4DHJA

The structure of a ceotub1 ubiquitin aldehyde ubc13~ub complex
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
248
structure length
248
Chain Sequence
b'DQQLKTIEDEQKSVPLVATLAPFSILCAEYDNETSAAFLSKATELSEVYGEIRYIRGDGNCFYRAILVGLIEIMLKDRARLEKFIASSRDWTRTLVELGFPDWTCTDFCDFFIEFLEKIHSGVHTEEAVYTILNDDGSANYILMFFRLITSAFLKQNSEEYAPFIDEGMTVAQYCEQEIEPMWKDADHLAINSLIKAAGTRVRIEYMDRTAAPNGGWHYDIPSDDQQIAPEITLLYRPGHYDVIYKKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin thioesterase otubain-like
publication title The mechanism of OTUB1-mediated inhibition of ubiquitination.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Hydrolase/signaling protein/ligase
total genus 90
structure length 248
sequence length 248
chains with identical sequence E, I, L
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2012-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10275 Peptidase_C65 Peptidase C65 Otubain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1300.20 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases 3 helical TM bundles of succinate and fumarate reductases 4dhjA02
3.30.200.60 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4dhjA01
3VONA 4LDTA 4I6LA 4FJVA 4DDIA 4DHZA 4DHJA 1TFFA 4DHIB 4DDGA 2ZFYA
chains in the Genus database with same CATH superfamily
4F0GA 2R3NA 4S33A 4PP7A 2YIRA 4BDFA 1KE5A 3AEDD 1VYZA 3FXXA 3LFCA 4EJNA 3HV3A 3UOKA 2C3JA 2CNUA 2ZFYA 3LJ2A 3PJ3A 1ZOYC 4O27B 3T9IA 5HE2A 3AC3A 4ANSA 2VTJA 1YDSE 3RNIA 5M57A 3ET7A 2HW6A 4I0SA 1OECA 3PY3A 2XALA 3WBLA 2OLCA 3DBQA 4IJ9A 5DN3A 5EOBA 3W2OA 1UNGA 4MD8E 3R00A 3RM6A 4CZTA 2QOHA 3Q53A 3KIOC 3V5JA 2B54A 3KULA 4F0IA 3LXNA 5KZ0A 4CGAA 4ZTQA 1SNXA 1OUYA 2BS3C 2IG7A 3K2LA 2BKZA 2LGCA 2QD9A 4FT7A 4O0XA 4QP6A 3SRVB 4LFIA 4FNWA 3GU7A 4BCPA 2W9ZB 1A48A 4NM3A 4YZ9A 2GFCA 1WBTA 4QMUA 2H89C 3D7TA 4I92A 5BYLA 3WZDA 4I5HA 3OG7A 4OTWA 3SDJA 3EMGA 4AE6A 4FA2A 3AE9D 1PXJA 3ZUUA 3ZHPC 4F99A 1XH4A 1V1KA 4ZZMA 2PVMA 2XJ1A 3LFQA 3F5PA 3OY1A 4F9AA 4WOVA 4YSYD 3QHRA 5ETFA 4L6QA 4RJ6A 4D28A 3R8UA 1Q61A 4AF3A 5LXMA 3SXFA 5F20A 2Z02A 3PA4A 2WQYC 3BPRA 3ACKA 5LARA 3W33A 5TOZA 2GQGA 4WT6A 4IC8A 4CLJA 1MQBA 4GT5A 1H1SA 5DFPA 3FLYA 3KA0A 5KHWA 5C8MA 5CQUA 4FSNA 2IW8A 5E4HA 4GYIA 3NW5A 2VWBA 4EK5A 3LW0A 1REJA 2XBAA 4IANA 3WF5A 3WIGA 3D0EA 4DEBA 2ZDUA 3REPA 5F9EA 2JEDA 3D14A 1E1XA 4ZSEA 2YM6A 2VTAA 5BQ0A 4BTFA 