4DHJA

The structure of a ceotub1 ubiquitin aldehyde ubc13~ub complex
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
248
structure length
248
Chain Sequence
DQQLKTIEDEQKSVPLVATLAPFSILCAEYDNETSAAFLSKATELSEVYGEIRYIRGDGNCFYRAILVGLIEIMLKDRARLEKFIASSRDWTRTLVELGFPDWTCTDFCDFFIEFLEKIHSGVHTEEAVYTILNDDGSANYILMFFRLITSAFLKQNSEEYAPFIDEGMTVAQYCEQEIEPMWKDADHLAINSLIKAAGTRVRIEYMDRTAAPNGGWHYDIPSDDQQIAPEITLLYRPGHYDVIYKKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/signaling protein/ligase
molecule keywords Ubiquitin thioesterase otubain-like
publication title The mechanism of OTUB1-mediated inhibition of ubiquitination.
pubmed doi rcsb
source organism Caenorhabditis elegans
total genus 90
structure length 248
sequence length 248
chains with identical sequence E, I, L
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2012-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10275 Peptidase_C65 Peptidase C65 Otubain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1300.20 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases 3 helical TM bundles of succinate and fumarate reductases 4dhjA02
3.30.200.60 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4dhjA01
4FJVA 1TFFA 4DHIB 4DDGA 4DHZA 4DHJA 2ZFYA 4I6LA 3VONA 4LDTA 4DDIA
chains in the Genus database with same CATH superfamily
3AE7D 3PXKA 3GCQA 4M12A 4FKGA 3NUNA 4RVMA 4FKUA 4AGDA 4M0ZA 4XYFA 5HBJA 3CLYA 3EIDA 4FSQA 5E90A 5HVJA 3JXWA 3V51A 4EBVA 3DBCA 3DNEA 3OTUA 4BI1A 2W1FA 4DGNA 4NZWB 5EI8A 2VU3A 3Q6UA 2QOIA 4H3QA 4JL9A 1G8AA 2CN8A 3AEED 3V01A 5IF1A 4R6VA 4XP3A 5EM8A 4H3PA 3NNWA 1KV2A 4IX5A 4PTGA 1B6CB 2DWBA 4J7BA 4HVIA 3PJ8A 2X4ZA 3UVPA 3Q9WA 1W8CA 4A07A 5EHLA 2XP2A 5TT7A 1JAMA 2R9SA 3F66A 2A0CX 4YJTA 3BEGA 4TT7A 3ITZA 3QWJA 2QOKA 4BDJA 3SXFA 4IEBA 2BALA 3F61A 4FYNA 2Z8CA 4G17A 2A4LA 4BN1A 2I1MA 1NXKA 2UZLA 3HMMA 3OT3A 5C27A 3R02A 3L8SA 3CY3A 3DA6A 3QALE 4R1VA 4AN9A 3F3TA 3RAKA 4YNEA 3U87A 3OUNB 3VS1A 3COIA 4D5HA 4RQKA 2Z7RA 3NCGA 3PRIA 4YJNA 3R63A 3COMA 4QP9A 4X2KA 5BVEA 2W1ZA 4IVBA 2HK5A 4UZDA 5IQHA 4XLVA 3M2WA 4KS8A 3LPBA 3FSKA 4KIOA 5M08A 1SNXA 2YCRA 3D0EA 2BILB 1LPUA 3OY3A 3OP5A 5AV4A 5AX9A 4ZS4A 3GUBA 4AP7A 4YJQA 4YTPC 5E4HA 5EYMA 3ZUVA 3BGPA 4GT5A 5LCKA 3R2YA 2B76C 5EQEA 1L8TA 3UPZA 3W0PA 5KHWA 4G3EA 3GU6A 4XUFA 3ULIA 2F7ZE 3NCZA 4LUDA 3I7BA 1BKXA 3TNHA 5IEVA 3P5JC 5HI2A 4J97A 3KRRA 4MEDA 3M1SA 4EOOA 5DBXA 5CAOA 3COHA 4IAKA 2QLUA 3BELA 2YIXA 2ACZD 4YC6A 3VBWA 2PZ5A 3UQCA 3CGFA 4FTNA 3OZ6A 5HCZA 5C1QB 2F4JA 3FDNA 2W1CA 4FIIA 4IJ9A 5AUTA 1OI9A 3QZFA 4JJRA 3UYSA 2CNVA 2W0JA 2XIZA 3EQCA 4KAOA 4RFYA 4ENYA 2F57A 1OMWA 5DR6A 4OTWA 3UC4A 3AEFD 3O23A 3THBA 4AA5A 4CCUA 1ZZ2A 2C6MA 2UUEA 3TTIA 2QU5A 4L00A 4QTDA 5IA2A 2X7OA 2HWPA 1GAGA 3CKXA 3OXZA 4R7BA 3F7WA 4O7ZA 3B8RA 3VS5A 3BGZA 3C5IA 3CBLA 4TWNA 4YZBA 3PRFA 5EM5A 3EN6A 4PMPA 3LJ1A 3DDQA 2WMTA 3CQEA 4FT3A 2A27A 4YJOA 5CSWA 5JGAA 1UWJA 2YDKA 3E5AA 3R7UA 1Z5MA 3G0EA 2WDQC 2BZHB 2ITTA 3F7ZA 3MVLA 4MXYA 2RKUA 3EN5A 3K5VA 2XUUA 4DFXE 3H9OA 5G6VA 5IG1A 2PVKA 3W0RA 3IPHA 5HE2A 3ENMA 4L3JA 2YIRA 4N6ZA 1YDSE 5DT0A 5DA3A 1KFYC 3AE2D 5L2IA 2W9FB 3JUHA 4PNIA 3AEBD 2O64A 1TKIA 4R1YA 5F4NA 3PIXA 3KA0A 4DN5A 2UV2A 2VWUA 4JLCA 2C0OA 3R7IA 1NA7A 2PUNA 3KFAA 1WBWA 3DXNA 3MVMA 4DH7A 1YXUA 4IBMA 3EZRA 5IUIA 5DEYA 5IH4A 3R8ZA 3VHKA 5AUYA 2C6OA 3F9NA 2VV9A 4FSRA 3WF8A 3GC7A 4ANMA 3MFSA 1URCA 3UE4A 4CMUA 4K0YA 3E8CA 4L42A 3WZEA 2YWVA 4F9AA 3KXZA 1KSWA 2Y4IC 4O7NA 1KOAA 4QYHA 5EW9A 3O51A 3M11A 5IA5A 2ZMDA 3BI6A 1P4FA 3BLHA 4X2NA 3Q96A 3SW4A 3KCKA 4UV0A 4L52A 2GFSA 3AE6D 2YM8A 3HDNA 2G2IA 1ZMWA 2BRNA 3MFRA 5ANKA 4AUAA 4BYJA 1M2PA 3QGWA 3OHTA 3AE8C 4UB7A 3AE9C 2VWXA 3QC9A 3FSFA 4DG2E 5AEPA 4I5MA 2BKKA 4GEOA 4BGQA 3W2QA 4EK4A 3CIRC 2WEIA 3EFLA 3G6GA 5IA0A 1MUOA 1UNLA 3QD3A 4FTKA 4RC3A 2OIDA 3P4SC 2YZAA 3OCSA 3ORNA 4L6QA 4BB4A 4F9WA 3ALOA 3POOA 2W1IA 4ZTRA 2VGPA 3A61A 1U46A 3PYYA 4MCVA 4I4EA 4O0SA 4YTIA 4U45A 2ITVA 3PFYA 5HE0A 2ZM1A 4Y72A 4D4RA 2ESMA 2CNQA 3MGYA 4WNMA 4RC2A 4EONA 4DGLC 4HGSA 2ITUA 2RFDA 2CJMA 3LZBA 1UU9A 2VD5A 4IVAA 1ZRZA 4MXZA 2YM4A 1MRUA 2FA2A 3HMIA 2IW6A 4R3RA 5CQWA 3KL8A 5HBHA 5TR6A 2W5HA 4TYIA 2B9FA 4I20A 2XIYA 1ZARA 3ORLA 2R3HA 3Q53A 2UZNA 4H05A 4BIDA 3EQFA 4HVDA 1YQ4D 2WTVA 2JKMA 4WBBB 4YMJA 4I5PA 1PMVA 3KN5A 3PIZA 4GJ3A 4L45A 4RLKA 3QZHA 4D58A 2W06A 5C4KA 1Y8GA 4FR4A 2W4KA 3AC2A 3TN8A 3LXPA 3W16A 3PA4A 2JIUA 4OUCA 2XKCA 3NLBA 3WBLA 1V0BA 4HZRA 3E3BX 4K77A 2UW6A 1OBDA 1RE8A 2WTDA 2RIOA 4I6HA 5FG8A 4AWIA 5JSMA 5KCVA 4GIHA 3IK3A 4IW0A 4EOJA 4QMTA 2WAJA 3WZJA 5HQ0A 3FZRA 4AT5A 4QYGA 5M06A 2IWIA 2WKMA 5B2LA 2XBJA 2XNOA 2UZOA 4KBKA 4XRJA 4DH3A 1QMZA 3QQGA 4HCTA 3IOKA 1P2AA 4A4LA 3LLTA 4FV5A 4G3GA 2A1AB 3MV5A 4MX9A 5AFVA 4I23A 4M0YA 4QMYA 3HRBA 2GNHA 4FZ6A 3FI3A 1J7LA 1YI3A 2LGCA 2ZAZA 3FMNA 3SXSA 3DJ6A 2VTRA 2W4JA 3R1NA 2P3GX 5F9EA 4X2FA 1WZYA 2W05A 4FIGA 4IIRA 4I6QA 4S2ZA 3Q4TA 1XBAA 3TZ9A 2CGUA 4LRKA 3W10A 4BJJB 3COKA 3E3PA 2PE1A 4X3JA 3SDJA 5KO1A 5TKDA 3VF8A 1PXKA 4X3FA 2WEVA 4D0WA 1H25A 2PUPA 5DLSA 1UU7A 3SOAA 4WNKA 1XHAA 3BV3A 1GZ8A 3R04A 3I4BA 2QOFA 4YT0D 1LEWA 2QCSA 1PRYA 2NRYA 5DR2A 4II5A 4RIYB 5A6NA 