 5C3JC 1OL6A 1WMKA 4HYIA 4M84A 2C0IA 4YLKA 3LCSA 3ZLYA 4C3RA 2ITXA 4MEDA 4G17A 3BLHA 3BLAA 4GT5A 5IQIA 1WBNA 3D5WA 3NAXA 3D5XA 4MQ2A 4HZRA 4EOPA 5M57A 2CGXA 5ETCA 4FNYA 4RIXA 5EQYA 1G8AA 2EXMA 3ZSGA 4EH9A 3F2AA 4LFIA 2CMWA 1TFFA 3HRFA 3W0QA 5CI6A 3WZKA 4CFWA 1K3AA 5L2WA 1Q41A 5IQHA 4FSZA 5C2TD 5DR6A 3QRKA 5JN2A 2VU3A 4WG4A 4YJOA 4DH5A 1R39A 4IZYA 4DEIA 2YDIA 3VJNA 3TEIA 1PXLA 4G6LA 3QTSA 4JG7A 3G2FA 5AP6A 4IX4A 1ZMWA 4C59A 1OKYA 4M14A 2NP8A 4YTHA 3OT8A 3AT3A 2QLUA 5CNOA 3QQHA 4F9BA 1SZMA 2UV2A 2XIYA 2GNJA 3FZOA 4YTFA 2HYYA 2C6LA 2YIYA 3NIZA 3FPQA 4H58A 3I81A 1WBTA 3M42A 4JT3A 4AW5A 3R7UA 3I7CA 4I94A 3MH1A 3VQUA 5LVNA 5CQWA 4A9TA 4E5BA 4O84A 2WTVA 2F57A 2VX1A 4G1WA 2I6LA 4KBAA 3KULB 1GIIA 4BTJA 1BI7A 3VUIA 5M07A 3Q5ZA 4YC8A 4DC2A 3QQJA 4X21A 5JKGA 4ZTHA 3U6HA 2XKCA 3HMOA 4L3LA 1OUKA 4FSTA 5LMBA 1OMWA 4RBLA 4KRCA 2CKOA 3BI6A 2ACZC 3CY3A 2WQEA 5A4EA 3DLSA 4FKRA 2XKFA 3R0TA 2FA2A 4QTBA 2F9GA 4S31A 3V51A 5CAVA 4Y8DA 4USFA 4ZY6A 4FIIA 4RX9A 4M12A 2QHMA 4FTJA 5AUVA 3QXPA 4M67A 4FNWA 3EB0A 5TT7A 4X3FB 3BWJA 3Q5IA 4FKTA 3MBLA 5A3XA 4IZ7A 4UBAA 4DGLC 3F61A 5L6WL 1VLRA 2BHEA 1GZOA 2OJJA 1O9UA 2BRBA 5LCJA 4CV9A 4CD0A 2QCSA 3BRBA 3R9NA 3ANRA 3QQKA 4XX9A 2WQYD 3ODYX 4I41A 5BUJA 1UU8A 3PVGA 3F5PA 4U41A 5ANEA 4FSYA 4A4XA 5HVKA 2HK5A 4ZLYA 5CZIA 1YWRA 4N6ZA 4USDA 2C6OA 1KOAA 3OBJA 4YJVA 3QQGA 4EK5A 5JK3A 5J7HA 3Q2JA 3O0GA 1EH4A 2XRUA 4FV9A 3WYYA 4TWPA 1PXNA 3DTCA 4BICA 4GEOA 4UX9A 3DJ6A 3WZEA 2J4ZA 4ZEGA 4E6CA 1T46A 2XEZA 2EB2A 4JS8A 3UIXA 1A06A 4EH2A 3ZZEA 5CI7A 3W16A 1XBBA 4RWJA 2C0TA 1M2PA 2Q0BA 3EOCA 3T8OA 1OM1A 2ZDTA 4BKJA 4W4YA 2OH4A 4WRSA 3OS3A 4C62A 1SMHA 3P78A 3Q9WA 3DNEA 4B6LA 3R6XA 4QTEA 3FXWA 3A4PA 5EK7A 4BF2A 4RFYA 4F08A 3NEWA 3PDTA 3P4QC 2XBJA 2GSFA 3PJ3A 3JPVA 4BY9E 3KMMA 3LQ3A 1XMMA 2CCIA 1XBCA 3EQGA 3P5JC 4IANA 2WQMA 4FEQA 5J8IA 5F94A 2O0UA 3PIYA 4U5JA 1P14A 3G0EA 3PY0A 4IB1A 4CRLA 5DOSA 3TKIA 3VR9D 3UNZA 4UEUA 5CEMA 3PLSA 4I6QA 4S33A 5EM8A 2P3GX 4JQ7A 3PSCA 2JAMA 3V01A 3AECC 5IDNA 2YN8A 3DTWA 3DBQA 4DFYA 2WMVA 4M3QA 2OSCA 4GKIA 2IO6A 3R04A 4I0SA 3PVWA 2QOQA 3BQRA 3UTOA 3LCOA 4DITA 3E64A 4TXCA 1R0EA 4AXCA 3RAWA 3HUCA 3TNWA 2UW0A 4AACA 3RNIA 2DWBA 3GU8A 4XG3A 1H25A 3FKNA 1PMEA 1PW2A 4EOKA 2I0VA 3EFJA 5JFVA 5KHWA 3DB6A 4C38A 5C26A 4JRNA 3R7IA 3FV8A 3ZDUA 1M14A 1K9AA 2RFNA 1NT2A 4AZVA 3OWJA 2CCHA 3RK5A 3MDYA 4ALWA 4BHNA 4X7QA 4EHZA 1ZMVA 5JH6A 4MXCA 3DPKA 2WTIA 1K2PA 3PJ1A 4IE9A 4JJRA 2OIDA 3HMNA 3QGWA 4FTAA 4FEUA 3CBLA 4XG9A 4J8NA 2BMCA 3QYWA 4FV3A 4I4FA 5EHLA 2IW9A 2OJFE 5EI6A 3TV4A 3ZZWA 2C30A 3QUPA 1QPEA 3PRIA 4U44A 4C02A 3E7OA 2WMXA 3V6RA 3BCEA 1J1BA 4ANBA 4NFNA 1M7QA 4BI2A 3EN5A 3OXIA 4E6AA 3P4PD 5IH4A 3PG1A 4OBOA 2C5XA 1TQPA 1QPDA 3BIZA 3PIXA 4MD9E 2W1EA 4F6WA 4K11A 1U5RA 4Z3VA 2W1ZA 4EK8A 4CRSA 3OUNB 4D55A 3GEQA 4Y73A 4OTIA 4DH8A 3IDBA 3PA5A 1JSTA 5KMIA 1APME 4MVFA 2GTMA 1YDTE 3U9CA 1ZYLA 2VWVA 5AUTA 3OOMA 5FUTA 2UZWE 4XEYA 1E7PC 3DY7A 1BUHA 3ORTA 4XNEA 4FZAB 5E7RA 2OGVA 4QNAA 1NY3A 4AOTA 5B2LA 2QO9A 1YOLA 3MPAA 3HA8A 1LPUA 3VUGA 4I3ZA 1ST4A 2B76D 1KV1A 2B0QA 3QX4A 5LVMA 1XO2B 2C5OA 2Y0AA 4K9YA 4ASDA 3CJGA 5FBOA 5A54A 3AE1D 3FZSA 3EWHA 4IB3A 4RPVA 4D0XA 5IZFA 3KN6A 4ORKA 3R9HA 3OW3A 3BELA 3IDCA 2CJMA 2XNOA 2VX3A 3U87A 5E8SA 3IK3A 2WMWA 4CCBA 4AOIA 2G2FA 4OTFA 1WBVA 3VS1A 4P7EA 2UUEA 4MD8E 3TZ9A 