1B6CB 3MV5A 4FIGA 3P7AA 4X2KA 4Y85A 2WMSA 1PYXA 2GNHA 4MEDA 5E8TA 3RM7A 3RKBA 4FV4A 1R78A 3E8CA 4M97A 4EH2A 4AZTA 4FTQA 4JG7A 3EFKA 4XX9A 3HEGA 3OOGA 4C34A 3N9XA 2B9JA 4FEQA 4QNYA 3H9FA 5AJQA 4RRVA 4ACGA 2FSOX 4IEBA 4KABA 4H1MA 5KBQA 3UQCA 1SVEA 3FJQE 4FTTA 3ABVC 3KXGA 3UQGA 2PMLX 1M7QA 3PRIA 3MA3A 2VU3A 3IOKA 3PXRA 4O91A 4QMMA 5CI6A 3FLZA 5EG3A 2UVYA 5BVKA 3R7YA 4BZNA 4L45A 2WS3D 3LQ8A 4FKLA 4YPDA 5F94A 4BI0A 4RX5A 2W5AA 4GIIA 4L68A 4MXOA 5CEMA 3N4VA 4NIFB 1UWJA 4IX5A 3R9HA 5IG1A 2LAVA 3S2PA 2Z7LA 2XM8A 4XUFA 4HVHA 1BL7A 4LQMA 1Q62A 1KV2A 2I40A 4JT3A 3ORLA 3ZTXA 3NUSA 3Q3BA 1U4DA 4I6QA 2PHKA 4AOTA 3SG8A 3GOPA 3VUKA 5EW3A 2WTWA 2B1PA 3OHTA 5AUXA 5DT4A 2W9FB 4NCTA 5CT7A 1WAKA 3PVWA 4D4VA 1OGYA 5CU6A 1Z9XA 4CT2A 3KMMA 4MH7A 4AX8A 1H4LA 1Z57A 4F9BA 3FI8A 5JN2A 3HUBA 2WEVA 3RAWA 1UV5A 3BGPA 3VWAA 4YXDC 5J87A 3NGAA 1H25A 1KWPA 4MKCA 2NO3A 2I0EA 1YWRA 4FZFB 3DJ7A 1J1CA 2BVAA 4TYGA 2JGZA 3LXLA 3W2PA 4FKJA 4WNOA 4E6DA 1G8KA 3E5AA 1ZZ2A 5JQ5A 3A7FA 4CKRA 3S4QA 5HBEA 4E4NA 3KK9A 5DR9A 5C4LA 4Z16A 3EQCA 3FMLA 4OTIA 1URCA 3EQBA 3QWJA 5DEWA 1XH9A 4IM0A 1YQ4D 3A2CA 4U79A 3EQFA 4MD7E 4K9YA 4ZTLA 3GP0A 2VWWA 2X7FA 3THBA 4DTKA 3PXFA 5TR6A 4HVGA 1XKKA 3MVJA 3Q6UA 3HMPA 4HGEA 3W55A 4C4FA 3Q4CA 2PVLA 3FMEA 4YTMD 5AX9A 3UODA 2JBOA 4PTGA 2R3MA 5EM7A 3R8PA 4KBCA 4FV5A 1SMHA 4RIWA 3OF0A 2WMVA 3MJ1A 4DBNA 1WVXA 4FV9A 5EHLA 3WARA 4AA0A 2YM3A 2FSTX 4QYEA 3UQFA 4FKRA 4M7IA 3BL7A 4O0VA 5DT0A 3E7VA 3ZZEA 1QPJA 4JBOA 2QOOA 1VR2A 2YISA 4NFNA 5IEVA 3CGOA 1XO2B 4ORKA 4S34A 2W17A 4YC8A 1YXXA 3F2AA 3O71A 3LMHA 3QD0A 4BCKA 4C36A 3QHWA 5CSPA 4AA4A 2ITYA 2RGPA 3DXPA 3MYGA 5DRBA 4EK3A 2HCKA 1PMUA 2CGVA 3DT1A 3Q9YA 2R0UA 3LM0A 3C0GA 3LOKA 4QMVA 5ANJA 4ZJJA 4EH3A 5HD4A 5BYZA 4UBAA 3E88A 4FVPA 4CTCA 4ZJIA 4R1YA 4XYFA 3F5UA 5E8XA 5D11A 1Q41A 2IW9A 1NVQA 5EYKA 4G9RA 1BKXA 4OLIA 4XRJA 5M55A 1UKHA 2AC3A 3QF9A 4I93A 4FBXA 4FT3A 4H36A 3UDSA 3ZC5A 5K4IA 1WVYA 4BN1A 3QTZA 4TYEA 2ZB0A 4GVJA 1PXPA 3ZU7A 3DAJA 5HX8A 5EHYA 3FKLA 1K3AA 2F49A 3GENA 3LCKA 4R5YA 2XA4A 4YNEA 2J50A 2I6LA 5ANGA 5HTBA 4I41A 5HLPA 3SD0A 2X8DA 2RG6A 3Q4UA 2JITA 5DT3A 2VD5A 4ZMFA 1PHKA 3IDBA 4U44A 3LCTA 2JAMA 2CCIA 3LFDA 4O7NA 2KTYA 4Q5EA 4ZY5A 4YJSA 2A1AB 3B8QA 4U40A 5C26A 4QMZA 4BGQA 2VWZA 4MAOA 1Y6BA 2GNJA 5AV1A 3KRXA 3HMNA 3DPKA 5F1ZA 5FQDC 3RWQA 3UMWA 1REKA 3A60A 5EOLA 2NYAA 4BYJA 5BYYA 3CIRC 3U4UA 3I4BA 5FD2A 2QO2A 2NNWB 2VN9A 