4BCNA 1GIJA 3K3IA 3ERKA 5CZIA 4EWQA 2XK6A 2YACA 4EH9A 1YXVA 3Q4UA 5H9BA 1IASA 4JG6A 5K4JA 2JC6A 2CHLA 3GCVA 3WF9A 2BZIB 3OCBA 3ZMMA 5C3JC 2FSTX 5L3AA 4AZWA 3AEGC 5CEOA 3UG1A 3SXRA 4WG3A 1R0EA 2CGWA 4YPDA 5HLPA 4RWJA 2XNBA 3JS2A 3PFQA 4MBJA 3P4PD 1OIUA 4JQ8A 5AV0A 3TKIA 3H0YA 3BL7A 3BU6A 3I5ZA 1YI4A 3MFUA 3LMHA 4LRMA 3I79A 4P7EA 1GJOA 5GIPE 3I5NA 5AX3A 4L01A 5TOZA 2R7BA 5FRIA 2X2LA 4QEBA 2CKEA 4XBRA 3RAHA 4QMSA 3A4PA 4IVDA 4XP0A 4JAIA 4CLJA 1Z9XA 3FKLA 4QT1A 3NW6A 5EKOA 1OL7A 2PVYA 5HIDA 1FGKA 5HD7A 3FZPA 5CNNA 3VR9D 2PMIA 2XVDA 3FHIA 4Y5HA 2Z7SA 4BTMA 2IPXA 3RM7A 4CQEA 4KINA 4BCQA 3RK7A 1SZMA 1A06A 1W82A 3CGOA 4JOAA 4HCUA 4KIQA 2XCHA 4N6YA 5D7VA 5B7VA 4F1OA 1MQBA 2HWOA 3P86A 2GU8A 3HNGA 2XK4A 4H1JA 5IA3A 5BYLA 4FL1A 4MNEB 4DBXA 3T9TA 1M17A 4FSYA 4QYEA 2VTSA 4M7IA 4YZNA 3GP0A 3GI3A 4DGGA 4DFLA 4IM3A 4D0XA 1H0VA 3UIXA 2J5EA 2IW9A 1WVWA 3DGKA 1PXJA 4O7SA 5D7AA 2BUJA 3TCPA 3W32A 1Q61A 4I22A 5HE3A 3TDVA 4DFYA 4M15A 4USEA 4EK6A 5K4IA 4QMNA 1FINA 4HPTE 1BI7A 3FPQA 3L8PA 3QUEA 2GQSA 2WB8A 4S33A 4E6CA 2CCHA 3F88A 2R0IA 3FL5A 3VR8C 2Y4PA 3FZTA 3OF0A 4HYSA 4E20A 4E5AX 4O84A 1NEKD 1FPUA 4RJ4A 5JMSA 2P0CA 1Y8YA 2RG5A 4RSSA 2C30A 4ZTSA 3V5JA 4F7NA 3TUDA 3GOPA 2HW7A 3EB0A 3MIAA 3UDTA 5A4LA 4EH8A 4IB0A 3O17A 5DYJA 1VZOA 1T45A 3PJ1A 3R83A 1OM1A 3RCDA 4KKHA 4TY1A 3EQIA 1O6YA 3EL7A 5HX8A 4QMVA 5M57A 2CCIA 1XBCA 4G34A 5KZ0A 4AU8A 3KEXA 3BGQA 4FTOA 3R21A 4C4JA 2X39A 4AG8A 4RJ6A 4FK3A 3AT2A 5M09A 1KUTA 4UXLA 3IW8A 3W55A 1SVGA 4NH1A 3UOLA 4C4EA 2GNLA 4M13A 2OJJA 5I9ZA 2G15A 3HEGA 4XV2A 3UZPA 3WF5A 1K2PA 3ZSIA 4D4SA 3AMAA 2B9HA 3D4QA 2YABA 4CFXA 4HVSA 1JKTA 1U54B 2CGXA 2HW6A 3RVGA 2BRMA 2ACXA 3PPZA 4ZZNA 2ERZE 3E7OA 4KB8A 3W2RA 2QOOA 5IQGA 2IW8A 2VO7A 5DG5A 1KV1A 2I0YA 2UW8A 3DV3A 4BY9E 4EH6A 5CASA 4IHPA 4J95A 1R39A 4ZIMA 2WU2D 1H24A 2C6TA 3FMKA 3RPVA 3NGAA 2X7GA 4FKVA 3QTSA 3O96A 5J8IA 5LMBA 1I09A 1KWPA 1RJBA 1WMKA 3FMEA 4TPTA 2VTOA 5FEEA 3R28A 5C2TD 3VIDA 3UDSA 2VN9A 4MBLA 2H9VA 2R3MA 4Q9ZA 4JR7A 4FV9A 1QL6A 1H1QA 1UKHA 1ZMVA 2WMVA 3JY9A 5CQUA 3IW5A 5JFVA 5M55A 3RNIA 4EI4A 3HZTA 1DI8A 1PKGA 4F99A 4TRLA 4RIXB 4HVGA 3Q9YA 3R22A 4QYYA 3GQLA 2EB2A 2WO6A 2F9GA 2QKWB 3QKLA 2BRGA 3D83A 2HAKA 3P9JA 4YHFA 4FODA 5CYIA 3RMFA 3ANQA 5DN3A 2HYYA 4F0FA 4FTIA 3RK9A 3HRCA 4IM2A 4RZWA 1NVSA 5HORA 3W2OA 2XALA 3ZM4A 1QPEA 5H8BA 2FGIA 3NYVA 5E9EA 5AADA 4J71A 4RFZA 4DFUA 4I24A 3A7IA 3ZDIA 2WFYA 3S3IA 4EH3A 1YHWA 3FQSA 5BUJA 4JDIA 5CU4A 1VYZA 4M68A 4BJJA 4O21A 3OT8A 2C6EA 1YXXA 2WZJA 4BGGA 3A99A 3UZTA 2HY81 3TT0A 3R7EA 2JDTA 4EOPA 4O7TA 1PKDA 3GC8A 1WBVA 2VRXA 3CTHA 4JRNA 4FTRA 4IE9A 3P4KA 4JIAA 4RIYA 3ZH8A 1YI6A 3VWAA 1W98A 3D7ZA 3IECA 3QTUA 1DM2A 4RLLA 5HE1A 1YWVA 2C5VA 1JPAA 2BRBA 4EOSA 5DOSA 2JIVA 3ZSGA 3C51A 4LL0A 4APCA 5JT2A 1G8JA 3AGLA 4GCJA 4DHZA 4XG6A 5EM6A 4UWBA 4KWPA 4CMOA 2H89C 2ITQA 3PSCA 3QZIA 3TUBA 4C61A 2ZVAA 3PE1A 4YSMA 3QWKA 5CVGA 3U6JA 4K33A 5AMNA 5IQCA 4NKAA 3UZRA 2J0LA 4WT6A 3E92A 3AG9A 3E87A 3Q5IA 5IDNA 4FTTA 4GS6A 1I44A 3MB7A 3QLFA 2OIQA 4Q5HA 3H9RA 3ZXTA 4QMXA 3KB7A 5EK7A 4IFCA 2CKQA 3N4VA 2DS1A 4EH7A 4JXFA 3MESA 5C9CA 5KMLA 4FKSA 4GJ2A 4M84A 4UY9A 1IEPA 3FC2A 4NCTA 4RVKA 4BHZA 4C33A 1B38A 3UBDA 4XP2A 4PUZA 4EHGA 2IZUA 4TN6A 5KKRC 2C69A 2XIKA 3EL8A 3QRJA 4CSVA 3DXQA 2UW0A 3I6UA 3VS4A 1S9JA 1Q8ZA 4PP7A 2OICA 3LCSA 3P0MA 3TI1A 4MNEA 4DEAA 5BUEA 4JBQA 2PPQA 2Y4IB 4AFJA 4PDYA 3NIZA 1Q8YA 4B6LA 3ZHPC 2NP8A 4EH4A 3RCJA 2VTMA 3DY7A 4WRSA 5FGKA 3LFQA 1JNKA 2GS7A 3N4UA 5GJFA 3VS2A 3FLQA 4Z7HA 2WQBA 4W8DA 3QTWA 2PVMA 3IDPA 1PXLA 1JQHA 5E1EA 3BYSA 4ALVA 4ACDA 3K54A 2QURA 2YIQA 5I9UA 5E91A 3TV4A 5C26A 3LFAA 3NR9A 3OVVA 5AIRA 2HIWA 1XH7A 2R3JA 2J0MB 1FVVA 4YO6A 5KZIA 3E64A 1YOMA 4RT7A 4LOQA 4U80A 3V5PA 5EOBA 3PP0A 2ZV7A 1DS5A 3HV7A 3NUAA 4RC4A 4E7WA 4ERWA 4F4PA 3SAYA 2H88C 1BX6A 4RIWB 4ZK5A 4IVCA 4DA5A 5FEDA 3G90X 2GCDA 3QFVA 3EHAA 3VW6A 3L9PA 2JDVA 4O81A 4XS2A 4CT2A 4FJVA 2CPKE 2ETMA 2H96A 5AUWA 4D4VA 4O27B 4F70A 4GH2A 4PL5A 4MQ1A 4CFNA 4JX7A 5M4UA 5ETFA 4CV9A 2J5FA 4QDEA 3UO4A 3ZONA 2WMSA 3BHUA 4ZAUA 3NYNA 3BL9A 3EN4A 3LQ8A 1E1VA 4RGJA 2CGVA 2UZEA 2UZTA 3FKOA 2WDQD 4H39A 3P1AA 3C50A 2AC3A 3GOKA 1OGUA 3NZ0A 4FGRA 4IWOA 2R3PA 1PY5A 4IMYA 4L67A 4YBKA 5ANJA 4EQCA 5A46A 1Q62A 5EKNA 5M53A 3LKMA 2UZUE 5H3QA 3S00A 1R3CA 1KFYD 4JDHA 5A6OA 3GGFA 4R5YA 1WBSA 2W5AA 3DCVA 1H01A 3WIGA 3QRIA 4G9RA 3O71A 3E8EA 3ZRMA 5A4QA 5KMJA 5HD4A 1KE9A 4U8ZA 5M4CA 2F2CB 3I60A 3IKAA 3BEAA 3BX5A 2PYWA 2PK9A 2QODA 2CLXA 2ETRA 4OTDA 4XV1A 3CR0A 4TNBA 3ZUUA 2OI4X 1T46A 3FMHA 3OD6X 3PPKA 4I6BA 4M8TA 4S30A 4W4VA 3TMOA 3ZBFA 4FTQA 4RIXA 4ENXA 5L2TA 2OXXA 5DT3A 3RALA 4QYFA 4C4IA 3JYAA 4B0GA 4XNEA 3CJFA 1IG1A 2WPAA 3KRWA 4JBVA 5E1SA 4GFGA 4D1XA 4EOLA 2FBWC 3MPTA 2V7AA 5I0BA 4DC2A 4FTAA 5FQDC 2W9ZB 3E7VA 4IQ6A 2VO0A 4JS8A 4M3QA 3O7LB 4NW5A 5HU9A 2WMBA 2XARA 1ZOHA 2AC5A 5AA8A 3SFDC 1U4DA 3A7HA 3BHTA 3TJDA 5JKGA 3LFCA 5HCYA 3AE8D 4U7ZA 2OK1A 3GEQA 5D12A 3HDMA 5FBNC 5CEIA 3ULZA 2KTYA 2XM9A 5JGDA 3BE2A 3CXWA 3H10A 2EWAA 4O22A 2R4BA 3O0GA 3R73A 2ZFYA 4XG4A 3P4SD 3DKCA 5FDXA 2UW4A 4GK3A 5C03A 3TV7A 4LV5A 4U40A 5JRSA 4BCHA 3DJ7A 1PMUA 4IM0A 3MJ2A 4I1ZA 4U97A 5DI1A 1W0XC 4YTND 3R01A 