3Q9YA 5IA3A 3D4QA 3PY3A 4ZTLA 3VN9A 4EL9A 2HXLA 3GC8A 2CKEA 2R3MA 3AE4C 1CMKE 5AUWA 3DOGA 4HOKA 1KF6C 3UG2A 3RHXA 3E8CA 3ZEWA 4BDAA 5K5NA 1W0XC 3B2TA 2HCKA 4O81A 4J8MA 1J1CA 3FMEA 1JSVA 5I9XA 4XJ0A 4QP6A 2Y4IB 3EIDA 4DFZE 3S0OA 2PUIA 3FC2A 4HGEA 3UO5A 3N4UA 2X7OA 5DI1A 5HE0A 3TTJA 4UXQA 5JT2A 2NPQA 5HG5A 1REJA 4XLIA 3RPRA 2QOIA 3ZDIA 4EC8A 4F63A 3NFFB 4O7YA 1OBGA 5IA0A 3NNVA 1FMKA 2XAMA 5IQFA 2Y4PA 3WI6A 4M7IA 4AZWA 4YZMA 3W18A 4IC8A 4TYEA 3V5WA 4BN1A 4O0RA 4BDCA 3C9WA 3VBYA 4E6QA 5JQ8A 3NS9A 2CNVA 3Q2MA 4HVIA 4CVAA 4ZJIA 5TKDA 4EBVA 4P5ZA 3DXPA 2PMOX 3DBEA 2GDOA 4PP9A 5BVEA 3QCQA 4X2GA 2BRHA 4LMNA 3TV6A 4J95A 3RP9A 2C47A 1BLXA 3F2NA 5DR2A 2X8IA 3QTWA 2QOLA 5J95A 5JEBA 4JX3A 5D10A 1Y8GA 4FTRA 2B52A 3ZM4A 3FI2A 3AEGD 1JAMA 2Y6OA 4EOMA 1LUFA 4FEXA 3O2MA 3PVUA 4JXFA 3R1NA 4ENXA 2VTLA 5M08A 3LXKA 2ITOA 3GFEA 2VO0A 3KULA 4NJ3A 5DHJA 4A7CA 4BDBA 4C4HA 3QRUA 3TMOA 4B99A 4QMWA 2IVVA 2YDKA 2BRGA 4H36A 3IOPA 3FKLA 3ORZA 3SW4A 4FIHA 4W4VA 5D7AA 5CXZA 5FTGA 1VYZA 3KRRA 2BRNA 4PMSA 3NUUA 4CG9A 4IMYA 4X3FC 3F7WA 1WCCA 3ZC6A 3ZO1A 3GOPA 3UVPA 5JQ5A 3L1SA 4R3RA 3P5KA 4P4CA 3TNHA 4DN5A 3QD3A 2V0DA 3FZTA 4MXZA 4PDPA 1OB3A 2IZRA 3W2OA 5IUHA 2JDRA 4RQVA 4RLLA 1FVRA 5E8TA 3ZUUA 3TZ8A 2HELA 3ATSA 2AEGA 3GU6A 4X3FA 4IADA 2W1IA 1ZYCA 3OCTA 4X2KA 5GJGA 3ZU7A 2ACZD 1J3HA 3O17A 2C68A 4KKGA 5C9CA 2ZB0A 3HP2A 4FICA 5DWRA 1XBAA 2WAJA 3AC5A 2JFLA 3G0FA 3PE1A 3R21A 3R2BA 3W10A 2QO2A 2BHHA 3FQSA 3IW6A 4YTIA 2XEYA 4KNBA 2X2LA 3QX2A 3PJ8A 4FI1A 2EUFB 3CQWA 4FTOA 4JMQA 4NK9A 4QP8A 3WF5A 4QP2A 3ZBXA 2BZIB 1LP4A 1M52A 1O6LA 2G2HA 2IN6A 2XS0A 3HVCA 3LFFA 3VRZA 5IA1A 3EYGA 3ROCA 3BYMA 3H3CA 3VO3A 5ITAA 3OC1A 1SVGA 1OIYA 2VUWA 3UPZA 3BHVA 1S9JA 4L46A 2C1AA 2BPMA 1MRVA 3BHHA 3VULA 4ASXA 4DE4A 3R9OA 4ERKA 3VHKA 4F1MA 5IA4A 2YHVA 1YQJA 1SNUA 3FMKA 3FMDA 3MW1A 3N51A 3CGOA 4Q5EA 4FX3A 4QNYA 5CT7A 3NSZA 4ID7A 2HZIA 5G6VA 4AUAA 5KBRA 2CN5A 4GVJA 5GJFA 3F3ZA 2C6TA 2B53A 4L53A 5KMMA 4D58A 3MJ1A 5GIPE 4PMMA 1YXTA 4CZTA 4IAAA 2VWYA 2UW9A 2JDTA 4MBIA 4WNPA 1KE6A 4O22A 3VR8D 5HTCA 5KZIA 2J0JA 4NTSA 4R77A 2XNMA 4O6LA 1IG1A 4AZTA 2J5EA 4RWLA 2OXDA 4EQCA 1Y6BA 3FDNA 4EWQA 3W33A 4EEVA 2XK3A 4QQTA 4MCVA 2JEDA 3OTVA 4CCUA 2WPAA 3B8RA 4YJQA 3TXOA 4O7SA 2W1GA 3UOJA 1ZY5A 4J1RA 2ZV7A 2XARA 4YZNA 2ZMCA 3Q4CA 1H0WA 3KXMA 3FMMA 4BCQA 2W96B 1UU7A 1YQ3C 3SXRA 5FXRA 2P0CA 1JQHA 1T45A 3E3PA 4KRDA 3D14A 1PKGA 4KS8A 3GUBA 1CKJA 3EYHA 2R3RA 4KSQA 1PKDA 1H1RA 4MQ1A 4WD5A 4FODA 1PMUA 3C4EA 1J91A 4RJ8A 2QOCA 4TPTA 4RX7A 4ANLA 2UW6A 3OFMA 4FL2A 3EL8A 3CP9A 5FEEA 5HU9A 3D7TB 4QQCA 3LVPA 1ST0A 4JLCA 3O50A 2XM9A 3DDQA 3OXZA 4MXOA 4KBKA 1Z9XA 4ZSGA 1G8KA 2R3PA 4GVAA 4RQKA 4RJ7A 1GNGA 3PXRA 4PL3A 2WTKC 3D83A 2PVLA 3SA0A 3P4RC 4XHKB 1NEKD 3AT2A 4MNEB 4EONA 3POOA 2JKOA 5D9HA 4EJNA 4BYJA 2ZVAA 4JNWA 3P7BA 5AA8A 2GHGA 1MQ4A 3FLWA 3LQ8A 4V01A 1XH9A 3A7HA 3OUKA 3P0MA 3NUNA 5HE2A 5IH5A 2PVFA 2XJ1A 1JKSA 2UVXA 5FQDC 4YPDA 3FY2A 3I0QA 2NYAA 2YERA 1YHWA 1GOLA 5CT0A 3DKOA 1PRYA 4EBWA 3U4UA 4L67A 4YTNC 2HWOA 3FQEA 3GXLA 2R7BA 3ZONA 4FGBA 3A7GA 2YCFA 3F2RA 3F6XA 4DGOA 4DGNA 2XJ0A 3AC3A 5IQCA 4KWPA 4HNFA 3SW7A 5HZNA 4ANSA 5JFSA 5DFPA 2W7XA 3OHTA 2OICA 3JR1A 3LCDA 4KD1A 3AMAA 1URCA 1M2RA 1Y8YA 4O0VA 2H89C 1W7HA 5CF4A 2JKKA 3NUYA 3VS5A 2UZEA 4IX3A 4JBPA 3PXKA 4W8EA 5FP5A 3SKCA 4FV0A 4HCUA 3V5PA 4AE9A 