3CQEA 3GU8A 3VJOA 1YVJA 4WKQA 4IVDA 4MWHA 4G5JA 5GIPE 4JIKA 1IASA 4ZSAA 3VAPA 2UW8A 3H4JA 3JS2A 3COIA 3IO7A 1OL5A 4E5AX 4ZK5A 3E3BX 3JY9A 4IW0A 4XLIA 1U54A 1XH5A 3QQLA 1G8AA 3DDPA 5J5SA 5AV0A 5GJFA 3MJ2A 4BDIA 3IGGA 3FLWA 2AC5A 3F3VA 1GNGA 4DGLC 4CRLA 3ZO4A 2C6DA 4F4PA 3DTWA 4FE2A 2XNOA 3U6HA 4M68A 3VF8A 1Q4LA 1GOLA 4RA5A 4FC0A 5M4CA 2GHMA 2BS4C 4IWDA 2XYNA 4EH7A 4QTDA 5DHJA 4FODA 4BJJB 4EBWA 4HJOA 5BUJA 3HYHA 5KMNA 1ZLTA 3TACA 1SYKA 4HVDA 2JD5A 4XG8A 3I0QA 1NW1A 2CKEA 3FL5A 3PVGA 4EBVA 3PY0A 4AZVA 3P4QD 3AD6A 4BRXA 1ZRZA 5JFSA 3E93A 3PLSA 2UW6A 4YUQA 4X3FB 1XBCA 2W06A 4CRSA 2ONLC 3LFEA 3ZOSA 4YZNA 3VIDA 2QG5A 4NM5A 4R7BA 5ETCA 3LIJA 4WRSA 3FMHA 3I6WA 4JAIA 4RIXA 4C7TA 3GC7A 2ZM3A 3OROA 3ROCA 2J90A 4A9TA 4BZOA 2NP8A 4IMYA 4O7TA 2WD1A 2PL0A 4GT4A 3BU6A 3FY0A 4ANMA 2EWAA 2GHGA 4E6AA 3DKCA 4JBQA 3VBQA 2R9SA 3HA6A 3V8WA 5IUHA 4O0SA 1UNHA 4X21A 2XS0A 4EWHA 2VWXA 3UPXA 4O84A 3QLFA 3E64A 5AP6A 1IA8A 5HU3A 4C3PA 1YKRA 1WBWA 5CT0A 3QYWA 5KBRA 2BAKA 3DZQA 2ZV7A 2QKRA 1YWVA 3PIZA 5IQAA 3R8VA 3WOWA 3F6XA 4AG8A 3CLYA 4V05A 5HE0A 4O2ZA 5BNJA 5HIBA 5IA1A 2VO0A 5HU9A 4O83A 2BAQA 2BZHB 4FIHA 4EH4A 5H2UA 1JWHA 5I9YA 4YSXC 1X8BA 1YWNA 3QCXA 1T45A 4YSZC 3HV4A 5G1XA 1LP4A 5HG9A 3VO3A 4AA5A 3TUDA 4DCEA 4Z7GA 2A19B 3DJ6A 3GBZA 4YTCA 2C3IB 5LMAA 3VUDA 2C30A 5KMLA 4U6RA 4YZCA 4MNEB 2QI8A 3KQ7A 2WDVD 2XYUA 3D2IA 4V0GB 2YZLA 2OIQA 5AIRA 2FUMA 2QODA 5CEQA 4OBPA 1PYEA 4TY1A 5M56A 4TWOA 3KC3A 4EOPA 2BPMA 2P0CA 4IAFA 4C58A 5HTCA 5KNJA 3FPQA 4A4XA 3COMA 3UG1A 3P4SC 2PUNA 1NEKD 2P33A 4OBOA 4EHGA 1IAHA 4ENYA 4F70A 5KMKA 1J3HA 3P86A 4RJ8A 5IF1A 4C3FA 4FKQA 4Y95A 2YN8A 4RA4A 3EQGA 3KCFA 4CV8A 2PZRA 4EH5A 2QC6A 5CSHA 2UZUE 3OTUA 4CNHA 3RVGA 4L43A 1W82A 4MBIA 2ZOQA 5D10A 4D0WA 3U6JA 2R2PA 1WBSA 2VGPA 3O7LD 2H96A 4OT6A 2A2AA 2PVJA 3BE2A 4OTFA 3S00A 5FEDA 2R5TA 3DXNA 1H26A 4ZP5A 3IW4A 2BFYA 5JMSA 3GGFA 3FXZA 5A4LA 4UV0A 3DB6A 3G9LX 3T9TA 4CMTA 4RFYA 1WBVA 2VTOA 5E8UA 2E9OA 4FV8A 5AAFA 5EKOA 4E4XA 4I94A 2ACZC 3D15A 5K4JA 3AE4D 2WMRA 2UZVA 2XRWA 3GOKA 3UE4A 2OF2A 2W1ZA 3TIYA 4YNOA 4DE4A 2Z8CA 1V0BA 3C4CA 2JFMA 4CFNA 5JSMA 2H34A 3GI3A 4YO4A 3B2WA 2YIWA 3TWJA 5CAOA 4I21A 2IW6A 3PJ2A 4NW5A 4QP3A 1P5EA 4FTCA 3LLTA 3TV7A 3PUPA 2VUWA 4GU9A 3QGYA 3OXTA 4FSMA 3QFVA 2F7XE 2WDQD 4DTAA 4KUJA 4YMJA 4DEEA 4APCA 2GMXA 2ESMA 2YAAA 2BDJA 3SFEC 5CASA 1Q8UA 2PUIA 4O86A 5ANKA 3G6HA 3RK7A 3AE7D 3D7ZA 4ACCA 3F88A 