3HGKA 5EI2A 3DK3A 3VVHA 4A06A 3IGGA 4DHFA 1TQMA 3UMWA 2P55A 1IAJA 4WNOA 4YC8A 2BDWA 5IPJA 5M4IA 4F0IA 4E73A 5GJDA 3W0QA 4F64A 3TEIA 4XH6A 1JVPP 4HGTA 2X4FA 3ENHA 3R8PA 4V04A 2C1AA 1QCFA 2Y9QA 4IDVA 4F7SA 4D2SA 4QMOA 3HV3A 3HA6A 3AEDC 5DIAA 3DFCB 3P7BA 2GNGA 4WO5A 3VW8A 4RA5A 4LV7A 4HVHA 2GPHA 3MIYA 2WXVA 2LAVA 3QQLA 5HLNA 4NM3A 5CEMA 3QTZA 5EG3A 4PMSA 4P90A 3G2FA 4KS7A 4AX8A 3PSBA 2XK8A 3P08A 4J8MA 5EQPA 2CMWA 3MTLA 1WVYA 3HAVA 1V0PA 2CSNA 4FIFA 4LG4A 4UX9A 1J1CA 3FE3A 3RPRA 1OB3A 2EVAA 4ANSA 5AP6A 5CI7A 2QVSE 3AE4C 1SVEA 4FTUA 5CU6A 2XK3A 3KXGA 2VAGA 3NUPA 4AAAA 2WS3C 4UEUA 4ZY6A 4O7WA 2BPMA 3DBEA 5HLWA 5I9VA 3Q9ZA 3ZDUA 2E9OA 2X0GA 2RG6A 4GIIA 3C4ZA 4CKJA 3FUPA 2FUMA 3R8VA 5HG9A 3VULA 3GU7A 3O7LD 3DQWA 5CF8A 1E7PC 4WA9A 1ZAOA 5BNJA 4NUSA 2B1PA 4DHJA 1YVJA 2VTLA 4NIFB 4ZZMA 4K6ZA 4AW2A 5HTCA 1H1PA 4U43A 2O3PA 3FLWA 4MVFA 4BKJA 3OS3A 4IFGA 4CG8A 3OCTA 1MRYA 5E8SA 2C6KA 1Y6AA 1PJKA 4JNWA 4DFNA 4BDGA 3PLAE 4P5QA 5C3JD 4RIWA 3N51A 5DH3A 2B52A 3AEGD 4BRXA 3HL7A 4W4XA 1TVOA 3GCUA 4QP1A 5EM7A 3GQIA 5ETAA 1KE8A 1ERKA 3E8NA 4CZTA 4EK3A 4L43A 3ML1A 4K18A 5F94A 3FQHA 2QQ7A 3R9HA 5BMSA 3VBVA 2PSQA 2EUFB 4O0TA 4FEXA 1JSTA 3TL8A 2SRCA 4MKCA 3AC1A 3EYHA 3C5UA 4X3FB 3NAXA 4O0XA 5J5SA 4RG0A 4DHIB 5DRBA 4RRVA 2BDFA 2ITYA 5IQFA 2BS3C 3FLZA 3ANRA 2GQRA 1GIHA 2Z7LA 2IVSA 3D14A 4KSPA 2JBOA 4CFMA 3H0ZA 3QBNA 2I7QA 4C62A 5AP3A 4MXXA 3OTVA 4DFBA 4E4XA 3VBYA 3QGYA 3BWFA 4NK9A 3RNYA 2QOHA 5HESA 5AV2A 4ANLA 3GU4A 2ETKA 4WUAA 4IC8A 3SG8A 4FV7A 4YTMC 1SMHA 3VN9A 3O8UA 4FVPA 3BQCA 2XIXA 2C6LA 1OIQA 1Q8WA 2XNNA 2UW5A 5JK3A 4ZSGA 2JDRA 3VJNA 3POZA 1Q5KA 3NDMA 4JQ7A 3SVVA 4O6EA 2GFCA 3NMUF 2QC6A 4KBAA 3TYKA 4NU1A 4DFZE 1UA2A 4UALA 4J53A 1L0VD 2PVHA 4E6AA 2ONLA 4FT7A 4NJDA 3NNVA 4FMQA 5T6KA 1ST4A 2ZV9A 3N4TA 4LRJA 3HRFA 4Y46A 1KF6C 2PMLX 3VR8D 2ZM4A 3ZXZA 2OFUA 3OG7A 2O5KA 2WMQA 4O0RA 3TIYA 2E9UA 4W4YA 5D11A 5ETCA 3QXPA 4JG8A 5CF6A 1HOWA 4G6OA 4FSNA 3R7VA 4D9TA 2YHVA 2PVNA 3OMVA 2OFVA 2PZIA 4JX3A 4K2RA 4RZVA 1OBGA 4B4LA 4AA4A 1BLXA 4PTCA 2HZNA 1LEZA 4MNFA 3R8LA 2C1BA 3ID6C 3L1SA 1WVXA 1ZY4A 3L9NA 3AC4A 3RPSA 2QLQA 2C0IA 5DT4A 4ARKA 3QQKA 2BCJA 2FSMX 5TO8A 4FNWA 3Q2MA 5HO7A 1M2RA 5A3XA 4A9RA 1JBPE 2CKPA 3NYOA 2AEGA 4BDDA 2OJFE 3TKUA 3ZTXA 1P5EA 4FTMA 1CTPE 3FKNA 3LXNA 4MD7E 2X2MA 5FTQA 5TF9A 3EWHA 4BGHA 3MY0A 5HG5A 4YSYC 3TACA 3NWWA 5IQAA 4FSUA 4FICA 3RKBA 2OW3A 2BKZA 4G9CA 2OZAA 3WF6A 4ORKA 4XHKB 2B9JA 2WTKC 3G0FA 3ZO1A 1YDTE 4QQCA 5HICA 4EHEA 1XJDA 5ANEA 4EKLA 2VNYA 1LP4A 2IZSA 4HW7A 3DFAA 2C6IA 4FEUA 4FV1A 4C2WA 3H30A 2B54A 2XRWA 4CG9A 3GT8A 4MBIA 5HX6A 4V05A 3UP7A 4YSZC 3LFBA 3D9VA 2GNIA 3UNKA 3WIKA 4F65A 4L8MA 2BROA 3OROA 3SKCA 4IB1A 5CY3A 1OPJA 4UN0C 4DINA 4ZTQA 5T68A 3UPXA 3P4QD 4O2PA 4DEEA 3WZUA 2BAQA 3IW7A 3NYXA 5KMMA 4GT4A 2DUVA 5BVDA 2JD5A 4PDPA 4NJ3A 3DAKA 2WMXA 3C0GA 4EQMA 2HXQA 5HG8A 3RGFA 3ZC5A 3PDTA 4AOJA 4D5KA 1WCCA 2B0QA 4MXCA 5BX0A 5H8GA 1TQIA 3DTWA 2BDJA 3QD2B 3KXNA 5AP4A 4YU2A 5I9XA 4F09A 4K1BA 4X0MA 4YHTA 3ZRKA 4DH1A 1YKRA 1ZY5A 4R77A 4CNHA 2ZYBA 5LOHA 1ZWSA 3BRBA 1AQ1A 2VGOA 4TYHB 4CKIA 3SGCA 3PUFC 4E8AA 2IZRA 2X6DA 4FG9A 5EOLA 2C5NA 2JAVA 4QOXA 2QOBA 3ET7A 4ALWA 4QMZA 5BVFA 3L9LA 2GHLA 3EQRA 3IO7A 3OY1A 1CKIA 4YJPA 3ZFMA 4QP3A 4AW1A 5LVNA 1OUYA 1J91A 4IWPA 3ZU7A 3LCKA 2W4OA 3AE7C 1BMKA 3QU0A 3ZLSA 4AT3A 4BC6A 3ZO4A 2CN5A 3BIZA 4YP8A 4FKIA 4RQVA 3FL4A 4QPSA 1CMKE 4AXAA 5EDPA 2O0UA 3P7CA 2XKEA 4DAWA 2W96B 3Q32A 1RQQA 1E9HA 3ZBXA 1R0PA 2I6LA 1H1WA 2J9MA 2I0EA 3HV4A 3Q5ZA 4KA3A 3SLSA 3UQGA 3VRYA 1S9IA 3VRBC 2HZ4A 5D10A 3W2SA 4FVQA 3I7CA 4GKHA 3R7OA 3PVWA 4WHZA 5AP5A 5C01A 2PU8A 3B8QA 4EOMA 3RPYA 3PVGA 4FKWA 4KBCA 5CZHA 4U41A 2WD1A 2OU7A 2EXCX 4KRCA 5ACBC 5CU2A 3QX2A 2QG7A 3LFEA 4DH8A 5JEBA 4BBMA 4X7QA 4I0TA 5BYZA 2BTSA 3P78A 4YJRA 4W4WA 4EC9A 3PUPA 1LR4A 4Z7GA 4OBQA 1NW1A 4FBXA 5CF5A 1WAKA 4FK6A 1PXMA 5EYKA 2VX1A 3ABVC 3FMJA 4KNBA 3W8LA 3FZOA 2XANA 3HKOA 3MYGA 5LMKC 3EJ1A 3C0HA 3MA6A 3SX9A 2IO6A 3KGAA 3AE3D 2YCFA 3A8XA 4IAIA 5EYDA 4EJ7A 4BCJA 3VS7A 5LVOA 4X2GA 3IGOA 3Q3BA 3AQVA 5FXQA 3DLSA 3SHEA 4ASXA 4AE6A 3LM0A 1F3MC 4AE9A 1WBPA 3ZO2A 5CAVA 3KRLA 2H8HA 1CKPA 5J9ZA 4O2ZA 5AUUA 4XMOA 1GZKA 3QQHA 1AD5A 4RJ7A 3NEWA 4TKSA 3CD8A 3MSSA 3U9CA 3BBTB 2ITWA 2UVYA 3WE4A 3TDWA 4IB5A 4YLJA 3OWJA 3C4WA 2ZB0A 3HMNA 1M7NA 4YHJA 3AGMA 3AOXA 3UMXA 3VUIA 3KCFA 4MAOA 2JEDA 3CP9A 1PMNA 4EOIA 4U81A 1JLUE 5IQDA 2XNPA 3A4OX 3NW5A 2WU6A 4EHVA 3NS9A 5AV1A 3BYMA 4D4YA 3W8QA 4PWNA 2C3KA 5BQ0A 4M97A 4I4FA 4O83A 3TUCA 1HCKA 2O65A 2YJRA 1A48A 3KXXA 2H88D 2ZJWA 3AECC 2Y7JA 4WD5A 4FKLA 1YWNA 1JSUA 4ONAA 4PDSA 1PYEA 4K9YA 4A9UA 3VAPA 3R1SA 5DGZA 4AQKA 2WDRD 4PNKA 3LW0A 3V8WA 3ORXA 4EH2A 3JY0A 4PMTA 4X21A 3OWPA 1Y6BA 5AAFA 2AYPA 3OOGA 3OOMA 4XG7A 3RK5A 2I0VA 3LMGA 3VUKA 2GTMA 4PV0A 3MI9A 3PXZA 5JN2A 3WE8A 3PSDA 3MY5A 2X8EA 3QQUA 2VTNA 4QMQA 2BS2C 4YJSA 3WYXA 5HKMA 4BTJA 2QHNA 5CU0A 2BMCA 4QMLA 4IWQA 5ITAA 2XNEA 4V0GB 3A60A 2JLDA 3DZQA 3PLSA 4QPAA 4ZZOA 5I9YA 3FZ1A 4ZMFA 2WU5C 4Y8DA 3EQDA 2Q0BA 4OW8A 1F0QA 3PVBA 1NENC 3SV0A 4E4NA 4CFFA 1Q99A 2FSLX 1GZOA 3I0QA 1IRKA 1FVRA 3JPVA 3AE2C 2PVJA 2QO7A 3NVMB 4QNAA 1WFCA 3H4JA 2VWVA 5E7RA 5A54A 5IQEA 3AEBC 4BDAA 3MFTA 