2IVUA 2WO6A 3VAPA 4PV0A 2QONA 3R9DA 2XIXA 4YC6A 4HPTE 4FV6A 4NM0A 1ZP0D 4KKHA 4Z9LA 3Q9ZA 5D11A 4B9DA 3QTZA 4MK0A 4DEGA 5D41A 1IA8A 5F95A 1JVPP 4R1VA 1GJOA 4L7SA 2V7AA 4KIQA 2ZFYA 5M56A 4OLIA 3CE3A 3A61A 3QZIA 4IJPA 4WA9A 4MKCA 4LL0A 4F7JA 3DQWA 4ANQA 3AE6C 3LCKA 4D9TA 1ZWSA 3QTQA 1O6YA 1PXJA 3VQHA 4C4EA 2WDQD 1GIHA 1WVWA 5JMSA 3LW0A 2WMAA 2ZAZA 2E9NA 5AJQA 2F4JA 2OXXA 3CLYA 1RE8A 2Y4IC 2ZM3A 3LXPA 3F9NA 3OBGA 1ZARA 2HY0A 3NUSA 3SXFA 4C3PA 1V0OA 3BWFA 2X9EA 2R4BA 2RFEA 2BZHB 3WE8A 3ZFYA 1H1WA 2CLXA 3MN3A 4AW1A 2CSNA 3UVQA 3KY2A 4FTTA 3UYTA 3ORXA 3U55A 1Z57A 4JL9A 3SOCA 4KAOA 3WF6A 5FDXA 1OPLA 2Z7QA 4GS6A 1TQIA 5TF9A 1WAKA 2H6DA 4HPUE 4E4NA 4GK2A 4ZY4A 2WDRC 4UY9A 3DDPA 3UIUA 1KF6D 2BR1A 3G6HA 4YJTA 3W0NA 1WBWA 4HYUA 3RM7A 5HTBA 4FTLA 3V5JA 3QLFA 3CTQA 3OEFX 3VRBC 4M0YA 5CYIA 2JGZA 4F1TA 3UVRA 4E26A 4BIDA 3OCGA 3SOAA 2PVMA 5HCXA 2C6DA 3ZM9A 3TIZA 3VF8A 4QP1A 3KEXA 3UOHA 3AE7D 4NUSA 3EQRA 4RGJA 4AW0A 4EC9A 3VS7A 1PXKA 2OIQA 4IB5A 4XP2A 2C3LA 3GU4A 2IZUA 2C6MA 5CWZA 4CZUA 2C6KA 4BBMA 2GNGA 3UJGA 2PE2A 3WZUA 3AEED 2YABA 3UPXA 5BVOA 3DLZA 5AMNA 3IDPA 3VS0A 4Z7HA 1SVHA 3A99A 3HAMA 4QMVA 1UVRA 5E8UA 3SLSA 3E92A 4DFXE 4ERWA 3E87A 5IF1A 1A48A 4RC2A 3MI9A 4R5SA 4FOCA 4EOIA 4DDGA 4FTKA 1V0PA 3M11A 5HLWA 3EZRA 2XCHA 4NCTA 2WS3C 1XH6A 5AX9A 4C4FA 4MUQA 2PTKA 4BGGA 3CS9A 4F6SA 4IAFA 3AE9D 4S32A 3D2KA 2CGVA 3MFUA 3RNYA 2YWVA 5DA3A 5C1QB 3P4SC 1XKKA 1ZOEA 5HIBA 3O7LB 3COMA 3TKUA 2JAVA 4F64A 5CF6A 3IO7A 5EYCA 4BCOA 4ITHA 3RPOA 3W0MA 4YP8A 2V55A 4FL1A 5CF8A 2PZPA 3GOKA 3AE8C 5KMOA 4RA4A 2PVKA 2WELA 3BV3A 5K5XA 4OR5A 4PTGA 3C51A 3R7EA 2R0IA 2IPXA 4RZVA 5CASA 4O21A 3P4KA 5HG8A 2VV9A 4BB4A 4IDVA 2F49A 3DZOA 2H88C 3BQCA 3EMGA 1NA7A 1UU3A 4NW5A 4I6BA 3UDTA 4CLIA 4I20A 3VUHA 1Y57A 3FMHA 4QMTA 3EQPA 4NU1A 3BGQA 2RIOA 4XG6A 4IAYA 2HIWA 2VWWA 3O71A 3AEAC 5A46A 4Q9SA 3I6UA 4EOJA 3O5AA 5I4NA 4AT4A 2J0KA 4G3GA 4G5PA 1JLUE 2PYWA 5M4FA 1XH8A 3QRIA 1XH4A 2X2KA 3ETAA 4HZSA 3HRBA 4UWCA 2FVDA 4APPA 4XYFA 4EH6A 3FI4A 2C6EA 4KB8A 3RPYA 3ZSIA 3QXOA 1KE7A 2NNWB 2V7OA 3QZFA 3O8PA 2QKRA 4XP0A 3TKHA 4HVHA 2YISA 3UIBA 3FMNA 3FQHA 3CIKA 2VWZA 5EHOA 2ETKA 2QNJA 5AP0A 3R00A 1UA2A 3TZ7A 3NVKI 2W5HA 4IDTA 1WBOA 4JQ8A 1OZ1A 4DFBA 4ACDA 1PJKA 3H4JA 1QPCA 4LMUA 4QYEA 5FXSA 2J7TA 2O64A 4CFFA 3OTUA 4R6VA 2EB3A 3HMIA 3LFBA 3E63A 4FV4A 3CQUA 4WKQA 2GQGA 5EDQA 2VWXA 1H08A 2QODA 2Y7JA 2OXYA 2C5VA 2X7FA 3MY0A 3ORMA 2GCDA 1MP8A 3QCYA 4L52A 4GKHA 4XG8A 5AV3A 4FT3A 3R9RA 4EZ3A 5AAFA 3L9LA 1DAWA 1OGUA 3F88A 3ZRKA 3P1AA 2C69A 3W32A 4L8MA 2QR8A 1LEZA 4YJUA 5JZNA 2BZJA 3PP0A 1LR4A 4RJ3A 2YCSA 4J7BA 4YZDA 2OZAB 3MFSA 2VNYA 5DEYA 3VHEA 4YLJA 3D7TA 1H28A 1YVJA 3ERKA 4YPSA 5BVWA 3TNPC 3UODA 2XVDA 4U45A 1BKXA 3VWAA 4TW9A 1OL7A 2QI8A 4Y72A 4UXLA 3TN8A 2X8EA 2X4FA 3C1XA 4NM3A 4O7NA 4QT1A 2J0LA 3KRXA 2YM8A 3HMPA 2B9JA 3ZS5A 2VTIA 2YWPA 3MVHA 3KXGA 1H4LA 4UV0A 4MNEA 4AP7A 2CKPA 3NNXA 3U4WA 1KE9A 3C5UA 4CEGA 2R3KA 3L8XA 3OXTA 3R7YA 3RHKA 3ZO4A 2R3QA 4DCAA 5LOHA 4JIKA 3BE2A 4DFNA 4FTUA 2WDVD 4IH8A 4BYIA 5KUPA 4L3PA 3FSKA 4OUCA 3QYZA 4AAYA 3MWUA 4QMNA 5CX9A 1TVOA 4JBOA 3P4RD 1OUYA 4R7HA 3NCGA 4FSUA 4W4WA 3UP2A 1Z5MA 3RPVA 1YHVA 3O51A 4PTCA 5BNJA 4XOYA 2W0JA 3WF8A 1L0VD 4EWHA 3GP0A 3KA0A 4D0WA 4UYNA 4Q9ZA 3L9PA 2GHLA 1F0QA 2WTCA 5HG7A 2WQNA 5KCVA 1NEND 2ITVA 3QHRA 4L6QA 3UOLA 