4P5ZA 3W2CA 4BF2A 4KNBA 5IQHA 5I9VA 2W05A 4JRVA 3ATTA 3DBCA 3NX8A 2C6LA 3Q60A 3NAYA 4A9UA 4XV9A 4RLKA 2Z7QA 4FGBA 5ANDA 5C8KA 3GVUA 3GC8A 3SHEA 4ARKA 4IACA 2VTQA 4AXDA 4MHAA 1JSUA 1ATPE 2BILB 3E92A 3S0OA 4GT3A 3F82A 5M06A 3GT8A 1KE6A 1OBGA 3E7OA 3GEQA 3OXIA 3HNGA 1M52A 2R3RA 5KMIA 1YHWA 4M84A 3PSCA 5IA4A 3KF7A 3I5ZA 4YPSA 3NWWA 2NRUA 5AUZA 4FSZA 5J1WA 4QMWA 4UWCA 3FZSA 3ZMMA 5J7HA 5ICPA 3KY2A 3G6GA 1RW8A 2GTMA 3MH1A 4BICA 4IC7A 3WYXA 3N4UA 2UW4A 4TYIA 3PPKA 2HWOA 1Q3DA 4BIBA 3VRAC 4G17A 4DGNA 3Q52A 5EQPA 4YLJA 3TZ9A 2PVFA 1YHVA 2J4ZA 5A54A 5FG8A 4O0TA 3EB0A 5HBJA 3G9NA 1LR4A 4GRBA 5CF6A 1H1QA 3UYTA 3ZEPA 4B8MA 2XNBA 3GUBA 5IH4A 3GCQA 2OICA 3MWUA 4CFVA 3OFMA 4U81A 3V5WA 2WMWA 2QU6A 4I23A 4DEIA 4DH7A 4HPTE 3KMWA 3EH9A 2IZTA 4R3PA 4F64A 1OL1A 3KGAA 5C27A 1Y8YA 5IQDA 3RWPA 3ZBFA 1OL2A 3AGLA 2OBJA 5DVRA 3DOGA 4IH8A 5CEKA 3ORTA 3QD4A 4FL2A 4HGTA 4F7LA 3F61A 5EYCA 4AQCA 2HXQA 3EN9A 4KRCA 2UZNA 3I0OA 4FKPA 4QYFA 3UIMA 4EUTA 1ZZLA 4AXAA 2YDJA 1JAMA 4TXCA 4C61A 4G3FA 3BELA 5DPVA 3NUPA 3VHKA 4KKEA 4FK3A 2BROA 3P4PC 3R9OA 4N4SA 5EM8A 3UZRA 4MXXA 3KVWA 2J7TA 4E5BA 1JLUE 2XNEA 4QEBA 1XH7A 1YXVA 3UIUA 3D94A 3VQHA 3EYHA 5IA5A 3BU5A 2XK9A 2JDTA 3WILA 4D1SA 4X2GA 3I6UA 3E8NA 3ZLXA 1CKJA 1TQMA 4BCHA 3MI9A 4YJRA 2WIHA 2BRHA 3DK7A 3SGCA 2UW0A 4D58A 2QOQA 3NYOA 3KRJA 1M2QA 4IDTA 3F5GA 4O82A 1E7PC 3PIXA 3AEAD 1KFYD 1U46A 3POOA 4FYOA 4XG9A 5KZIA 3H30A 5HCXA 3ZO3A 5J9ZA 4FKIA 5L6PA 4BCJA 1PJKA 4I4FA 1V0PA 5HI2A 1OI9A 3F3WA 4DG2E 2PZPA 4YTPD 1OIQA 2PZYA 4WBBB 2V55A 3TIZA 3UOHA 3WI6A 4EOLA 5HIEA 3DLZA 5DG5A 3RI1A 3DBDA 4DHZA 4XEYA 2XM9A 4Y5QA 1Q5KA 2GPHA 5IH6A 5JH6A 3OP5A 2QOBA 2GFSA 4RWJA 4W4VA 3RALA 3VW8A 3MESA 4O7LA 2XF0A 3R8LA 2X6DA 3O8PA 3DBFA 4R78A 4IHPA 3BLHA 3CPBA 4IQ6A 2G2FA 3PWYA 3GC9A 4MX9A 2ITOA 4GVAA 4TW9A 5HICA 5CENA 5K3YA 5CAVA 2Y0AA 3EL8A 3KU2A 3AE3D 4RX9A 5BVFA 4LUDA 5KCVA 2RF9A 2UZTA 4M8TA 2JDSA 2GS7A 2JDRA 3WF8A 2BTRA 4HYUA 2BHEA 5DRDA 3H0YA 3ULIA 4WNMA 3AD5A 1NVRA 1VYWA 3FE3A 3CR0A 4FV1A 3MW1A 3AKKA 2GS6A 4J8NA 4ANQA 3NYNA 3F2NA 3DCVA 2OXYA 2ITZA 3UGCA 3R7EA 1F5QA 1K2PA 5CSWA 2IWIA 3ORNA 3BBWA 4GFOA 4BDDA 3DNEA 1Q8TA 3VBXA 4QPSA 5IMXA 1FBNA 4J71A 4JMQA 1DAYA 2IN6A 5FEQA 3DNDA 3BI6A 4BCQA 2JC6A 4DLIA 4AXCA 5FXSA 2GNLA 4FVRA 5I9WA 1FMKA 3R7OA 4KS7A 3MFSA 4OBQA 2CSNA 3ZDUA 4DA5A 4AT4A 2CKOA 3AQVA 2UZDA 3HA8A 4O0UA 2QOIA 4DHJA 5HNIX 5DEYA 4RT7A 2W1FA 3QC4A 4CZUA 