2BHEA 5C8MA 4G6NA 2PHKA 3QYWA 4GRBA 4NTTA 3QTXA 4O7YA 3ZLXA 2HELA 2WQYC 3IOPA 1Q8UA 1QPCA 2R64A 4BI0A 4U0IA 5DPVA 4GK2A 3MVJA 3VHEA 1URWA 3UG2A 5E8YA 1GNGA 3HUCA 4LMUA 4IC7A 3KREA 3VUDA 2FBWD 2WQEA 3MDYA 4DYMA 2WNTA 4JAJA 4Q5EA 1K3AA 3PJCA 3ACKA 4FKOA 5ACKA 3VBXA 2OXYA 4RA4A 2JKKA 5CS6A 3PA3A 4LDTA 4OTFA 4CRSA 2XA4A 2WTCA 4D9UA 2YIWA 3SFDD 1OKYA 3PZEA 4TYHA 3KKVA 3KXMA 3UVQA 4ASEA 3CTQA 3FMMA 5AUXA 3LJ2A 2JBPA 3BU5A 2HZ0A 2OO8X 3UTOA 3G9NA 4CV8A 5CSPA 3NVKI 4W8EA 3I81A 4BIBA 3BQRA 4R7HA 3BYVA 5M07A 1PXNA 4JR3A 4QTCA 3KF7A 3DTCA 2B7AA 3QTIA 5AP1A 4ZEGA 5KMIA 4FT5A 3WI6A 3ZYAA 2YAAA 1R1WA 5BMMA 1G3NA 5HG7A 5KE0A 3ZLYA 4C35A 3AE5C 3CPBA 3NUXA 3GBZA 4ITJA 2EB3A 2GMXA 2W17A 4I6LA 2X6EA 3VF9A 2WMAA 3EN9A 1XKKA 4QP6A 1Z57A 4BDCA 4U79A 4DGOA 2J2IB 4F7JA 3JR1A 4Y95A 4UXQA 3KY2A 3DNDA 4PL3A 1MQ4A 3CKWA 4BDKA 3BYOA 4ACCA 2ZV2A 3WARA 2OLCA 2R3KA 3OW3A 3G51A 4C37A 5B2MA 5DE2A 4TZRA 5KBQA 2F7EE 2BIYA 1L3RE 3L8XA 3O8PA 3RZBA 1ZYDA 3ZZEA 3AEDD 4K11A 4YJVA 4FG8A 1H8FA 1OIYA 2BHHA 3ODZX 4RX7A 3S4QA 4IAZA 4JMQA 1Q3WA 3IS5A 3ZEPA 4WIHA 3UGCA 5A4EA 3HMPA 2IZTA 1BL6A 3QRTA 5DR9A 5ANIA 2R3LA 5FP6A 5ICPA 3OXIA 3Q04A 2W5BA 4I92A 1ST0A 4ZJVA 4AZSA 1V0OA 4AZVA 4S31A 2ITXA 3KXHA 3MPAA 3GENA 4X2JA 5LARA 1BUHA 2YCSA 3O5AA 4F78A 2JGZA 4K8AA 2YEXA 3U9NA 3LFSA 2JFLA 3V3VA 2BIKB 2XJ1A 2PZYA 4Z16A 2QOCA 3DT1A 4BHNA 2ITOA 4O91A 3TV6A 1XH4A 2XS0A 4ZOGA 4E5BA 2WS3D 5AP0A 5KHXA 4AXEA 3TIZA 1MRVA 4NSTA 5HIBA 5DRDA 3GFWA 5L8KA 3ORPA 4YSXC 2ZV8A 4PTEA 4FV3A 3K2LA 3PXQA 3R1QA 3SQQA 3NSZA 4QQ5A 2C3LA 3TTJA 4MXAA 2QHMA 2C4GA 3F5XA 4FIJA 5AP2A 3UVRA 3CQUA 3VQUA 3AEAC 4IDTA 3UO6A 3NFFB 2PULA 4IADA 4Z55A 2IG7A 4F1TA 4FKTA 2OWBA 4UWCA 1WBNA 2YDJA 3BWJA 4Y83A 3UIUA 3NUYA 3P4RC 1OKZA 4O7LA 3RM6A 3BHYA 3UNZA 3U8WA 3H3CA 3G33A 4YTPD 1JKLA 2ERKA 3ETAA 3FQEA 4UBAA 4YNOA 5E8UA 3W2CA 4ZS0A 3MW1A 2B76D 2X9FA 5AV3A 3DK6A 1YQ3C 4J98A 4FNZA 2XJ2A 3PXFA 2WP9C 3ATTA 4BF2A 5DEWA 2BAJA 1VEBA 3PWDA 3DQXA 2WTKB 3QCYA 2GQGA 2QU6A 4BBFA 3RTPA 2PTKA 3W18A 4ANBA 2ZMCA 4XG9A 2XKDA 3F3WA 3ZC6A 3LCTA 4EL9A 1OL6A 4GL9A 4G6LA 4AT4A 3QTQA 1M2QA 2ZOQA 3A8WA 4JRVA 4P2KA 4FSTA 2QO2A 4V0GA 5CX9A 2WMWA 4M67A 1SNUA 5FTOA 4C59A 2H6DA 2WMRA 3QF9A 3OBGA 3D5UA 3IDCA 4Y73A 3DLZA 3RI1A 1IA9A 5E8VA 1B39A 3CS9A 3FI4A 2QOQA 3U51A 5AWMA 3FY0A 4C4FA 3MB6A 1UVRA 4FZ7A 4GG5A 3PXRA 4MD9E 3HV5A 3FZSA 5G1XA 4AW0A 4XOYA 3EZVA 1M14A 4BICA 1P4OA 4A9SA 3UQFA 1XH9A 4ZSEA 5HHWA 3KF4A 4G5JA 4HCVA 4YC3A 4MTAA 4AF3A 4E4LA 5JFSA 1QPJA 4U3ZA 4CFUA 2YITA 4GFMA 3FXWA 4GVJA 2IJMA 4MD8E 4NM0A 3R8UA 1XH8A 5AAEA 1NY3A 4KKGA 4ITIA 5JZJA 3K5UA 3QD0A 3LE6A 3R8MA 3VBQA 2QG5A 4UYAA 4U42A 4IWDA 4YZCA 5M51A 3UDBA 3C4FA 3N9XA 1PXPA 4C3RA 4B7TA 4DT9A 2C5XA 1YW2A 3ZM9A 2R2PA 3RINA 2JKOA 2BZKB 3R00A 1BYGA 3FBVA 2E9PA 1FQ1B 2FH9A 3OW4A 2Z7QA 3BHHA 3DS6A 4C3FA 2A19B 1M52A 5GNKA 1ZZLA 4O0UA 4O96A 4R7IA 2XM8A 1J1BA 4FV6A 4IX3A 4NTSA 3EQBA 3ZFXA 1NEKC 4AGUA 4KX6C 1CDKA 3E88A 4HNFA 3FXXA 4HOKA 2XMYA 4C38A 4EK8A 4MUQA 4QNYA 3AC8A 4L3PA 1JOWB 4ASDA 3HV6A 4A4OA 3OEFX 2O63A 4AOTA 1H07A 1E1XA 2P2IA 3GVUA 4PL4A 4DT8A 1UU8A 3ZEWA 3VQHA 4RFMA 3BV2A 3AD5A 3EFJA 3HECA 4RJ5A 3D5WA 1PXOA 2J0KA 4FUYA 3PIYA 4YLKA 4IB3A 5C8KA 1TQPA 1OL1A 4YSYD 3BLQA 3GU8A 1V1KA 2I0HA 3QQFA 4PY1A 2RL5A 3W33A 3QAME 4H1MA 3WILA 1CKJA 4D1ZA 1OIRA 3AE9D 5LWNA 3AKKA 4NM5A 2C5YA 4DTBA 3BHVA 5EDRA 3CIRD 4OT5A 3L9MA 4RWIA 3RWPA 3FYJX 2CLQA 2R7IA 3FEGA 3KIOC 2GTNA 4FTLA 3NFGB 4XX9A 4FNXA 3QTRA 4I5CA 4IX4A 4EUUA 2YFXA 4YSZD 1H1RA 3NNXA 4BZDA 2R3QA 3C4CA 2VNWA 4LL5A 4IZ7A 4EK5A 4AN3A 4FG7A 3RAWA 4OTIA 3NNUA 3PZHA 4AW5A 3K3JA 4ZLYA 5HGIA 2GDOA 2ITPA 2Y8OA 4G3CA 4GT3A 4FL3A 4OBPA 3PVUA 3SOCA 4O38A 3C4XA 3V5WA 5CTPA 2QR8A 1RDQE 4AXCA 3OCGA 2QNJA 1A9UA 2JKQA 3W0OA 3IDBA 1H08A 3UIMA 2QKRA 2OZAB 3D7TB 3PA5A 4ASZA 5IH6A 3EOCA 4FIEA 3WZKA 4BTKA 1Q97A 3EKNA 5J9YA 2F2UA 4MH7A 5L6OA 3ZSHA 3SG9A 4APPA 3RHXA 3DBQA 3TNIA 3VNTA 1ZYCA 4D55A 4DTAA 3GC0A 3PY0A 3V6SA 3QL8A 4C4GA 3AKLA 4C02A 4QMPA 3O2MA 2C3JA 3VS0A 2VTQA 5LJJA 3L8VA 2BFYA 5K5XA 5DFPA 4PDOA 5AAGA 3KULB 1ZOYC 3AMYA 4O7RA 1X8BA 3HYHA 5C4LA 4KABA 3KU2A 5DWRA 3HP2A 1BL7A 2IVTA 1HCLA 1XWSA 3KMWA 3PWYA 4G31A 4TYGA 5EH0A 2VTJA 5FUTA 5B2KA 5HBEA 4XCUA 4D1SA 5D1JA 1DAYA 1Q8TA 5FP5A 5F20A 4ZJIA 2QR7A 3E8DA 4WRGA 4I0SA 4DITA 4TYJA 4QTEA 2PE0A 4Z3VA 4XG8A 5L8LA 4HZSA 4BBEA 4O0WA 3TNWA 3LOKA 4BCIA 2YJSA 3C1XA 4J99A 4OTQA 5EYCA 4L3LA 2YM5A 3SFEC 4R5SA 5H8EA 4F7LA 4BCKA 2PMOX 3KK8A 4FC0A 5EHOA 1FMOE 4YLLA 3CC6A 5CXHA 3OWKA 1ZOGA 4FSZA 1WBTA 4IZYA 4MQ2A 4RWKA 2W99B 4TWOA 4USDA 3TG1A 5CAUA 3CTJA 3VRBD 4TWPA 2E2BA 4MK0A 3DK7A 2WMUA 2GS2A 2PZRA 4EH5A 5K9IA 1VYWA 3ZS5A 3VONA 2G2FA 2YIYA 3B2TA 2WOTA 2WGJA 2X9EA 4FKRA 3D2IA 5FBOA 3EQPA 3FWQA 2WQOA 3ORTA 3DPKA 3AE1C 2YN8A 3UO5A 5EI6A 2RF9A 5IDPA 5M44A 2NO3A 4FZFB 1REKA 2VWYA 4EEVA 2Y6MA 3CE3A 4Q2AA 5FEQA 3Q4CA 5A14A 4ZTNA 3BLAA 3R6XA 4M14A 4ZP5A 3F3ZA 4ZJJA 3ABVD 3D15A 5KUPA 1Q41A 1H26A 1YWRA 1H1SA 3DU8A 5CEPA 4N57A 3V04A 3LCOA 2EXMA 4RIOA 2UVZA 5FXRA 3R30A 5CXZA 3D5XA 3DB6A 4AS0A 1PMEA 5ANDA 2R3NA 3Q6WA 5BV3A 4C3PA 4BTFA 3MH3A 2VX0A 2W7XA 4IAYA 4KRDA 2R3GA 5A4CA 3HP5A 4DDGA 3F82A 3QCSA 2V0DA 2PWLA 4G3FA 