1O6KA 1F3MC 3AGMA 5IQBA 3KFAA 4DFUA 3OWLA 5HD7A 2BILB 2B54A 3FC1X 5JZJA 4RVKA 4EYJA 2BDFA 2OW3A 4AAAA 2WU7A 3QQFA 2FB8A 3BU5A 3R1SA 2AC3A 3HAVA 4WT6A 3R7VA 3DA6A 3PFQA 4XH6A 4FT5A 4C0TA 2OK1A 1OKWA 2FH9A 4QMOA 4G16A 2XIZA 3IPHA 1P2AA 2JFMA 2F7XE 1UKIA 3FI3A 4DT8A 2B55A 2R3LA 3ML1A 3LOKA 5HG9A 4AA5A 2UZLA 5DGZA 2WMUA 3E7VA 5FGKA 4E1ZA 4P2KA 3WZDA 3AKLA 3I6WA 3AD4A 1U5QA 3OWKA 3Q9XA 4D9UA 3BL9A 4CG8A 4PNKA 4GFMA 4HYSA 1WZYA 3VBVA 3SVVA 4MD7E 4BDIA 4DTBA 4PL5A 3CD3A 2GPHA 3EZVA 2QR7A 2X2MA 1JKLA 2O63A 4GCJA 4H39A 3PWDA 3MVLA 4U6RA 3V6SA 3D15A 3EFWA 3ZXZA 3OCSA 3LFCA 5CLPA 5M4IA 1G3NA 3A8XA 3F3VA 4MBJA 3ZO2A 3PIZA 4NKAA 2IWIA 2ZB1A 4FSQA 4XV9A 4I22A 3PUPA 3QCXA 5J87A 4ZSJA 4LRKA 5FM2A 3E8DA 3FZRA 3AT4A 1W82A 4YSXD 3CGFA 3ITZA 5BX0A 3R30A 2YACA 1UWJA 4CTCA 3SFED 4NWMA 4MWIA 4BZOA 4GYIA 2UZNA 3COKA 2R3IA 3QZHA 3DS6A 2C5NA 5HORA 2E9UA 3G9LX 2HZ0A 3EL7A 3KMWA 3CIRC 4ACMA 5JGDA 2YIRA 5M51A 4YSYC 3KVWA 5T3QA 2LAVA 4E8AA 2PHKA 2VTPA 2VTQA 4RRVA 4AZSA 2VTTA 1PXIA 1G5SA 2ITUA 1Q4LA 5AV0A 5A6OA 2BCJA 3AEBD 4QDVA 5ANDA 4ACHA 1R78A 3DBDA 2PE1A 1PMNA 2WOTA 1MUOA 4L44A 1L8TA 4FKUA 4B8LA 2JITA 3KQ7A 5CQUA 2X9FA 4YSZC 4J98A 5I9VA 4ASEA 4F0FA 5M44A 2I0YA 4P5QA 3DK3A 3U8WA 5L2IA 4FEWA 3G6GA 4DYMA 2R0UA 4E6DA 4E93A 3VRYA 3QRJA 5IA2A 1UU9A 2XIKA 3VRAD 3DT1A 4GIHA 3LXNA 4IB0A 1QL6A 4QMMA 4Q5HA 3UZRA 2XK7A 5HU3A 4FVPA 1SM2A 2WTKB 3D5UA 3K2LA 5AM6A 3NUAA 4DEAA 2JC6A 2WS3D 5M55A 5AAEA 3CKXA 3QUEA 3SD0A 1H8FA 4PF4A 4DHJA 4OTWA 5DRBA 3AEDC 3MPMA 5C8NA 1B38A 5HQ0A 2O5KA 1OL1A 3P4SD 2ETMA 2HY81 3AMBA 3HMMA 3O96A 4M97A 3A8WA 4PDSA 4PQNA 2RFDA 2PVYA 4D5HA 4X6RA 4EYMA 3WOWA 4APCA 2PE0A 2GU8A 5CSWA 5I9WA 3VS3A 3N4TA 4FV5A 4R1YA 2X8DA 3L8VA 3AE8D 4Y5HA 5E91A 1OITA 3RAIA 4ACGA 5EG3A 4J53A 1JKKA 5ANOA 3A7JA 3BL7A 3PJCA 4EHVA 5CAQA 5KMLA 1KV2A 5LXMA 2NRYA 3AE3C 3FI8A 5KZ0A 2WEIA 4GJ2A 1F5QA 4I1ZA 3WF7A 5BUEA 3WYXA 3ZH8A 4CV8A 3UOKA 3ATTA 4ZIMA 4EI4A 4AT3A 4NJDA 2OF4A 5EM6A 5ETFA 2R9SA 2ZYBA 5E8WA 2W5BA 3QTRA 4XOZA 3S1HA 3G5DA 4II5A 4ZTNA 5AUYA 5CU2A 3TCPA 3TDWA 4BCIA 2QG7A 3MFTA 1IRKA 4FK6A 5JRSA 4MXYA 4RVTA 3Q6WA 1NVRA 1OKZA 2PUPA 3EHAA 3WZJA 5L6PA 3PYYA 3Q4UA 3VVHA 3IGOA 4PUZA 2PZIA 5CEOA 5AV1A 2P33A 2XCKA 3QTIA 4O83A 3VS2A 3ID6C 4YZCA 1YI3A 4YZBA 3P79A 5B2MA 4G9RA 4FJVA 2WU5D 4FIGA 4RC4A 3IQ7A 4XUFA 4GV1A 2UZVA 2AC5A 5H2UA 2IZTA 5D12A 3NYOA 4ALUA 3LMGA 3Q53A 3COHA 3QD2B 3KCFA 3QU0A 4HNIA 3AE5D 2OZAA 4MBLA 4U0IA 4M69B 4WNOA 3QL8A 5T68A 4CT1A 4YSMA 3FLQA 1MQBA 4F7SA 2H96A 4WNKA 4AE6A 2UZUE 3HDNA 3K5UA 4TKSA 5C3JD 4O27B 1OIUA 3R1QA 3ULIA 5ANKA 3D5VA 3WIGA 5KO1A 4IC7A 2C3IB 4DDIA 3EQDA 2B9IA 3JY9A 3MVMA 4N4SA 5DEWA 4JX7A 3UP7A 5A14A 3BGPA 2X4ZA 4C2WA 3T3UA 4XLVA 4O7LA 4W4XA 4A4LA 4F99A 1YQ4C 4V04A 3SDJA 3F3WA 4O0YA 1H0VA 5GINE 4QQJA 2ZOQA 2GNFA 4FMQA 4O2PA 4AXFA 1AD5A 2HW7A 5DT0A 3RK7A 3TL8A 3W55A 2B1PA 4ZTMA 3TUBA 4ZTSA 4A4OA 4AWIA 3N9XA 3IW5A 4F0IA 5C27A 4U9AA 5IEVA 1XJDA 2W1DA 3AKJA 3C4CA 4RJ6A 3ACJA 4IVDA 1CTPE 3PPKA 3FL5A 5KKRC 4Y85A 2RKUA 4JAJA 1WVYA 4CGAA 2XM8A 3KXZA 3HRCA 3DKGA 3I7BA 3KRJA 4FIEA 3VIDA 4B4LA 3UG1A 3PZHA 4YU2A 5L8KA 4LUEA 5AWMA 1SVEA 2YM4A 5L8JA 1YW2A 3DQXA 4G5JA 4I24A 2RF9A 3LHJA 1E9HA 4FZDB 1OIQA 4BDGA 3IW7A 4NTTA 4U81A 4U79A 4WO5A 5HLPA 4E4XA 4YTPC 4RG0A 4DGMA 5T6KA 3PE2A 5EQPA 3JS2A 4RMZA 4EH8A 3BYVA 3FZPA 4IX5A 2ZV9A 4BBFA 3VJOA 3AEFC 4WOVA 5BVDA 1NVSA 4F70A 2W4KA 2C5YA 2JIUA 4LDTA 3NYVA 3A4OX 4JDIA 4C61A 3MH3A 5FBNC 4L9IA 3VC4A 3K3IA 3KN5A 3PXFA 3QCSA 3TYKA 3MB7A 2WMSA 4C2VA 4GT3A 1U4DA 1IEPA 2GNIA 3H30A 2WP9C 3Q04A 3ROYA 4FC0A 4PDOA 3SGCA 4E5WA 3S00A 3EQCA 1NW1A 3TM0A 4YT0C 3IGGA 2XYUA 3QF9A 4CFXA 2XMYA 5J5SA 3MA3A 3KF7A 3RINA 5CU3A 4IBMA 3VW6A 4CMOA 2FUMA 3AGLA 3R83A 3DAKA 5AUUA 2PK9A 5EM5A