3RPSA 2JDOA 2YCRA 3C5IA 3RAKA 3SV0A 2R64A 4EZ5A 2QNJA 4XP2A 4QP8A 2H9VA 4RJ4A 3PLAE 1A9UA 2CNVA 3SFDD 2H6DA 2HWPA 3HGKA 3VW6A 3ELJA 3FSFA 2PTKA 3L9NA 2PMOX 1Q24A 2OZAB 3LPBA 4MQ2A 4RJ3A 3KN6A 1YRPA 4E26A 4OTRA 3TI1A 1IEPA 2BKKA 3R2YA 5CAQA 4JAJA 4V04A 1JPAA 1OM1A 1F0QA 1R3CA 3RJCA 4C02A 4CG9A 4CCBA 1EH4A 2R3LA 2WGJA 3HMOA 3UZTA 2HZIA 3OCSA 4GG7A 5LCKA 2B9HA 4O7RA 2RKUA 3KXHA 5J95A 3GQLA 5BVEA 4H39A 3MFUA 2E9NA 4U5JA 2QLQA 2WTCA 1LEWA 4RFZA 3F69A 1ZP0D 3WZUA 3KULB 1AD5A 4WNKA 4LOPA 2PVHA 3NR9A 4BY9E 2YJRA 4CKIA 3C4ZA 1OZ1A 4LMUA 2CNQA 4K6ZA 4LGGA 4M0YA 3TG1A 4C4GA 3BYSA 4OTDA 3NNXA 4IJPA 4M67A 1J7IA 4IZYA 4Y5HA 2VTIA 1U59A 2O5KA 4PDSA 4F6SA 3Q2MA 3ORZA 4XV1A 3S1HA 4KIOA 1ZMUA 4GK4A 3EZVA 4J98A 2R0IA 4TZRA 5BVDA 3A99A 2VZ6A 3ZM4A 2R3PA 5JZJA 2X1NA 3GB2A 4YXDD 4IFGA 4JL9A 4LG4A 3ZSGA 4G6OA 3W0QA 4AP7A 3AEFD 3AEED 2YCQA 3OCBA 5HORA 4MWIA 3HL7A 3R1SA 4UB7A 4JRNA 1OKVA 4U80A 3WIKA 3MFRA 4I6LA 3WYYA 4FL1A 3D5VA 2OK1A 4K18A 4JX7A 3TL8A 1UVRA 3IPHA 4I0RA 3ROYA 5C3JC 4F08A 2F2UA 4PY1A 3ZFMA 5AP4A 4E8AA 2C6IA 2E9UA 1H27A 3FQSA 4YZBA 2WQNA 4NYEA 4I5MA 3AE1C 5FM3A 3MIYA 5ACKA 2VTPA 3GXLA 1IRKA 3R6XA 4MUQA 4U3YA 3H0ZA 2XARA 2C0TA 2HOGA 4LI5A 1XMMA 3II5A 3QUEA 2HY81 5HHWA 4GUEA 5BUEA 2X2LA 2YDIA 3AE2D 4F1MA 1ZYJA 3DQXA 4OUCA 2PU8A 3CJFA 5L8KA 4TYHB 1PXKA 3EKNA 2J5EA 5L2IA 4AN9A 1G5SA 3OEZA 1XMLA 1FQ1B 4XLVA 2P4IA 2YIYA 3PP0A 1HCKA 4ZTHA 3W8QA 3KFAA 4AZEA 3MH2A 2XNMA 1TKIA 2PVRA 3CGFA 4F9CA 4BIEA 1WCCA 5DIAA 4QMQA 5IQIA 5LVNA 5GJGA 3FHRA 3FMMA 4HCUA 2XEZA 4QO9A 5L8LA 2YCFA 4KKGA 4L7SA 2ITXA 3VR9C 4PDOA 4JLCA 1L0VC 3DTCA 5EHOA 5A46A 2V0DA 5HG7A 4Y73A 3P4RC 2C3LA 5FBOA 1Q97A 5HO7A 3QRIA 4QP2A 3Q2JA 4HCTA 3WZJA 2E9PA 3NLBA 2X7OA 1GZOA 4RGJA 2UVXA 2F7EE 1GAGA 2XIKA 5EDRA 3R28A 2Y7JA 3FQHA 4FT9A 4J52A 5AP0A 5KMOA 3TNIA 4NFMA 2R4BA 4C33A 5HNBA 3IW6A 5FTQA 3ENMA 3PTGA 4ACDA 5IQGA 5M08A 2WPAA 2GTNA 4TPTA 4RJ5A 4RX7A 5AV4A 2W1DA 1SM2A 4ASXA 4KRDA 4GMYA 4X2JA 4FEUA 5GHVA 3R1YA 5BVOA 4IM3A 3CXWA 2FBWD 4OW8A 3ATSA 1W84A 4QP4A 2R3HA 3CKWA 4KBAA 4QDVA 5E7RA 3AE8D 1ZOGA 3TKIA 3RHKA 3KCKA 3HMIA 3T8OA 4CFWA 1DM2A 3VR8D 2VO3A 3LFFA 4FTOA 4L3PA 4YHJA 5DWRA 3P5JC 2HZ4A 4X6QC 3Q4ZA 2W1IA 4JOAA 2B7AA 2X9FA 3ZRLA 3A61A 2QOCA 3R7VA 2XJ2A 4A06A 5L2TA 1BMKA 4NL0A 1CM8A 4XG7A 4FT5A 4IDVA 3R04A 1ZOHA 2BDWA 2IZSA 2UW7A 4FKTA 3ODYX 2QOKA 1KF6C 3ANRA 2WTVA 2XIZA 3QC9A 2WDRD 3RMFA 3W0NA 2BZJA 2FA2A 