1J3HA 3VS3A 5J95A 3OUKA 5BPYA 2JDOA 3O50A 4LOOA 4AA0A 1ZMUA 2HCKA 3EN7A 3OC1A 4AGCA 2XCKA 1GOLA 1G8SA 1XBBA 3U54A 3LFDA 4E4MA 3DKGA 4WNPA 4FIHA 5E8ZA 1BI8A 3S95A 3QQJA 2XNGA 1H0WA 4FEVA 4FZAB 4DCEA 5KBRA 2CKOA 2NRUA 4ACHA 3FLSA 2WU7A 3R9RA 2JFMA 3OFMA 1YHVA 3TNPC 2C5OA 5HIEA 5L2WA 4BDIA 3C9WA 4BCMA 5AP7A 2QI8A 3HUBA 3SD0A 4AQCA 3MA3A 4N0SA 3ATSA 4Y85A 3AD4A 4L53A 2PMNX 3VJOA 2PZPA 3DJ5A 4P4CA 3ACJA 4U6RA 4NL0A 5CWZA 4EHZA 2YZLA 4QRCA 2CDZA 4DF3A 2FYSA 2O2UA 3CEKA 1F5QA 2XNMA 4ACMA 2DYLA 3UODA 3AECD 4DEHA 1JKSA 3IQ7A 4I0RA 2PY3A 4CZUA 4QP8A 4UZHA 4F0GA 2UZBA 2QONA 4FV0A 2GHMA 4MYGA 4F6UA 4D28A 4RVTA 1ZYLA 5HZNA 1NVQA 1U59A 4AZTA 4HGLA 5JFXA 1YXTA 2HY0A 2VX3A 3E63A 1DI9A 2W1DA 4XEYA 3R71A 3UJGA 4AFEA 2PE2A 3LJ0A 3PG1A 3R1YA 2PVLA 2VTHA 4YJUA 2W1HA 3ORKA 1YRPA 2RFEA 2Q83A 3FMLA 3FI8A 5EQYA 4A9YA 4AXFA 2P33A 4F63A 2QOLA 3FI2A 3Q4ZA 2WDVC 2VZ6A 2V7OA 3TZMA 4BCOA 4E6QA 2O8YA 3S1HA 4MF1A 5J1WA 3G6HA 4C34A 4HYUA 4BDEA 2WU5D 4MWHA 1ZOEA 2J90A 3BPRA 4PQNA 3T3VA 4NFNA 4RJ3A 4ID7A 1NEND 1O9UA 4RVLA 2YISA 4JVGA 3T8OA 4ZLZA 4YXDC 5LMKA 2B53A 2ZM3A 3QUPA 4EWHA 2BFXA 1OGYA 3ALNA 2XK9A 2W1EA 3ZUTA 2OGVA 2GSFA 5IU2A 5IUHA 2XH5A 3GU5A 5CNOA 4CLIA 4FGBA 4S32A 3MS9A 4DH5A 3UYTA 1XH5A 2X8IA 3S2PA 2WQYD 4UYNA 4ZY4A 4F6WA 3UOHA 5IH5A 2P4IA 4FTJA 3MN3A 3MPMA 3RHKA 2REIA 3D7TA 3LMIA 4YR8A 1ZXEA 5I4NA 4YTHA 1G8KA 3MBLA 5HCXA 3V8TA 5FDPA 3HX4A 5H2UA 4ZY5A 3GXLA 3ZZWA 2WHBA 5HTBA 4F1MA 4NM7A 5KNJA 5FM2A 3UP2A 3I1AA 2BRHA 3II5A 5AUZA 5BVNA 4YURA 5CSXA 5FXSA 3QC4A 4RX5A 2G01A 4ZTLA 4PP9A 3EYGA 3KMUA 4CRLA 5CAPA 4ITHA 4O7VA 5ANOA 3KULA 3VRAC 2OKRA 3IG7A 5AA9A 5KKRB 3FXZA 2BR1A 4TNDA 5L6PA 3I0OA 4WKQA 5AM6A 4CFVA 2OH4A 3V5TA 4I5HA 3BKBA 3DDPA 4R78A 3KC3A 5C8NA 4YUQA 1YOJA 4J52A 3FHRA 4I41A 4E1ZA 4X6RA 4IH8A 5CT7A 5GINE 3OWLA 1K9AA 2C68A 3TXOA 1IAHA 2A2AA 3DKFA 4MHAA 1O6KA 4BVUA 5DNRA 3AE5D 5F95A 5M4FA 4B9DA 3KRXA 4I93A 3MJ1A 4O86A 3AT4A 4YTNC 5K3YA 1YHSA 3SRVB 2OIBA 5JFWA 4FSMA 4GK4A 3F5GA 1ZP0C 3EFWA 3R0TA 4O82A 4H3BA 3U4WA 1W7HA 3DAJA 3MWUA 3W0SA 2XYNA 3W2PA 4GG7A 2Z02A 5CLPA 2OJIA 4RWLA 5L6WL 3C0IA 3AC5A 4P5ZA 4WOVA 4C36A 2F49A 4I21A 4Q9SA 3T3UA 5FD2A 4B8MA 3BCEA 4YTCA 2VTIA 3JVSA 3RJCA 4E5WA 5GIOE 3T9IA 3LXKA 3GB2A 4YBJA 3Q9XA 4GUBA 4L7SA 3MH0A 3PJ2A 3TZ7A 5E8WA 3WYYA 1FBNA 5KMNA 2VO6A 3SA0A 4IACA 2NPQA 2V22A 3MY1A 2F7XE 4B8LA 3A7JA 3W0MA 3AEEC 3DXPA 3P5KA 5HO8A 1APME 3WF7A 4C7TA 3F2AA 5BVWA 5LQFA 4XG2A 4KKEA 3W0NA 2H89D 3FC1X 4BDBA 4WBOA 1YOLA 2UZWE 4XV9A 3RWQA 2YDIA 3FAAA 4R3CA 3Q2JA 4RX9A 4QTAA 2WQNA 4L68A 5EW3A 4RJ8A 4U44A 4NT4A 5IEXA 3R9DA 4XG3A 3UIBA 2NNWB 2V55A 4GUEA 4EOKA 3QRKA 5J1VA 3VBTA 3LLAA 4YSXD 5D9HA 4J1RA 5CSHA 4CFWA 3ORMA 2ONLC 5CEKA 2H34A 1RW8A 2PVFA 3FV8A 4WUNA 2PL0A 4FTCA 5E8XA 4EYJA 2YM3A 4KD1A 4AACA 4HGEA 4FKJA 1QPDA 4FEWA 5LXMA 1OVEA 3MTFA 5EDQA 3AEAD 2FO0A 5E92A 3ROYA 5K5NA 4OLIA 2P2HA 2X7FA 1ATPE 4S34A 3VS6A 4WG5A 4O0VA 5IQBA 2B9IA 3QA8A 3P4RD 5AM7A 3A2CA 2B4SB 4DBNA 5IA1A 4PX6A 1GZNA 2WTWA 3CD3A 3C13A 4Y5QA 2XJ0A 2C47A 3P23A 4TWCA 2R3IA 3HA8A 5CANA 5CI6A 2JITA 4J8NA 4DGMA 2PVRA 3QRUA 2G2HA 1YQ3D 3PY1A 2OBJA 1W83A 4QMWA 2WP9D 1OUKA 4NKSA 4ZLOA 4I94A 2HXLA 5EW8A 1M7QA 3EH9A 2B55A 3NPCA 5LVMA 4IANA 4C4HA 4DG3E 4AXDA 1H00A 1UNGA 5FLFA 1OKVA 5CU3A 4LQMA 4BDHA 2UW3A 3LQ3A 4YZDA 4U3YA 5FTGA 2JAMA 2Z2WA 4H58A 5KMKA 2ACZC 2OXDA 2XZSA 4O6LA 4LOPA 4PMMA 4BCFA 4CGAA 2RFSA 5BYYA 4FOBA 4QDVA 4WG4A 1FMKA 2ZB1A 2BZJA 4KSQA 3SC1A 4Z9LA 4HPUE 4ERKA 2GNJA 5DHJA 2OJ9A 4H36A 2BS4C 3V5QA 2J4ZA 4GW8A 3P79A 2J51A 4EJNA 3AEFC 5CF4A 4GKIA 4JI9A 4F9YA 1IA8A 2BTRA 4FUXA 4I3ZA 3E93A 4HYHA 3ZRLA 1EH4A 3MH2A 4XV3A 4LI5A 1OKWA 2VTAA 4EBWA 3ELJA 2YAKA 1UKIA 4OR5A 3ORZA 4QP7A 1LUFA 2EU9A 4TW9A 1ZYJA 4LYNA 4BYIA 3F3VA 4YSJA 3F2NA 3ODYX 2VWBA 5GHVA 4ANQA 2C6DA 1DAWA 2Q0NA 3Q52A 5AJQA 1GY3A 3WOWA 4ALUA 3RP9A 3PG3A 5IMXA 3VRZA 3QXOA 1L0VC 1PYXA 4QMUA 5M56A 1Y57A 4ZSJA 2R3FA 4EOQA 1UU3A 4FKPA 4FEQA 4DEIA 3BYUA 1JWHA 4HJOA 3I6WA 3LXLA 4OTGA 4U9AA 3TNQB 1KE7A 2XK7A 4N4SA 4ACGA 5IZFA 5BUIA 1XQZA 5E8TA 4BCGA 4CKRA 5IEYA 3QA0A 2XF0A 1WBOA 2XB7A 4KX6D 1PXIA 2VWIA 4LUEA 4XRLA 1CM8A 3OBJA 1FVTA 5AUVA 1ND4A 4EZ3A 5JZNA 3REPA 4HYIA 3AC3A 4R3PA 3E62A 1XMLA 1CSNA 2X8DA 3EQGA 4IAFA 2ITNA 4TYEA 5CSVA 4AN2A 4CEGA 3NX8A 4GV1A 3ZO3A 3IONA 3DAEA 5A9UA 2WTIA 2E9NA 5I9WA 1KOBA 4XBUA 3SRVA 1NVRA 4F9CA 1Q24A 4ZTMA 4OGRA 4RPVA 5L8JA 3AE6C 4XLIA 1JKKA 2IN6A 3FPMA 4IZAA 1KE5A 1OL5A 2PUUA 4BCPA 3F5PA 5J87A 5T3QA 4GSBA 4LM5A 3QKKA 4X3FC 4G1WA 4FKQA 3BE9A 3CJGA 2W1GA 4MXOA 3F2RA 3A7FA 5J7HA 5LMAA 2YCQA 4ZXTA 2YM6A 3NW7A 3D94A 5B0XA 4PF4A 4XOZA 1PHKA 3CPCA 3F3UA 3PP1A 1UNHA 4L44A 3D2KA 1H4LA 1OZ1A 3FY2A 3TKHA 2XAOA 4EZ7A 4LGHA 2X1NA 1GIIA 3NUUA 5CT0A 2YA9A 2UZVA 3LCDA 4GMYA 3W1FA 3P4QC 3KN6A 2R5TA 4AGWA 4LGGA 2GHGA 5HU3A 2X2KA 2OF4A 3GNIB 3KVXA 2R3RA 3R2BA 5KMOA 4IZ5A 4QP4A 5L2SA 2UW7A 3P7AA 2CNUA 4KUJA 1YQ4C 1FOTA 3QCXA 3QZGA 1H28A 2OF2A 4CD0A 4EUTA 3Q60A 1ZOYD 4JBOA 5A4TA 3KMMA 3QX4A 2HENA 3DBDA 2XRUA 1G5SA 3UOJA 3QLGA 2J50A 3LM5A 4G16A 4OTHA 2R0UA 2XIRA 1PW2A 2FSOX 2OSCA 3F6XA 3TJCA 3TZ8A 1ZLTA 1YQJA 3R7YA 5HNIX 4AZEA 2OZOA 1UV5A 2I40A 3QKMA 4FT9A 2XEYA 3FJQE 1ZYSA 4JT3A 3SFED 