chains in the Genus database with same CATH topology
4DH3A 1YDRE 4QTAA 4L45A 1Q8YA 4AX8A 3EQHA 2PPQA 2V22A 1I44A 2BAKA 3QZGA 4FIJA 4PDYA 4D5KA 3KK8A 4XG7A 4R3PA 4LOPA 5FLFA 5GHVA 3SG8A 3EJ1A 1UNLA 1GAGA 3FPMA 1M7NA 1CKIA 2WQOA 2UW5A 2Y6MA 3IW8A 4X2NA 3EH9A 3LIJA 2VWUA 5C03A 3RK9A 4DBNA 4JDJA 2ITZA 3LZBA 3NGAA 3NNWA 3NWWA 5AP7A 2VO6A 4U40A 3ZXTA 4NM5A 2WHBA 3QUDA 1AQ1A 2OF2A 3CXWA 2EVAA 4IW0A 2BDJA 3ELJA 3ULZA 4AG8A 1KSWA 3KREA 4FKPA 1YHSA 2VTOA 4I6LA 3PA3A 3BU6A 3IECA 1YI6A 2WTJA 2OI4X 4ZLOA 5CTPA 4ASZA 1YWVA 3PZEA 2WU6A 5CEIA 2HOGA 2W05A 4BCPA 5M4CA 1H07A 2PL0A 5EW3A 3UQFA 4R7IA 2G9XA 5F1ZA 4DHFA 4AZFA 2KULA 5DN3A 1YDSE 1YOMA 3HP5A 4I6FA 2R3GA 4I5PA 2WNTA 4L00A 5IG1A 4OBQA 2YZLA 3KB7A 3MSSA 3PPJA 4J97A 3ZUTA 1Q3DA 5B7VA 3BYUA 3TACA 2SRCA 4FUYA 4HCTA 3LFAA 3RTPA 4FE2A 4KABA 5EI8A 3W8LA 2UZDA 4KIPA 5BYZA 1ZZ2A 4QMZA 4WG3A 4AZEA 4WIHA 5A4QA 3IKAA 1ZY4A 1XWSA 3KK9A 2XALA 1ZYSA 2R2PA 5HLNA 4QOXA 5BYLA 2UVYA 1GIJA 4E5AX 5IEXA 2HXQA 4O0WA 4XCUA 4F9CA 5HE3A 1YRPA 4UALA 3O7LD 2OBJA 3FE3A 4C35A 2QU5A 2OIBA 4FVRA 3RKBA 3R22A 4GUBA 2J0IA 2UZOA 3ENHA 4QYHA 1UV5A 4RFMA 5GNKA 2W1FA 5E90A 3DNDA 1Y91A 4N0SA 4DCEA 4IVBA 4BCGA 5FDPA 4JBVA 4ZS0A 5HBEA 3LXLA 5HEZA 3GB2A 4WG5A 4OTDA 2YFXA 4XG4A 5HBJA 5JSMA 4I0RA 5L2TA 3HLLA 3SV0A 5HE1A 3U51A 4AS0A 2R3FA 4Z55A 4ZTQA 3LJ0A 4Y46A 3GC9A 4ANMA 2AUHA 2VRXA 5LVPA 2XH5A 1JWHA 3ODZX 2QQ7A 2UW8A 4GW8A 2IW8A 5ETAA 1OECA 3FLSA 4DEDA 2BIYA 5FTOA 3NFGB 4LV5A 4Y95A 3ZLXA 3E8EA 2FO0A 1M2QA 3AMYA 2VO7A 4QEBA 5ETIA 5HBHA 5TOZA 3WBLA 3KRLA 3KXXA 3P7AA 4LL5A 1SYKA 3GI3A 3A7FA 4BTMA 4IM3A 1DI8A 3C50A 4GUEA 2QOHA 4IM2A 4IQ6A 4ZSLA 1RDQE 4E4MA 5KMKA 5C01A 3ZHPC 2YIWA 4O82A 2QD9A 4V05A 5J9YA 2YJRA 3R02A 4FNZA 5FEDA 4FTIA 3II5A 3WIKA 3RGFA 4EOQA 5IDPA 2GNLA 3LLTA 5A4CA 1Q99A 3V8SA 4AFJA 5I5ZA 4QYFA 3I79A 2XKEA 3BE9A 2ZM4A 4S30A 2WEVA 4ZY5A 3QQUA 4ZJJA 3TZMA 4BDJA 1E1XA 3PVBA 1FMOE 1PXOA 4RWKA 3BPRA 3RZBA 3W0OA 5CANA 3MY1A 3NPCA 4FSRA 3I5ZA 3OWPA 2V5QA 3FMLA 4FKSA 4BTKA 3PFYA 3FJQE 2GTNA 2GS7A 3QD0A 4LV8A 4MF1A 5B2KA 2YM3A 4TYIA 4MYGA 2P4IA 3A2CA 5KX8A 2VTSA 4DG3E 2OFUA 5IUGA 2ZMDA 3QTXA 3EKNA 3R8ZA 3PPZA 3R7OA 3LFDA 3CEKA 2WMRA 5ANGA 4ZSEA 2QURA 4IEBA 1Q61A 4TT7A 3BEAA 1G8SA 4GK3A 3V5TA 4DINA 4FYOA 4RIOA 2GQRA 4M0ZA 4D28A 4NKSA 4F9WA 4F7NA 2JIVA 4FGRA 2UW4A 3FXXA 2VTJA 2QOFA 4O91A 4XV3A 5EW9A 4I5HA 3P08A 3BBWA 3MTLA 3VUDA 4FT9A 4A9YA 1IASA 2O3PA 2XBAA 4XBRA 1CSNA 1XHAA 2Z2WA 2ITTA 4EOSA 3Q3BA 4AGUA 2Z60A 1BX6A 3FZ1A 2VD5A 2XKDA 3P86A 3QC9A 4IZAA 3G51A 1FBNA 3BX5A 3FAAA 4FA2A 5A9UA 3QAME 4D1XA 2Q0NA 3RCJA 2PMLX 2XNBA 3QQLA 4BDEA 4M68A 5EOBA 2PWLA 5I0BA 5CXHA 2EU9A 3LFEA 3GU5A 4L7FA 4BDKA 3CR0A 3PXQA 5EW8A 4B8MA 3UMXA 3HV3A 1Q8WA 5E8XA 4UN0C 4FV7A 4C4IA 4F78A 4XV1A 3FUPA 4ZK5A 4TWNA 3C7QA 3W2SA 4PX6A 1H00A 3HV7A 4WRGA 5IPJA 3P7CA 4DLIA 1ZOGA 4XBUA 2WFYA 3PG3A 2DUVA 1OKVA 4L68A 4RVMA 3JVRA 1ZZLA 2QLQA 3EKKA 3F69A 3QD4A 