3DAEA 3DV3A 2HELA 3KXNA 3AMBA 2P2HA 3LZBA 3UMXA 3E62A 3JVRA 2QCSA 4G9CA 4TT7A 3SC1A 4IX6A 3AEDC 2EXMA 2YERA 4L01A 4Y83A 4CFUA 5T68A 4D5KA 3G90X 1VJYA 3OCGA 4I4EA 4ZY6A 4ASEA 3VBTA 4RIYA 3RPOA 3KK8A 1UU7A 2XNNA 4IAYA 4TTHB 2XK3A 4AGCA 2PMNX 1NEND 4U9AA 5AM6A 1ZOEA 5CQWA 4HGLA 1DS5A 5G6VA 5C8NA 2E9VA 2YM5A 2XJ0A 3HRCA 2VO7A 3TNWA 4YJNA 5T6KA 3ZONA 4NT4A 3FI4A 3QTQA 4FIEA 4U3ZA 3QRKA 4DFLA 2RFEA 4M15A 3U6IA 3F3ZA 4S30A 2WIPA 3QQUA 5CEIA 3A7HA 3MPTA 4AW2A 3UO5A 4J1RA 2J0MB 3R02A 4BCMA 5LMKC 2C69A 4LUEA 5FEEA 1R0PA 4AFEA 2WB8A 4RIOA 5BPYA 3AE9C 5KUPA 1H1RA 4WG5A 4NTTA 1O9UA 2XNGA 3O96A 4BBMA 5M51A 1B39A 4XOYA 4F78A 5DA3A 5LMBA 2OGVA 3CQUA 3D5XA 4LOOA 2YAKA 1YHSA 5E8VA 4YSYC 2F9GA 3HRFA 4YJQA 3ORPA 4IFCA 2QVSE 3HX4A 4XNEA 5AUYA 3V51A 4AE9A 2C1AA 4P2KA 4UALA 4X3FC 5L8JA 4ACMA 2WQOA 5A14A 4N6YA 3RP9A 4O6LA 4A9RA 5HZNA 5AM7A 3PE2A 3GFEA 3PDTA 2QR8A 3BZ3A 3FMJA 2Z7SA 4O6EA 4P7EA 3EN7A 3PXKA 3G33A 4B99A 4CMUA 3PSBA 3I81A 3M2WA 5AX3A 3W8LA 1GIHA 1J1BA 1VLRA 2C0OA 3T3UA 3F3UA 4FSWA 2OFVA 1YI6A 3MA6A 4G6LA 5A4EA 3HVCA 4CEGA 1KV1A 4NSTA 2Y6MA 5EFQA 4Z9LA 4GW8A 3HZTA 3A4OX 3FBVA 1JOWB 4YP8A 3R0TA 4YTND 4FZDB 2R3JA 3AC8A 5C1QB 3KMUA 2O63A 2XAMA 3BHVA 3JPVA 3FI2A 4YSZD 4A9YA 1OL7A 4AOJA 3FAAA 5DBXA 3L8XA 4QQ5A 2CHLA 2OJGA 2B76D 3NVMB 4IM2A 4W4YA 4B7TA 2WS3C 1PMVA 4L44A 3N4TA 4G3DA 2GQSA 3TDVA 4N70A 4BDKA 2P2IA 4IZAA 4NJDA 4DF3A 2EB2A 4MD9E 1ZMVA 1MRYA 5AMNA 4BDGA 3R2BA 3QXOA 5JKGA 2YHVA 4MBLA 5AIKA 1P2AA 4IX3A 4ZS4A 3PA5A 5L3AA 4E4MA 1H0WA 1UU8A 3FC1X 4QMNA 4J7BA 4HZRA 4XG2A 1QPEA 4O0WA 2XVDA 3W16A 5HG8A 5LVLA 3U9NA 4EUUA 1P4FA 2A4LA 3FZPA 3NW7A 3OEFX 4FL3A 3ZZWA 3LCOA 3AG9A 5F95A 3G51A 4HVIA 5CXZA 2CGUA 2WU5D 2VWIA 3LLAA 4KB8A 4DH1A 1OPKA 3IW8A 4GCJA 3R71A 3W0MA 3MVHA 4D0XA 4ZLZA 5A4TA 4O81A 4PTCA 1LUFA 5CVGA 3Q9XA 5AA9A 1BL6A 3R21A 1Q8YA 1YQJA 2HK5A 2OJIA 4ZLYA 1STCE 3A8XA 4XCUA 4IB0A 2CCHA 3DY7A 4HYIA 4R7IA 4LV7A 3EZRA 3BGQA 3PZEA 4KX6D 3KREA 3OCTA 3R8ZA 5KHXA 4P4CA 1UWHA 4JBPA 4PMTA 4BHNA 2QO9A 2BRBA 4CD0A 3R9DA 2W4OA 5FTOA 1MRUA 3LVPA 3NNVA 4BCIA 5T3QA 5A4CA 2DWBA 2JBPA 3A7JA 3V5TA 2OFUA 5HE1A 5M44A 1Q3WA 2AUHA 1YQ4C 4C4JA 2BAJA 4TKSA 4DH8A 4XV3A 3R9RA 3NS9A 3R30A 2B52A 3I60A 4GK3A 3ZXZA 4TWNA 3OWKA 5FXQA 3C4XA 4J53A 1G8SA 4RLLA 2G01A 4E4LA 3MN3A 4BR3A 3P9JA 4NU1A 1OMWA 2V22A 5CYIA 4YTMC 2C6OA 4FTUA 5IQCA 3CSVA 4M3QA 3E63A 3JY0A 3LFAA 5AP1A 3GNIB 5F4NA 4AGUA 3ZBXA 