4BR3A 3U4UA 1XMMA 1W84A 1Y91A 4NYEA 3AE4D 3LHJA 1STCE 3ORIA 4B99A 3C7QA 2HZIA 2J7TA 4YZMA 4O0YA 2HOGA 2RFNA 3LAUA 4YO4A 5CVFA 4LMNA 4I6FA 3U6HA 5JH6A 1P14A 2BAKA 5CENA 3NRMA 5LVLA 4EORA 4YGAA 4QTBA 1XR1A 4FT0A 1J7IA 3AXWA 3FLNC 4FI1A 2UW9A 5CEQA 5ANGA 3KVWA 4L7FA 3A62A 3FYKX 3UDZA 2UVXA 3AE1D 3TWJA 2UZDA 5KX8A 4C58A 5LVPA 3PXYA 4JDJA 4UWYA 4YPSA 3HAMA 4BIEA 3V6RA 4A9TA 4EC8A 4BI2A 3LIJA 4DEBA 1OITA 5IISA 4EKKA 2QD9A 3OXTA 3TM0A 5BVOA 3VC4A 4YT0C 4FSWA 4GYIA 5DVRA 5CAQA 3EQHA 4CCBA 4JIKA 4E6DA 2YERA 1VJYA 4RBLA 4GU6A 4QO9A 4ZSAA 4FV2A 3V5LA 1PF8A 3H9FA 4OBOA 3HMOA 2WTJA 5HNBA 3ROCA 2Y0AA 3G15A 3EMGA 3QD4A 5IQIA 2X81A 2XEZA 1VLRA 3AE3C 2YWPA 4FV8A 3HVCA 5HVKA 4A7CA 3P4PC 3O8TA 3IW4A 3D5VA 3NAYA 3GFEA 4JBPA 4AOIA 4NWMA 2WIPA 2OG8A 3BZ3A 3UNJA 2V5QA 2VWZA 4FNYA 1OECA 4C0TA 3LQ5A 3GC9A 4N70A 4FL2A 1H27A 2XKFA 1KE6A 1XH6A 4FE2A 2ZDUA 3CCNA 3CSVA 3LFFA 4MWIA 1FGIA 1REJA 1JSVA 3PE2A 2PUIA 5HEZA 4A4XA 5JGBA 2XYUA 3UOKA 4DEGA 3VR9C 5D41A 4YTMD 4TL0A 3F5UA 4QP2A 5HNGA 5CALA 5AIKA 2RGPA 5JRQA 3QHWA 3VUHA 4OTRA 2FB8A 2WOUA 3VUGA 4G2FA 3A7GA 4BZOA 4D2RA 2Y6OA 5FM3A 2G9XA 3G9LX 3BBWA 4ZTHA 2YM7A 2R3OA 4E93A 2E9VA 4C2VA 4QMMA 3RPOA 2VTPA 4E26A 5JQ5A 2J0IA 4DG0E 3PJ3A 2QO9A 3EFKA 2IVUA 3VO3A 4NW6A 4QQJA 2VUWA 5HVYA 1SYKA 4XJ0A 2WDRC 1KF6D 4CTCA 4BDFA 5EHYA 3F69A 3PY3A 4HNIA 4X6QC 4L9IA 3ZLWA 4DDIA 4IJPA 4BZNA 5GJGA 2XAMA 3UC3A 4AZFA 4EQUA 4QQTA 2FVDA 1U54A 2WDVD 1AGWA 3JVRA 2KULA 3HLLA 3MH1A 4IAAA 5F1ZA 4DLJA 4F9BA 2VO3A 1SVHA 2Z60A 2XBAA 1TFFA 3GCSA 1NT2A 4LV8A 1MP8A 1IR3A 2BVAA 2C0TA 3OEZA 4RMZA 4V01A 4YXDD 4FX3A 3ZOSA 1YDRE 4GFOA 3S0OA 4FZDB 3U55A 2IVVA 1OL2A 5CVHA 4DTKA 4FYOA 4RX8A 4G3DA 4USFA 4OT6A 4CTBA 3QHRA 4JG7A 3CQWA 1U5RA 1J7UA 4F6SA 2AUHA 4GVAA 3IW6A 4FA2A 3QUDA 3DKOA 4GYGA 3KRJA 3VUMA 1Q4LA 4AAYA 1OPLA 4FOCA 3KQ7A 3M42A 4M69B 4U5JA 2J6MA 3RAIA 2JIIA 2DQ7X 2J0JA 5LWMA 3NUSA 2C3IB 4PRJA 4CVAA 5I5ZA 2WELA 2JDSA 3DZOA 2ZDTA 3PTGA 1R78A 4CXAA 4CT1A 4YTFA 3G5DA 1UWHA 2GNFA 3ZCLA 3DBFA 4G5PA 2WU2C 5IMEA 1Q3DA 4EYMA 4YZ9A 3VRAD 5BVKA 4WSYA 3R9NA 4J96A 1YXSA 3QYZA 4DCAA 3CIKA 5C2TC 3LFNA 3PPJA 4GU9A 3KK9A 4TTHB 4DLIA 4IX6A 4TXCA 3QCQA 4CMTA 1QLBC 4KIPA 3WZDA 3DB8A 4NCTC 2VTTA 4DEDA 4FV4A 1OPKA 5LCJA 3U6IA 3AKJA 2WQMA 4FVRA 2ITZA 3R9OA 3GCPA 2V62A 1SM2A 2WIHA 4ZMEA 5IA4A 1U5QA 2GS6A 5JQ8A 1VR2A 5EFQA 3SW7A 3V8SA 5IUGA 3BLRA 1O6LA 3ZFYA 4LFIA 3AMBA 3EKKA 3BU3A 2G1TA 3DOGA 3NIEA 3FMDA 4JDKA 1ZP0D 2VWWA 4F08A 3FLYA 5J9LA 4JQEA 3AT3A 4L46A 5ETIA 4NFMA 1XO2B 3MVHA 4ZSLA 2OJGA 4EZ5A 4DE4A 3LVPA 2OH0E 3AD6A 3B2WA 3CY2A 2NYAA 3C4EA
chains in the Genus database with same CATH topology
3PXKA 3GCQA 4M12A 4FKGA 3NUNA 4RVMA 4FKUA 4AGDA 4M0ZA 4XYFA 5HBJA 3CLYA 3EIDA 4FSQA 5E90A 5HVJA 3JXWA 3V51A 4EBVA 3DBCA 3DNEA 3OTUA 4BI1A 2W1FA 4DGNA 4NZWB 5EI8A 2VU3A 3Q6UA 2QOIA 4H3QA 4JL9A 1G8AA 2CN8A 3V01A 5IF1A 4R6VA 4XP3A 5EM8A 4H3PA 3NNWA 1KV2A 4IX5A 4PTGA 1B6CB 2DWBA 4J7BA 4HVIA 3PJ8A 2X4ZA 3UVPA 3Q9WA 1W8CA 4A07A 5EHLA 2XP2A 5TT7A 1JAMA 2R9SA 3F66A 2A0CX 4YJTA 3BEGA 4TT7A 3ITZA 3QWJA 2QOKA 4BDJA 3SXFA 4IEBA 2BALA 3F61A 4FYNA 2Z8CA 4G17A 2A4LA 4BN1A 2I1MA 1NXKA 2UZLA 3HMMA 3OT3A 5C27A 3R02A 3L8SA 3CY3A 3DA6A 3QALE 4R1VA 4AN9A 3F3TA 3RAKA 4YNEA 3U87A 3OUNB 3VS1A 3COIA 4D5HA 4RQKA 2Z7RA 3NCGA 3PRIA 4YJNA 3R63A 3COMA 4QP9A 4X2KA 5BVEA 2W1ZA 4IVBA 2HK5A 4UZDA 5IQHA 4XLVA 3M2WA 4KS8A 3LPBA 3FSKA 4KIOA 5M08A 1SNXA 2YCRA 3D0EA 2BILB 1LPUA 3OY3A 3OP5A 5AV4A 5AX9A 4ZS4A 3GUBA 4AP7A 4YJQA 5E4HA 5EYMA 3ZUVA 3BGPA 4GT5A 5LCKA 3R2YA 5EQEA 1L8TA 3UPZA 3W0PA 5KHWA 4G3EA 3GU6A 4XUFA 3ULIA 2F7ZE 3NCZA 4LUDA 3I7BA 1BKXA 3TNHA 5IEVA 3P5JC 5HI2A 4J97A 3KRRA 4MEDA 3M1SA 4EOOA 5DBXA 5CAOA 3COHA 4IAKA 2QLUA 3BELA 2YIXA 4YC6A 3VBWA 3UQCA 2PZ5A 3CGFA 4FTNA 3OZ6A 5HCZA 5C1QB 2F4JA 3FDNA 2W1CA 4FIIA 4IJ9A 5AUTA 1OI9A 3QZFA 4JJRA 3UYSA 2CNVA 2W0JA 2XIZA 3EQCA 4KAOA 4RFYA 4ENYA 2F57A 1OMWA 5DR6A 4OTWA 3UC4A 3O23A 4AA5A 3THBA 4CCUA 1ZZ2A 2C6MA 2UUEA 3TTIA 2QU5A 4L00A 4QTDA 5IA2A 2X7OA 2HWPA 1GAGA 3CKXA 3OXZA 4R7BA 3F7WA 4O7ZA 3B8RA 3VS5A 3BGZA 3C5IA 3CBLA 4TWNA 4YZBA 3PRFA 5EM5A 3EN6A 4PMPA 3LJ1A 3DDQA 2WMTA 3CQEA 4FT3A 2A27A 4YJOA 5CSWA 5JGAA 1UWJA 2YDKA 3E5AA 3R7UA 1Z5MA 3G0EA 2BZHB 2ITTA 3F7ZA 4MXYA 3MVLA 2RKUA 3EN5A 3K5VA 2XUUA 4DFXE 3H9OA 5G6VA 5IG1A 2PVKA 3W0RA 3IPHA 5HE2A 3ENMA 4L3JA 2YIRA 4N6ZA 1YDSE 5DT0A 5DA3A 5L2IA 2W9FB 3JUHA 4PNIA 2O64A 1TKIA 4R1YA 5F4NA 3PIXA 3KA0A 4DN5A 2UV2A 2VWUA 4JLCA 2C0OA 3R7IA 1NA7A 2PUNA 3KFAA 1WBWA 3DXNA 3MVMA 4DH7A 1YXUA 4IBMA 3EZRA 5IUIA 5DEYA 5IH4A 3R8ZA 3VHKA 5AUYA 2C6OA 3F9NA 2VV9A 4FSRA 3WF8A 3GC7A 4ANMA 3MFSA 1URCA 3UE4A 4CMUA 4K0YA 3E8CA 4L42A 3WZEA 2YWVA 4F9AA 3KXZA 1KSWA 2Y4IC 4O7NA 1KOAA 4QYHA 5EW9A 3O51A 3M11A 5IA5A 2ZMDA 3BI6A 1P4FA 3BLHA 4X2NA 3Q96A 3SW4A 3KCKA 4UV0A 4L52A 2GFSA 2YM8A 3HDNA 2G2IA 1ZMWA 2BRNA 3MFRA 5ANKA 4AUAA 4BYJA 1M2PA 3QGWA 3OHTA 4UB7A 2VWXA 3QC9A 3FSFA 4DG2E 5AEPA 4I5MA 2BKKA 4GEOA 4BGQA 3W2QA 4EK4A 5IA0A 2WEIA 3EFLA 3G6GA 1MUOA 1UNLA 3QD3A 4FTKA 4RC3A 2OIDA 2YZAA 3OCSA 3ORNA 4L6QA 4BB4A 4F9WA 3ALOA 3POOA 2W1IA 4ZTRA 2VGPA 3A61A 1U46A 3PYYA 4MCVA 4I4EA 4O0SA 4YTIA 4U45A 2ITVA 3PFYA 5HE0A 2ZM1A 4Y72A 