4TYHB 3LFSA 3IOKA 3PA4A 3DGKA 5LARA 3RM6A 4BIEA 4C58A 4QMXA 4DFLA 1Q8TA 1P5EA 4HGLA 5AADA 5IQDA 3GCSA 4TWOA 2YA9A 5FEQA 5HNGA 2FGIA 3TUDA 5EDPA 3LM0A 4QMYA 3TV7A 2BIKB 3HECA 4JOAA 4OTRA 4FT7A 3HV4A 4QO9A 2W1HA 4BCFA 3HDMA 2YM5A 1CDKA 2BTSA 1MRUA 3K54A 4BCHA 2YIXA 5BUIA 4YO6A 2WOUA 3ZLWA 4FT0A 5EHYA 5C4LA 4O0SA 3KF4A 5AP2A 4D4RA 4I92A 3TI1A 5FM3A 2BALA 4Q2AA 3VS6A 5CEPA 4ZTRA 2REIA 3HZTA 2F7ZE 2G15A 3ZRLA 3P9JA 5DG5A 2PMIA 3F82A 5EYKA 4HCVA 4BTFA 3O8TA 4FZ7A 2ZV2A 4AW2A 4EKLA 3U6IA 2BFYA 3CY2A 2RGPA 3UMWA 2GFSA 2J6MA 4LM5A 3C4ZA 4D2RA 2P2IA 2EXCX 5BYYA 4BI1A 4KUJA 4GSBA 1XH5A 1CM8A 4HYHA 4QRCA 3UIMA 2X0GA 4AT5A 4K33A 3A60A 3Q60A 1H01A 5BVNA 1JOWB 4CMUA 5HO7A 2PSQA 5JGAA 2UZTA 4F09A 4ZZNA 3OP5A 2CDZA 4YHTA 4JG6A 4XS2A 4QMSA 1ZYDA 3GC0A 3OT3A 4IAIA 5LWNA 5FP6A 2B9FA 4FTQA 3ALNA 1UNGA 4NW6A 1QCFA 3CPBA 4FOBA 5KBQA 2WIHA 1OIRA 3AC1A 2PUNA 4RIWB 4NH1A 4WSYA 1YXUA 4QTCA 3GCQA 4ZZMA 1J7UA 2RG5A 3KMUA 3BHYA 2DQ7X 3NVMB 2WIPA 3BV2A 4FZFB 4O7WA 3WILA 3NDMA 4RZWA 3CQEA 3DZQA 3MH0A 4N6YA 4MNFA 4RIYB 4DF3A 4E4LA 4H3BA 3EFKA 4EUUA 2PZRA 3RWQA 1OVEA 2WTDA 3LPBA 4OGRA 4F9AA 4IACA 5H3QA 3R8MA 3W0SA 5EI2A 5CAPA 2BFXA 3DFCB 4O7VA 4M8TA 4AGDA 4DH1A 3OG7A 3DJ7A 2OFVA 2XANA 4LRJA 5M06A 3JVSA 4U3YA 2UZBA 2R3JA 4IHPA 5AFVA 3UNKA 4YGAA 5HIEA 2VTMA 5H8EA 5LJJA 4FNXA 3NUPA 3VUKA 2A19B 4D4SA 1W84A 1XQZA 3RI1A 4DTKA 4EOLA 3HV6A 2WD1A 3LAUA 5E9EA 5IQEA 3C0HA 5HGIA 3ORIA 3OW4A 3ZO3A 4IFCA 5E8VA 2R3NA 4XV2A 5LQFA 4FYNA 4NL0A 2OJ9A 1OI9A 1WVXA 4GFGA 3AG9A 4RA5A 3F3TA 4FR4A 2ERKA 5HKMA 3W2QA 3HL7A 4CFNA 3F66A 5EDRA 3MY5A 4JG8A 3GU7A 3VBXA 4IVAA 4IX6A 2G2IA 3OY3A 1QMZA 1S9IA 5DE2A 3VUMA 2PULA 3GCPA 2UW7A 2YCQA 5BMMA 2XYNA 5CF5A 3LMHA 4UWBA 5DBXA 3G9NA 3PSBA 3VW8A 5KKRB 2O8YA 2XK4A 1M17A 1KOBA 4AF3A 2X1NA 4BIBA 1IAJA 1TKIA 2WKMA 1BYGA 3DU8A 1B6CB 4FEVA 4C3FA 4G3DA 3MIYA 2VGPA 2VWIA 4R7BA 1RW8A 4F0GA 2IVSA 4BDDA 4C7TA 1GZNA 3KL8A 4DT9A 2YJSA 3ORNA 2QC6A 5EH0A 5BMSA 3QLGA 4GT4A 2EWAA 4AA4A 3KRWA 3LLAA 2BAJA 4XP3A 3ACKA 4GK4A 4I23A 5FTQA 3ZEPA 4QMQA 2G1TA 3VF9A 3KXNA 4FKGA 3NR9A 4OTHA 2OH0E 4YC3A 3E62A 1H1SA 3CJFA 1FVTA 3EFLA 3CD8A 4BBEA 1DM2A 1BL7A 3EQIA 3FSFA 5ANJA 5A4TA 2JKMA 1VZOA 3DJ5A 2W5AA 4OW8A 2BTRA 4M13A 5EKOA 4X0MA 1OGYA 3NNUA 4QQ5A 5JFXA 2GS2A 4KINA 2X7GA 3F5GA 3NYXA 4IWDA 4LRMA 3E93A 1FPUA 2VTAA 4RVLA 5CEQA 4LI5A 3GC7A 2PZYA 1STCE 4IAZA 5AP1A 5DVRA 4GG7A 4BGHA 3C4WA 4TNDA 3FLNC 4NIFB 1Q5KA 3EN6A 3MJ2A 3BZ3A 5I9UA 4KS7A 3TNQB 2J9MA 5EM7A 5LMAA 4IWOA 3GCUA 3H9OA 4F65A 4YMJA 4X6QC 3QBNA 1R3CA 2A2AA 3FY0A 2ITWA 4EJ7A 2CGWA 3LFNA 4FKIA 2XUUA 4HGSA 5AP5A 4USEA 3C5IA 3AC4A 1R0PA 2VO3A 3W0RA 2C3KA 3Q96A 1G8JA 2W17A 2GFCA 3S4QA 3C0IA 4O0UA 4CFUA 4DLJA 3QA0A 3R73A 3NX8A 3SHEA 1NVQA 2DYLA 5IISA 3AD6A 3MA6A 5HI2A 3BGZA 4I21A 2QOOA 3KU2A 3NAYA 4BCNA 4NM7A 3UZTA 4U8ZA 5EQEA 2R3OA 1P4OA 5D7VA 5ACKA 2OJGA 3V3VA 2XRWA 4EZ7A 2YM6A 4A9UA 1PYXA 4DAWA 1PXPA 3PY1A 3BU3A 3G33A 3LQ5A 5I9ZA 1VYWA 1Y6AA 3UGCA 5JGBA 5CSHA 3NMUF 2RFSA 3MH2A 1GZ8A 1UKHA 2OWBA 3FWQA 2AYPA 1HCLA 5J9LA 2OG8A 3MYGA 4KBCA 4MX9A 3VONA 2C1BA 3SC1A 2GS6A 3ZC5A 4NZWB 1DS5A 4YBJA 4N57A 4GU9A 4XG2A 3V04A 1WBSA 3NIEA 3O23A 4K0YA 4TYJA 3BEGA 2I1MA 4YJNA 4FSWA 4FKWA 3TIYA 1DAYA 3UQCA 2W9ZB 3FHRA 3RPSA 1KWPA 2WZJA 4CTBA 3GBZA 5AV4A 4TYHA 4BI0A 4EHGA 2XNEA 3S3IA 3D9VA 3WF9A 3IG7A 5LVLA 