2C4GA 2ITWA 2WAJA 2YABA 3KL8A 2XBJA 3G2FA 3QQGA 4FKOA 4HYSA 5DI1A 2BMCA 2W0JA 3UC3A 4A4OA 3E8DA 3U54A 1IAJA 1LPUA 3BLRA 1XJDA 3LHJA 3TKUA 4EK8A 4KSQA 1FOTA 2VNWA 3H3CA 3TYKA 5AAEA 3AEBD 5LCJA 3VBYA 3ENHA 3O8UA 5D9HA 2OH4A 4J95A 4AQKA 2HENA 4UY9A 4FV0A 2UZWE 5GJDA 4A9SA 3ODZX 5IUIA 4ITJA 4PMPA 3CEKA 3FKOA 4RJ7A 2NRYA 3DFAA 4AW0A 4DHIB 3UO4A 5DOSA 1UNLA 1IR3A 4AZWA 4L3JA 2X4ZA 5EQYA 3GFWA 2Z60A 5CLPA 5CANA 3BX5A 3LXPA 4FV3A 5EDQA 5KMJA 1VEBA 3A62A 2H88C 3R7IA 3RK9A 4RWKA 4RWIA 3IOPA 4WD5A 2Y6OA 2OIDA 2ZV8A 3OWPA 3TV6A 1W7HA 2ETRA 3GU4A 4AW5A 4DEAA 5CTPA 4EKKA 4F1OA 4QMYA 3MPAA 3RPYA 3LAUA 4EOQA 1JQHA 4UWYA 1WZYA 4EC9A 4EJ7A 2JLDA 3I1AA 2W1EA 4BC6A 1Y91A 2UW3A 2CMWA 3NNUA 2JKKA 1MUOA 3FDNA 4JDJA 3FMNA 4FKUA 5CS6A 3DBEA 1BYGA 3UO6A 2DS1A 4FTJA 5JGBA 3OS3A 4DAWA 1AGWA 4YGAA 3EKKA 3CD8A 4U43A 4V01A 1YQ3D 1QMZA 4MCVA 4M12A 4BI2A 5K5XA 3QZFA 1S9IA 1J7UA 1H24A 4OTGA 3EQIA 3WE8A 3UZPA 2R3OA 1H08A 1I44A 3DKGA 3AGMA 3CE3A 3IKAA 4FIFA 5EM5A 3TTIA 4K0YA 3EQRA 4AT3A 2ZM4A 3EFJA 2X4FA 2OU7A 5CU2A 3VN9A 4YSJA 3MB6A 4ANBA 4DEHA 3UIXA 3EYGA 3I7CA 5HX6A 2HZNA 4PF4A 4ITHA 3V5LA 3BU3A 3F7ZA 3V5QA 2VX1A 4AFJA 3R8MA 4NK9A 5CVFA 5HKMA 3GCPA 4C4EA 5IU2A 5D12A 4DC2A 1R39A 3TXOA 5I4NA 1O6YA 4DG3E 4MNEA 4U97A 4V0GA 4ZS0A 3F2RA 3NCGA 3MTFA 1ZY5A 3QX2A 4IVAA 4CFFA 1ZWSA 4I5PA 2JIVA 2EVAA 2VX3A 1XH8A 2WMQA 4FT0A 1XBAA 2RFDA 1YDRE 4O96A 4D5HA 1M2RA 3CTJA 4AT5A 4ALUA 4F09A 5B2KA 4FNYA 4ERWA 3OWJA 4MTAA 3QQHA 2W1CA 3ZFYA 4L9IA 2UZEA 2ZV9A 4U45A 4YZDA 1OKYA 2G9XA 3P4QC 1Y57A 4QDEA 3HV6A 1FVVA 1SNUA 4EOSA 2GQRA 4EQUA 2VGOA 2CJMA 1H0VA 2YIXA 4XRLA 1XHAA 3NEWA 4R1VA 4UXLA 3ORXA 2WZJA 3MVLA 1DI8A 2BDFA 1YDTE 2X0GA 4AN2A 1TFFA 4B8LA 3FL4A 3ERKA 3MGYA 4IZ7A 3V01A 4Y8DA 3RINA 3E8EA 3H9OA 4FTLA 5HVYA 3SX9A 4RBLA 2W7XA 3DKFA 3VS1A 3MB7A 4FZAB 5BVWA 4MXCA 2ONLA 3V3VA 1OPJA 1FINA 5IZFA 5L2WA 3LFNA 5TF9A 2X7GA 1U5QA 3QBNA 3R63A 5EI2A 5C03A 2J5FA 3GCUA 3HV7A 5JGAA 4G34A 4FX3A 2ZAZA 4JS8A 3KN5A 2CGWA 5ETAA 2C6EA 4GIHA 5IEYA 3S3IA 4QP7A 1Y8GA 4EHVA 4FYNA 2UW5A 4I6BA 2WP9D 4F1TA 1WFCA 3QUPA 2BALA 4FMQA 4LRJA 2IPXA 3WF9A 3AE5C 2JKMA 2XK7A 4OTHA 2ITTA 4JR7A 4KKHA 4AXFA 2W4KA 4S31A 2PVNA 4IVBA 5HBHA 5FLFA 3V04A 2FB8A 1BI7A 5HNGA 1UU3A 3AECC 3CTQA 4GFGA 4PDPA 5ETIA 3PSDA 4DGOA 3RGFA 3OY3A 3G15A 4BI1A 4RFMA 2XKDA 2VTNA 5FUTA 2PMIA 3UTOA 5M07A 2G2IA 3W0RA 5HGIA 2UUEA 3GU6A 4N57A 3VRBC 2WDVC 2V7OA 3AT2A 3IS5A 