4D4RA 2ESMA 2CNQA 3MGYA 4WNMA 4RC2A 4EONA 4DGLC 4HGSA 2ITUA 2RFDA 2CJMA 3LZBA 1UU9A 2VD5A 4IVAA 1ZRZA 4MXZA 2YM4A 1MRUA 2FA2A 3HMIA 2IW6A 4R3RA 5CQWA 3KL8A 5HBHA 5TR6A 2W5HA 4TYIA 2B9FA 4I20A 2XIYA 1ZARA 3ORLA 2R3HA 3Q53A 2UZNA 4H05A 4BIDA 3EQFA 4HVDA 2WTVA 4WBBB 2JKMA 4YMJA 4I5PA 1PMVA 3KN5A 3PIZA 4GJ3A 4L45A 4RLKA 3QZHA 4D58A 2W06A 5C4KA 1Y8GA 4FR4A 2W4KA 3AC2A 3TN8A 3LXPA 3W16A 3PA4A 2JIUA 4OUCA 2XKCA 3NLBA 3WBLA 1V0BA 4HZRA 3E3BX 4K77A 2UW6A 1OBDA 1RE8A 2WTDA 2RIOA 4I6HA 5FG8A 4AWIA 5JSMA 5KCVA 4GIHA 3IK3A 4IW0A 4EOJA 4QMTA 2WAJA 3WZJA 5HQ0A 3FZRA 4AT5A 4QYGA 5M06A 2IWIA 2WKMA 5B2LA 2XBJA 2XNOA 2UZOA 4KBKA 4XRJA 4DH3A 1QMZA 3QQGA 4HCTA 3IOKA 1P2AA 4A4LA 3LLTA 4FV5A 4G3GA 2A1AB 3MV5A 4MX9A 5AFVA 4I23A 4M0YA 4QMYA 3HRBA 2GNHA 4FZ6A 3FI3A 1J7LA 1YI3A 2LGCA 2ZAZA 3FMNA 3SXSA 3DJ6A 2VTRA 2W4JA 3R1NA 2P3GX 5F9EA 4X2FA 1WZYA 2W05A 4FIGA 4IIRA 4I6QA 4S2ZA 3Q4TA 1XBAA 3TZ9A 2CGUA 4LRKA 3W10A 4BJJB 3COKA 3E3PA 2PE1A 4X3JA 3SDJA 5KO1A 5TKDA 3VF8A 1PXKA 4X3FA 2WEVA 4D0WA 1H25A 2PUPA 5DLSA 1UU7A 3SOAA 4WNKA 1XHAA 3BV3A 1GZ8A 3R04A 3I4BA 2QOFA 1PRYA 1LEWA 2NRYA 2QCSA 5DR2A 4II5A 4RIYB 5A6NA 4BCNA 1GIJA 3K3IA 3ERKA 5CZIA 4EWQA 2XK6A 2YACA 4EH9A 1YXVA 3Q4UA 5H9BA 1IASA 4JG6A 5K4JA 2JC6A 2CHLA 3GCVA 3WF9A 2BZIB 3OCBA 3ZMMA 2FSTX 5L3AA 4AZWA 5CEOA 3UG1A 3SXRA 4WG3A 1R0EA 2CGWA 4YPDA 5HLPA 4RWJA 2XNBA 3JS2A 3PFQA 4MBJA 5AV0A 1OIUA 4JQ8A 3TKIA 3H0YA 3BL7A 3BU6A 3I5ZA 1YI4A 3MFUA 3LMHA 4LRMA 3I79A 4P7EA 1GJOA 5GIPE 3I5NA 5AX3A 4L01A 5TOZA 2R7BA 5FRIA 2X2LA 4QEBA 2CKEA 4XBRA 3RAHA 4QMSA 3A4PA 4IVDA 4XP0A 4JAIA 4CLJA 1Z9XA 3FKLA 4QT1A 3NW6A 5EKOA 1OL7A 2PVYA 5HIDA 1FGKA 5HD7A 3FZPA 5CNNA 2PMIA 2XVDA 3FHIA 4Y5HA 2Z7SA 4BTMA 2IPXA 3RM7A 4CQEA 4KINA 4BCQA 3RK7A 1SZMA 1A06A 1W82A 3CGOA 4JOAA 4HCUA 4KIQA 2XCHA 4N6YA 5D7VA 5B7VA 4F1OA 1MQBA 2HWOA 3P86A 2GU8A 3HNGA 2XK4A 4H1JA 5IA3A 5BYLA 4FL1A 4MNEB 4DBXA 3T9TA 1M17A 4FSYA 4QYEA 2VTSA 4M7IA 4YZNA 3GP0A 3GI3A 4DGGA 4DFLA 4IM3A 4D0XA 1H0VA 3UIXA 2J5EA 2IW9A 1WVWA 3DGKA 1PXJA 4O7SA 5D7AA 2BUJA 3TCPA 3W32A 1Q61A 4I22A 5HE3A 3TDVA 4DFYA 4M15A 4USEA 4EK6A 5K4IA 4QMNA 1FINA 4HPTE 1BI7A 3FPQA 3L8PA 3QUEA 2GQSA 2WB8A 4S33A 4E6CA 2CCHA 3F88A 2R0IA 3FL5A 2Y4PA 3FZTA 3OF0A 4HYSA 4E20A 4E5AX 4O84A 1FPUA 4RJ4A 5JMSA 2P0CA 1Y8YA 2RG5A 4RSSA 2C30A 4ZTSA 3V5JA 4F7NA 3TUDA 3GOPA 2HW7A 3EB0A 3MIAA 3UDTA 5A4LA 4EH8A 4IB0A 3O17A 5DYJA 1VZOA 1T45A 3PJ1A 3R83A 1OM1A 3RCDA 4KKHA 4TY1A 3EQIA 1O6YA 3EL7A 5HX8A 4QMVA 5M57A 2CCIA 1XBCA 4G34A 5KZ0A 4AU8A 3KEXA 3BGQA 4FTOA 3R21A 4C4JA 2X39A 4AG8A 4RJ6A 4FK3A 3AT2A 5M09A 1KUTA 4UXLA 3IW8A 3W55A 1SVGA 4NH1A 3UOLA 4C4EA 2GNLA 4M13A 2OJJA 5I9ZA 2G15A 3HEGA 4XV2A 3UZPA 3WF5A 1K2PA 3ZSIA 4D4SA 3AMAA 2B9HA 3D4QA 2YABA 4CFXA 4HVSA 1JKTA 1U54B 2CGXA 2HW6A 3RVGA 2BRMA 2ACXA 3PPZA 4ZZNA 2ERZE 3E7OA 4KB8A 3W2RA 2QOOA 5IQGA 2IW8A 2VO7A 5DG5A 1KV1A 2I0YA 2UW8A 3DV3A 4BY9E 4EH6A 5CASA 4IHPA 4J95A 1R39A 4ZIMA 1H24A 2C6TA 3FMKA 3RPVA 3NGAA 2X7GA 4FKVA 3QTSA 3O96A 5J8IA 5LMBA 1I09A 1KWPA 1RJBA 1WMKA 3FMEA 4TPTA 2VTOA 5FEEA 3R28A 3VIDA 4Q9ZA 3UDSA 2VN9A 4MBLA 2H9VA 2R3MA 3TUBA 4JR7A 4FV9A 1QL6A 1H1QA 1UKHA 1ZMVA 2WMVA 3JY9A 5CQUA 3IW5A 5JFVA 5M55A 3RNIA 4EI4A 3HZTA 1DI8A 1PKGA 4F99A 4TRLA 4RIXB 4HVGA 3Q9YA 3R22A 4QYYA 3GQLA 2EB2A 2WO6A 2F9GA 2QKWB 3QKLA 2BRGA 3D83A 2HAKA 3P9JA 4YHFA 4FODA 5CYIA 3RMFA 3ANQA 5DN3A 2HYYA 4F0FA 4FTIA 3RK9A 3HRCA 4IM2A 4RZWA 1NVSA 5HORA 3W2OA 2XALA 3ZM4A 1QPEA 5H8BA 2FGIA 3NYVA 5E9EA 5AADA 4J71A 4RFZA 4DFUA 4I24A 3A7IA 3ZDIA 2WFYA 3S3IA 4EH3A 1YHWA 3FQSA 5BUJA 4JDIA 5CU4A 1VYZA 4M68A 4BJJA 4O21A 3OT8A 2C6EA 1YXXA 2WZJA 4BGGA 3A99A 3UZTA 2HY81 3TT0A 3R7EA 2JDTA 4EOPA 4O7TA 1PKDA 3GC8A 1WBVA 2VRXA 3CTHA 4JRNA 4FTRA 4IE9A 3P4KA 4JIAA 4RIYA 3ZH8A 1YI6A 3VWAA 1W98A 3D7ZA 3IECA 3QTUA 1DM2A 4RLLA 5HE1A 1YWVA 2C5VA 1JPAA 2BRBA 4EOSA 5DOSA 2JIVA 3ZSGA 3C51A 4LL0A 4APCA 5JT2A 1G8JA 3AGLA 4GCJA 4DHZA 4XG6A 5EM6A 4UWBA 4KWPA 4CMOA 2ITQA 3PSCA 3QZIA 4C61A 2ZVAA 3PE1A 4YSMA 3QWKA 5CVGA 3U6JA 4K33A 5AMNA 5IQCA 4NKAA 3UZRA 2J0LA 4WT6A 3E92A 3AG9A 3E87A 3Q5IA 5IDNA 4FTTA 4GS6A 1I44A 3MB7A 3QLFA 2OIQA 4Q5HA 3H9RA 3ZXTA 4QMXA 3KB7A 5EK7A 4IFCA 2CKQA 3N4VA 2DS1A 4EH7A 4JXFA 3MESA 5C9CA 5KMLA 4FKSA 4GJ2A 4M84A 4UY9A 1IEPA 3FC2A 4NCTA 4RVKA 4BHZA 4C33A 1B38A 3UBDA 4XP2A 4PUZA 4EHGA 2IZUA 4TN6A 5KKRC 2C69A 2XIKA 3EL8A 3QRJA 4CSVA 3DXQA 2UW0A 3I6UA 3VS4A 1S9JA 1Q8ZA 4PP7A 2OICA 3LCSA 3P0MA 3TI1A 4MNEA 4DEAA 5BUEA 4JBQA 2PPQA 2Y4IB 4AFJA 4PDYA 3NIZA 1Q8YA 4B6LA 3ZHPC 2NP8A 4EH4A 3RCJA 2VTMA 3DY7A 4WRSA 5FGKA 3LFQA 1JNKA 2GS7A 3N4UA 5GJFA 3VS2A 3FLQA 4Z7HA 2WQBA 4W8DA 3QTWA 2PVMA 3IDPA 1PXLA 1JQHA 5E1EA 3BYSA 4ALVA 4ACDA 3K54A 2QURA 2YIQA 5I9UA 5E91A 3TV4A 5C26A 3LFAA 3NR9A 3OVVA 5AIRA 2HIWA 1XH7A 2R3JA 2J0MB 1FVVA 4YO6A 5KZIA 3E64A 1YOMA 4RT7A 4LOQA 4U80A 3V5PA 5EOBA 3PP0A 2ZV7A 1DS5A 3HV7A 3NUAA 4RC4A 4E7WA 4ERWA 4F4PA 3SAYA 4RIWB 1BX6A 4ZK5A 4IVCA 4DA5A 5FEDA 3G90X 2GCDA 3QFVA 3EHAA 3VW6A 3L9PA 2JDVA 4O81A 4XS2A 4CT2A 4FJVA 2CPKE 2ETMA 2H96A 5AUWA 4D4VA 4O27B 4F70A 4GH2A 4PL5A 4MQ1A 4CFNA 4JX7A 5M4UA 5ETFA 4CV9A 2J5FA 4QDEA 3UO4A 3ZONA 2WMSA 3BHUA 4ZAUA 3NYNA 3BL9A 3EN4A 