3MVJA 4DG2E 3F7ZA 4CFMA 2PU8A 2JLDA 3H0YA 1YOJA 2VNWA 4O96A 4TWCA 3OOGA 4YHJA 3ZCLA 3NUXA 3ORKA 4GYGA 3OCBA 4FBXA 4GG5A 4I5MA 3ZTXA 4C33A 5H8GA 5K4IA 2Z8CA 5CAUA 1LEWA 2JKQA 3FLZA 3ZLSA 4FIFA 1P4FA 4FTNA 5HICA 3ZBFA 4EUTA 4I5CA 1UNHA 4DHIB 4PY1A 4CMTA 5DT4A 4DEBA 2Z7SA 3MTFA 1OPJA 3QFVA 4FK3A 2B7AA 4WHZA 5CU4A 5HO8A 1YXSA 2E9PA 4HVDA 2VGOA 5DYJA 2WMQA 3G90X 3OF0A 3UO4A 3S2PA 2Y9QA 4HJOA 3R2YA 4PNIA 4C34A 2W1CA 4YJSA 2I7QA 1MRYA 2CHLA 3BYOA 3DK6A 1IR3A 5AP4A 5FXQA 2YITA 1ND4A 3CPCA 3O8UA 4ZSAA 4ZS4A 3ENMA 3U54A 4PMPA 4IZ5A 2A27A 4DEHA 5DNRA 4G3FA 1U54B 3TDVA 5CENA 3F5XA 4AGWA 4H1JA 3REPA 4QMPA 3CSVA 3BYSA 5M53A 3MPTA 4EZ5A 3VBTA 4HW7A 4JR7A 3R8LA 2OKRA 3RCDA 2XJ2A 2B9HA 4DEEA 2FSLX 3SRVB 2NRUA 2C0OA 4UYAA 3AXWA 2XP2A 2P55A 3E5AA 1KE5A 3ZMMA 5HD4A 5CVFA 2IG7A 4FKJA 3MS9A 4D1SA 5BPYA 3OZ6A 3R8PA 4RIWA 4J71A 1VEBA 4AQKA 1FGIA 2RL5A 4BDHA 4Z7GA 3C4XA 4ALVA 4JVGA 2YDJA 3L8PA 3PSDA 2LGCA 5G1XA 2HZNA 3UC4A 3DV3A 3SX9A 1J7IA 3V8TA 4LGGA 2UVZA 5CEKA 2J90A 5ACBC 2GHMA 4U42A 2QKWB 4RIYA 1V1KA 3IS5A 2HW6A 3FLYA 3JXWA 2VX0A 3EN7A 4LQMA 4YURA 2YM7A 4JBQA 4D1ZA 5I9YA 5DLSA 4HVSA 2ONLC 4FTCA 4G3EA 5AV2A 1XH7A 4FV1A 1NXKA 5AAGA 1PMVA 2WXVA 4G9CA 4QYYA 4O86A 3DBFA 3FEGA 4RWIA 3I5NA 4ZXTA 5K3YA 3DFAA 4GRBA 5CSVA 4HVGA 3BHUA 2YZAA 5DPVA 4K2RA 2OJIA 4UZHA 1E1VA 4RX8A 2BVAA 3E3BX 3UNJA 2ONLA 2XNNA 4I6HA 4EH3A 3W2CA 1OBDA 1JBPE 4WBBB 1YKRA 3TUCA 3QKMA 4HGTA 4U97A 4CLJA 2WMTA 4QPAA 2ITPA 4CKRA 4EH7A 4S34A 1V0BA 3K3JA 4Y5QA 2PVNA 3R8UA 3RVGA 3FMJA 4FZ6A 1H1PA 4IAKA 2IVTA 3LCTA 4EKKA 4F9YA 3OROA 4H05A 1WBPA 1XMLA 4U3ZA 4ONAA 4FSNA 1AGWA 3R1YA 4CSVA 3RAHA 3DXNA 3A62A 3DAJA 4ZOGA 3SQQA 3M1SA 3RMFA 5LCKA 3DB8A 2J5FA 5E1EA 1PF8A 3KVXA 4EQMA 1PXMA 3LKMA 3DKFA 4CT2A 1I09A 3QHWA 1ZYJA 4BGQA 5CSPA 3Q52A 4RC3A 5CALA 3EN9A 4RLKA 3LMIA 1IAHA 5C8MA 4DTAA 3L9NA 3QTUA 4LUDA 3ET7A 4JI9A 4DA5A 4G34A 4K6ZA 4EK6A 3IW4A 4QDEA 4YTCA 1YXVA 2PVHA 2YAAA 2KTYA 3DKCA 4MWHA 1OL5A 3NCZA 4FKOA 4Y83A 4N70A 5FRIA 2ACXA 3ZFXA 2XA4A 3DCVA 5HNIX 3PLAE 3DXQA 2CLQA 4DG0E 2BROA 5CY3A 2QU6A 4JIAA 5DR9A 4BRXA 1FQ1B 2Z7RA 2WTWA 2BKKA 5IQAA 4AXDA 2XNGA 4IFGA 4LV7A 1W98A 2YEXA 5JFWA 2FSMX 2I0EA 3W2PA 3SAYA 4TRLA 4RJ4A 4NT4A 4NFMA 4H1MA 2OZOA 4PP7A 5C4KA 3OD6X 4D4YA 4UZDA 4D2SA 3KIOC 2Z02A 4H3QA 3ZUVA 2ZDUA 1YXXA 3QRTA 4O2ZA 5E1SA 3FXZA 4A9RA 5CAOA 4CQEA 4UB7A 1REKA 4L3JA 3HA6A 4V0GB 4KA3A 4G6OA 1ZXEA 3NW6A 2VTNA 3V5LA 2CKQA 5IH6A 5GIOE 4BCJA 1R1WA 3H0ZA 1DI9A 4U7ZA 4FSMA 3VBQA 4O6EA 3LJ1A 3WARA 4F1OA 2ITNA 4QP9A 3JYAA 4BR3A 3MFRA 3PUFC 3VNTA 4WUAA 3QWKA 4C4GA 3CCNA 1ZRZA 5E4HA 3LFQA 5EYMA 5IEYA 1FGKA 5EFQA 3CC6A 2G01A 3F3UA 4XMOA 5F9EA 2VZ6A 3CKWA 3U6JA 4ZLZA 4UWYA 3QGYA 2H9VA 2QOBA 5IU2A 2X6EA 3FBVA 3D2IA 5IUIA 2CN8A 1VJYA 4EK4A 4BCMA 5CVHA 1JNKA 2JIIA 5F20A 1H27A 1BMKA 1GY3A 2CPKE 2X81A 3W8QA 5HVJA 2X6DA 4OT6A 5CVGA 4BJJB 4GFOA 5DRDA 3P23A 4F7LA 4L42A 5CS6A 4JDHA 5CSXA 4YUQA 5J1VA 5AUXA 2VAGA 4OT5A 4GU6A 3NYNA 4J52A 1Q8ZA 3HX4A 4EORA 3U9NA 2C6IA 1WFCA 3LM5A 4F4PA 4IWQA 3HNGA 3DBCA 3FKOA 3NLBA 4ZMFA 5HX6A 2R64A 2C3JA 3HYHA 1ZMUA 4YNOA 4B7TA 2W9FB 4TNBA 3MB6A 3PWYA 2VN9A 1JPAA 2ERZE 2ZV8A 5TR6A 3RJCA 5KMJA 3K5VA 3BKBA 2F7EE 3PRFA 5DH3A 3KC3A 4J96A 3THBA 4A07A 4RX5A 5KHXA 4QTDA 2QO7A 3GNIB 2P2HA 3UYSA 2FSOX 1Q24A 3T9IA 5B0XA 1Q62A 2A1AB 3FYKX 3UZPA 5EYDA 3BBTB 4JDKA 1HCKA 5F4NA 4AN2A 2BRMA 4ARKA 4EH5A 3L9MA 3HEGA 2UW3A 3QWJA 5KNJA 3D94A 4GH2A 4RIXB 5BV3A 3OY1A 1CKPA 5BQ0A 3VBWA 1Q3WA 3AQVA 2XK8A 2E2BA 2JBOA 4AGCA 4CKIA 4JRVA 3RAKA 4QPSA 1W8CA 3TTIA 3UQGA 2V62A 2ITYA 1YI4A 4YLLA 2JDSA 3EQFA 5GJDA 2I0HA 4QP7A 4I4EA 3V8WA 4QMLA 3I60A 1A9UA 3R28A 4QP4A 3AKKA 5CNNA 4TL0A 1KE8A 3QKKA 3AC2A 3JY0A 3UDZA 3PTGA 1H24A 2BUJA 3ZOSA 2J50A 2CNQA 5HNBA 4KKEA 4NSTA 4H3PA 4EQUA 5AP3A 1Q97A 4E20A 5IMEA 4LG4A 1UWHA 2WB8A 5M4UA 5KE0A 2I40A 4IWPA 3R8VA 3ZYAA 4IJ9A 1B39A 5HESA 1FINA 1U54A 3HGKA 4RJ5A 1J7LA 3UBDA 3UC3A 4ENYA 4J99A 2YIQA 4RFZA 3AC8A 4MH7A 2Q83A 4FV2A 5HIDA 2ZM1A 4AXEA 3HUBA 5FD2A 3C0GA 4O0XA 5ICPA 2JD5A 5L3AA 3E8NA 4R78A 4RT7A 3SRVA 3TG1A 5CU6A 4EOOA 4GIIA 4A06A 5KMNA 3TWJA 1BL6A 4CKJA 4WNMA 4GL9A 3OEZA 2VWBA 4C36A 3ZSHA 4F6UA 4K77A 2HAKA 4E73A 4IM0A 2DS1A 1SNXA 2JBPA 2YCRA 1H1QA 3C13A 3GENA 3G15A 3GQIA 4S2ZA 4AFEA 5LVOA 4DH7A 3I4BA 2F2UA 3Q4ZA 4JAIA 4AA0A 4IIRA 2R3HA 4FG7A 4X3JA 5D1JA 1JSUA 4PTEA 2E9OA 5HCYA 3TJCA 2ETRA 3W0PA 3MESA 4PWNA 4YHFA 1VR2A 2QVSE 1ZAOA 4YSJA 4WBOA 2W06A 5AM7A 3GVUA 4ACCA 5TO8A 3S95A 3KCKA 2B4SB 4R5YA 4BHZA 4TN6A 2IZSA 5DIAA 4G6NA 5IMXA 4YBKA 3PXYA 2FYSA 4ZJVA 5K4JA 4FG8A 4L01A 4GMYA 2PVJA 4CXAA 4FUXA 2J2IB 5L6OA 4LOQA 2WGJA 2GNHA 2BKZA 5HHWA 3QKLA 4BZDA 3CTHA 3UDBA 2QG5A 4O7TA 4BDFA 4DGGA 4AOJA 1RJBA 4L43A 2WMBA 4QP3A 5AIRA 4AN9A 2XB7A 3LE6A 2HWPA 2PY3A 1Q8UA 2XZSA 4MHAA 4OBPA 3R71A 4GJ3A 3L8SA 1XR1A 4QYGA 2IW6A 1L3RE 4FKLA 3DK7A 3HV5A 3QA8A 4K18A 3SG9A 2FSTX 5FG8A 4BVUA 4D4VA 3T9TA 2H8HA 3E88A 2O65A 4IVCA 4MTAA 1YWNA 5HVYA 4RSSA 4X2FA 5AUZA 1ERKA 3H9FA 5AA9A 5BVKA 2E9VA 3C4FA 4JR3A 2GQSA 4ITJA 3PXZA 2XK9A 1OPKA 3TNIA 3ZRMA 5J1WA 3NZ0A 5C8KA 3OMVA 2W99B 4A9SA 5CZHA 1GZKA 1H26A 2JDOA 3I0OA 2ZJWA 2XF0A 2H34A 3EN4A 3Q32A 4OTGA 5H9BA 4BCKA 5JRQA 1HOWA 3ALOA 3PP1A 3ANQA 5J9ZA 2O2UA 4O38A 3ORLA 3POZA 3WE4A 4EK3A 4CNHA 4YO4A 2XNPA 4NCTC 3SXSA 3GFWA 2HENA 1FOTA 3B8QA 4U80A 4FV8A 3UDSA 4TYGA 3CTJA 5H8BA 3W1FA 4G31A 5A4LA 3R63A 3QC4A 3GT8A 3DAEA 3Q4TA 3UO6A 3H9RA 5AEPA 1U59A 2A4LA 1ZOHA 1FVVA 4LYNA 4OTQA 3V5QA 5IQGA 2A0CX 4ITIA 1RQQA 2Y8OA 3KKVA 5L8LA 4MAOA 5CU0A 3BLQA 5IA5A 5LMKC 5EOLA 2J0MB 3ORPA 1ZLTA 2R7IA 2VTRA 5ANIA 5E92A 4C37A 3UE4A 4WUNA 4XRJA 4E7WA 3PJ2A 3TT0A 4G3CA 3NRMA 3MGYA 4I93A 4Z16A 4M15A 3R01A 4W8DA 2W4JA 5HX8A 4DHZA 3AD5A 4LOOA 3FL4A 3LJ2A 1PYEA 3GGFA 4K8AA 5E8ZA 3OVVA 3RWPA 3T3VA 5M09A 5EKNA 2ESMA 4PMTA 3BLRA 4V0GA 3F5UA 1U46A 4YZ9A 1TQMA 2CNUA 4NYEA 3W2RA 1KUTA 5LMKA 2PMNX 3MV5A 4O7ZA 1PHKA 2QOKA 2IJMA 2PUUA 4EH4A 4ZMEA 4TY1A 3FYJX 4XRLA 2WQBA 2J51A 3IONA 4O0TA 3I1AA 3KXHA 3VS4A 3GQLA 4QMUA 2XK6A 3FHIA 1URWA 4AU8A 3B2WA 3BHTA 3H10A 2OO8X 4KIOA 4BZNA 3D7ZA 5BVFA 4MXAA 3MIAA 4JQEA 2ITQA 2F2CB 1IA9A 2QHNA 4EHEA 3RALA 3M2WA 4I0TA 5L2SA 4FKQA 2R5TA 1JKTA 4FTMA 1OL2A 2PVRA 2BZKB 4PRJA 5LWMA 5A6NA 3COIA 2OLCA 4DBXA 3JUHA 4YJRA 4FVQA 2BAQA 2RG6A 4K1BA 5AX3A 2VTHA 4R3CA 2NO3A 4BJJA 4ZAUA 1ATPE 4B0GA 4C4JA 4CFVA 5K9IA 3EQBA 3A7IA 2PZ5A 5HCZA 4KSPA 3AOXA 1BI8A 2YAKA 4X2JA 4YNEA 4ZP5A 3ZFMA 2OU7A 5DT3A 4O7RA 1W83A 3NW5A 3NW7A 3N4VA 5AIKA 2XIRA 4FG9A 2XAOA 2X39A 2HZ4A 2BDWA 4AQCA 4PL4A 1X8BA 4YJPA 3TJDA 4LGHA 2Z7LA 4AXAA 2JDVA 4ZZOA 4P90A 3D0EA 3HKOA 3Q6UA 5E8YA 4FKVA 4BC6A 1QPJA 3KGAA 4TTHB 1PY5A 4TZRA 4YR8A 2CGUA 3QALE 3GCVA 2C4GA 4MXXA 2W4OA 4U43A