3LQ8A 1E1VA 4RGJA 2CGVA 2UZEA 2UZTA 3FKOA 4H39A 3P1AA 3C50A 2AC3A 3GOKA 1OGUA 3NZ0A 4FGRA 4IWOA 2R3PA 1PY5A 4IMYA 4L67A 4YBKA 5ANJA 4EQCA 5A46A 1Q62A 5EKNA 5M53A 3LKMA 2UZUE 5H3QA 3S00A 1R3CA 4JDHA 5A6OA 3GGFA 4R5YA 1WBSA 2W5AA 3DCVA 1H01A 3WIGA 3QRIA 4G9RA 3O71A 3E8EA 3ZRMA 5A4QA 5KMJA 5HD4A 1KE9A 4U8ZA 5M4CA 2F2CB 3I60A 3IKAA 3BEAA 3BX5A 2PYWA 2PK9A 2QODA 2CLXA 2ETRA 4OTDA 4XV1A 3CR0A 4TNBA 3ZUUA 2OI4X 1T46A 3FMHA 3OD6X 3PPKA 4I6BA 4M8TA 4S30A 4W4VA 3TMOA 3ZBFA 4FTQA 4RIXA 4ENXA 5L2TA 2OXXA 5DT3A 3RALA 4QYFA 4C4IA 3JYAA 4B0GA 4XNEA 3CJFA 1IG1A 2WPAA 3KRWA 4JBVA 5E1SA 4GFGA 4D1XA 4EOLA 3MPTA 2V7AA 5I0BA 4DC2A 4FTAA 5FQDC 2W9ZB 3E7VA 4IQ6A 2VO0A 4JS8A 4M3QA 3O7LB 4NW5A 5HU9A 2WMBA 2XARA 1ZOHA 2AC5A 5AA8A 3BHTA 1U4DA 3A7HA 5JKGA 3TJDA 3LFCA 5HCYA 4U7ZA 2OK1A 3GEQA 5D12A 3HDMA 5FBNC 5CEIA 3ULZA 2KTYA 2XM9A 5JGDA 3BE2A 3CXWA 3H10A 2EWAA 4O22A 2R4BA 3O0GA 3R73A 2ZFYA 4XG4A 3DKCA 5FDXA 2UW4A 4GK3A 5C03A 3TV7A 4LV5A 4U40A 5JRSA 4BCHA 3DJ7A 1PMUA 4IM0A 3MJ2A 4I1ZA 4U97A 5DI1A 1W0XC 3R01A 3HGKA 5EI2A 3DK3A 3VVHA 4A06A 3IGGA 4DHFA 1TQMA 3UMWA 2P55A 1IAJA 4WNOA 4YC8A 2BDWA 5IPJA 5M4IA 4F0IA 4E73A 5GJDA 3W0QA 4F64A 3TEIA 4XH6A 1JVPP 4HGTA 2X4FA 3ENHA 3R8PA 4V04A 2C1AA 1QCFA 2Y9QA 4IDVA 4F7SA 4D2SA 4QMOA 3HV3A 3HA6A 5DIAA 3DFCB 3P7BA 2GNGA 4WO5A 3VW8A 4RA5A 4LV7A 4HVHA 2GPHA 3MIYA 2WXVA 2LAVA 3QQLA 5HLNA 4NM3A 5CEMA 3QTZA 5EG3A 4PMSA 4P90A 3G2FA 4KS7A 4AX8A 3PSBA 2XK8A 3P08A 4J8MA 5EQPA 2CMWA 3MTLA 1WVYA 3HAVA 1V0PA 2CSNA 4FIFA 4LG4A 4UX9A 1J1CA 3FE3A 3RPRA 1OB3A 2EVAA 4ANSA 5AP6A 5CI7A 2QVSE 1SVEA 4FTUA 5CU6A 2XK3A 3KXGA 2VAGA 3NUPA 4AAAA 4UEUA 4ZY6A 4O7WA 2BPMA 3DBEA 5HLWA 5I9VA 3Q9ZA 3ZDUA 2E9OA 2X0GA 2RG6A 4GIIA 3C4ZA 4CKJA 3FUPA 2FUMA 3R8VA 5HG9A 3VULA 3GU7A 3O7LD 3DQWA 5CF8A 4WA9A 1ZAOA 5BNJA 4NUSA 2B1PA 4DHJA 1YVJA 2VTLA 4NIFB 4ZZMA 4K6ZA 4AW2A 5HTCA 1H1PA 4U43A 2O3PA 3FLWA 4MVFA 4BKJA 3OS3A 4IFGA 4CG8A 3OCTA 1MRYA 5E8SA 2C6KA 1Y6AA 1PJKA 4JNWA 4DFNA 4BDGA 3PLAE 4P5QA 4RIWA 3N51A 5DH3A 2B52A 4BRXA 4EK5A 3HL7A 4W4XA 1TVOA 3GCUA 4QP1A 5EM7A 3GQIA 5ETAA 1KE8A 1ERKA 3E8NA 4CZTA 4EK3A 4L43A 3ML1A 4K18A 5F94A 3FQHA 2QQ7A 3R9HA 5BMSA 3VBVA 2PSQA 2EUFB 4O0TA 4FEXA 1JSTA 3TL8A 2SRCA 4MKCA 3AC1A 3EYHA 3C5UA 4X3FB 3NAXA 4O0XA 5J5SA 4RG0A 4DHIB 5DRBA 4RRVA 2BDFA 2ITYA 5IQFA 3FLZA 3ANRA 2GQRA 1GIHA 2Z7LA 2IVSA 3D14A 4KSPA 2JBOA 4CFMA 3H0ZA 3QBNA 2I7QA 4C62A 5AP3A 4MXXA 3OTVA 4DFBA 4E4XA 3VBYA 3QGYA 3BWFA 4NK9A 3RNYA 2QOHA 5HESA 5AV2A 4ANLA 3GU4A 2ETKA 4WUAA 4IC8A 3SG8A 4FV7A 1SMHA 3VN9A 3O8UA 4FVPA 3BQCA 2XIXA 2C6LA 1OIQA 1Q8WA 2XNNA 2UW5A 5JK3A 4ZSGA 2JDRA 3VJNA 3POZA 1Q5KA 3NDMA 4JQ7A 3SVVA 4O6EA 2GFCA 3NMUF 2QC6A 4KBAA 3TYKA 4NU1A 4DFZE 1UA2A 4UALA 4J53A 2PVHA 4E6AA 2ONLA 4FT7A 4NJDA 3NNVA 4FMQA 5T6KA 1ST4A 2ZV9A 3N4TA 4LRJA 3HRFA 4Y46A 2PMLX 2ZM4A 3ZXZA 2OFUA 3OG7A 2O5KA 2WMQA 4O0RA 3TIYA 2E9UA 4W4YA 5D11A 5ETCA 3QXPA 4JG8A 5CF6A 1HOWA 4G6OA 4FSNA 3R7VA 4D9TA 2YHVA 2PVNA 3OMVA 2OFVA 2PZIA 4JX3A 4K2RA 4RZVA 1OBGA 4B4LA 4AA4A 1BLXA 4PTCA 2HZNA 1LEZA 4MNFA 3R8LA 2C1BA 3ID6C 3L1SA 1WVXA 1ZY4A 3L9NA 3AC4A 3RPSA 2QLQA 2C0IA 5DT4A 4ARKA 3QQKA 2BCJA 2FSMX 5TO8A 4FNWA 3Q2MA 5HO7A 1M2RA 5A3XA 4A9RA 1JBPE 2CKPA 3NYOA 2AEGA 4BDDA 2OJFE 3TKUA 3ZTXA 1P5EA 4FTMA 1CTPE 3FKNA 3LXNA 4MD7E 2X2MA 5FTQA 5TF9A 3EWHA 4BGHA 3MY0A 5HG5A 3TACA 3NWWA 5IQAA 4FSUA 4FICA 3RKBA 2OW3A 2BKZA 4G9CA 2OZAA 3WF6A 4ORKA 4XHKB 2B9JA 2WTKC 3G0FA 3ZO1A 1YDTE 4QQCA 5HICA 4EHEA 1XJDA 5ANEA 4EKLA 2VNYA 1LP4A 2IZSA 4HW7A 3DFAA 2C6IA 4FEUA 4FV1A 4C2WA 3H30A 2B54A 2XRWA 4CG9A 3GT8A 4MBIA 5HX6A 4V05A 3UP7A 3LFBA 3D9VA 2GNIA 3UNKA 3WIKA 4F65A 4L8MA 2BROA 3OROA 3SKCA 4IB1A 5CY3A 1OPJA 4UN0C 4DINA 4ZTQA 5T68A 3UPXA 4O2PA 4DEEA 5KMMA 3WZUA 2BAQA 3IW7A 3NYXA 4GT4A 2DUVA 5BVDA 2JD5A 4PDPA 4NJ3A 3DAKA 2WMXA 3C0GA 4EQMA 2HXQA 5HG8A 3RGFA 3ZC5A 3PDTA 4AOJA 4D5KA 1WCCA 2B0QA 4MXCA 5BX0A 5H8GA 1TQIA 3DTWA 2BDJA 3QD2B 3KXNA 5AP4A 4YU2A 5I9XA 4F09A 4K1BA 4X0MA 4YHTA 3ZRKA 4DH1A 1YKRA 1ZY5A 4R77A 4CNHA 2ZYBA 5LOHA 1ZWSA 3BRBA 1AQ1A 2VGOA 4TYHB 4CKIA 3SGCA 3PUFC 4E8AA 2IZRA 2X6DA 4FG9A 5EOLA 2C5NA 2JAVA 4QOXA 2QOBA 3ET7A 4ALWA 4QMZA 5BVFA 3L9LA 2GHLA 3EQRA 3IO7A 3OY1A 1CKIA 4YJPA 3ZFMA 4QP3A 4AW1A 5LVNA 1OUYA 1J91A 4IWPA 3ZU7A 3LCKA 2W4OA 1BMKA 3QU0A 3ZLSA 4AT3A 4BC6A 3ZO4A 2CN5A 3BIZA 4YP8A 4FKIA 4RQVA 3FL4A 4QPSA 1CMKE 4AXAA 5EDPA 2O0UA 3P7CA 2XKEA 4DAWA 2W96B 3Q32A 1RQQA 1E9HA 3ZBXA 1R0PA 2I6LA 1H1WA 2J9MA 2I0EA 3HV4A 3Q5ZA 4KA3A 3SLSA 3UQGA 3VRYA 1S9IA 2HZ4A 5D10A 3W2SA 4FVQA 3I7CA 4GKHA 3R7OA 3PVWA 4WHZA 5AP5A 5C01A 2PU8A 3B8QA 4EOMA 3RPYA 3PVGA 4FKWA 4KBCA 5CZHA 4U41A 2WD1A 2OU7A 2EXCX 4KRCA 5ACBC 5CU2A 3QX2A 2QG7A 3LFEA 4DH8A 5JEBA 4BBMA 4X7QA 4I0TA 5BYZA 2BTSA 3P78A 4YJRA 4W4WA 4EC9A 3PUPA 1LR4A 4Z7GA 4OBQA 1NW1A 4FBXA 5CF5A 1WAKA 4FK6A 1PXMA 5EYKA 2VX1A 3FMJA 4KNBA 3W8LA 3FZOA 2XANA 3HKOA 3MYGA 5LMKC 3EJ1A 3C0HA 3MA6A 3SX9A 2IO6A 3KGAA 2YCFA 3A8XA 4IAIA 5EYDA 4EJ7A 5IZFA 4BCJA 3VS7A 5LVOA 4X2GA 3IGOA 3Q3BA 3AQVA 5FXQA 3DLSA 3SHEA 4ASXA 4AE6A 3LM0A 1F3MC 4AE9A 1WBPA 3ZO2A 5CAVA 3KRLA 2H8HA 1CKPA 5J9ZA 4O2ZA 5AUUA 4XMOA 1GZKA 3QQHA 1AD5A 4RJ7A 3NEWA 4TKSA 3CD8A 3MSSA 3U9CA 3BBT