3KKVA 1MP8A 1PXMA 3QD3A 4L46A 4O22A 4DT9A 4FVQA 4B6LA 3FHIA 3O2MA 4GEOA 2OW3A 2VTHA 2W99B 5AUTA 4I3ZA 4DYMA 4YTIA 4H1JA 4FG9A 3PJ8A 1URWA 1NEKC 2C47A 3PY1A 1WBOA 4FTNA 1UU9A 4BCFA 1YI3A 2IVTA 2KULA 3UJGA 5FXRA 4YT0C 4MNFA 1QL6A 1RJBA 3W1FA 1PXLA 3ZCLA 1FGKA 1G3NA 3W2RA 3HDNA 2BZKB 4O7ZA 4G5PA 3HDMA 4IB3A 5B7VA 4DINA 4ZIMA 3QX4A 4LRKA 3NAXA 3CCNA 4BGGA 4JI9A 4F7JA 4JX3A 5ACBC 4EC8A 5I5ZA 3AEGD 3AE6D 1FPUA 1CDKA 3OXZA 4DDGA 2P3GX 5AV2A 2XK4A 3B2TA 3EOCA 3QTSA 2C6MA 5HVJA 3VS7A 3DLSA 2BS2C 3PFYA 4GH2A 3CC6A 1H28A 2XKFA 5C2TD 3L8PA 3V6SA 1M2PA 3POZA 3VS3A 5CU0A 2WU2D 2XKCA 3BQRA 4JR3A 1TVOA 3VS5A 5IQEA 3FZTA 3BYVA 1GZNA 2B53A 3O17A 3QKMA 4I20A 2O64A 2BFXA 2F4JA 4RZVA 3AE4C 3TJDA 3U4WA 3WZEA 4I0TA 3QKKA 1DI9A 3DQWA 3QTRA 1RDQE 2PUUA 4ONAA 4EQMA 4GUBA 1ZOYD 4G2FA 1JBPE 2ITVA 3L9MA 2JKQA 4FK6A 2WMAA 2OSCA 2WMUA 4FKGA 1NXKA 3L1SA 2H8HA 3BV3A 2XIRA 5I9UA 3S95A 4S2ZA 4XG3A 3UNJA 4E93A 2Y9QA 5E90A 4H05A 1H00A 4WSYA 4USDA 5AUVA 3NYVA 3TMOA 2WXVA 2WTDA 2ZVAA 3UVRA 3PPJA 3NMUF 2GNFA 2A27A 3K5UA 1BUHA 4ZJVA 5HEZA 2CLQA 2QU5A 5IA3A 4Z3VA 3AE7C 3OBJA 4AAAA 2XB7A 5EK7A 5ITAA 1JKSA 1IG1A 1NA7A 4U41A 2H89D 4GKIA 4C35A 4CSVA 3ETAA 3W18A 4NWMA 4L7FA 4E73A 3QWKA 4QNAA 3ANQA 5A6OA 3K3IA 5A4QA 2ZMCA 2UZOA 2XAOA 2E2BA 3P4KA 4LL5A 4A4LA 4G6NA 2FO0A 3PWDA 3QD2B 2CKPA 3Q6WA 3OT8A 4FR4A 4C4IA 1JNKA 4K2RA 4QMTA 5EW8A 2W5BA 4I6FA 2PE0A 3PUFC 3G0FA 5JT2A 3F5XA 2Q83A 5CVHA 5GINE 3NVKI 2WQYD 2PZ5A 1YXSA 3QRTA 3SAYA 3VNTA 2ZMDA 2W1HA 3ZEWA 4C38A 5JQ8A 3GQIA 2XK8A 3UP2A 4UXQA 3MH3A 4D2SA 2GDOA 3TZ8A 1M17A 3U51A 4M13A 4MXZA 1U5RA 4DEDA 5E91A 2FH9A 4FTMA 3G0EA 4UYAA 4WRGA 4EHEA 5E8YA 3PP1A 3PYYA 4H58A 3MBLA 4QOXA 3V8TA 2O8YA 4HNFA 4PL5A 1BI8A 5FP6A 3Q9WA 4TNBA 3PG1A 4EOIA 4DFBA 3UDBA 3LFSA 5H8EA 3IDCA 5BUIA 4CT1A 3O7LB 3QL8A 4O0RA 1Q99A 1L0VD 4FEWA 2GNIA 2C0IA 1XH6A 4EEVA 4MQ1A 2J6MA 5FP5A 3VC4A 4D1XA 4KD1A 3FLQA 2BRNA 2GS2A 2QKWB 3FZOA 3BYOA 3ABVD 3N51A 3P23A 3QZGA 3HAMA 4G3GA 1GJOA 3OC1A 3D5WA 4GSBA 3BWJA 4PP9A 4AS0A 5FDPA 2WQBA 3HMMA 2B55A 3Q32A 4BGHA 4JDHA 3OWLA 3SOAA 2OXDA 2DQ7X 2CPKE 4ZZNA 3TNPC 1WMKA 4FV2A 5ANEA 2BZIB 3NPCA 5TKDA 3FLSA 4N0SA 3UYSA 3F7WA 2YJSA 3LCSA 2VRXA 1JVPP 3EN6A 3LJ0A 4F6WA 5E8WA 3QKLA 5BX0A 3UOLA 3QA8A 4HVSA 2PUPA 4RC3A 3BEAA 1HCLA 4DH5A 2VWUA 2BRMA 3L8VA 3U9CA 4E6CA 4FZ6A 1SVHA 4LOQA 3FMDA 2HIWA 2VAGA 3TUBA 4ANLA 3FSKA 4Q2AA 4JIAA 4TWPA 4XBUA 2X2KA 3D7TB 5H8GA 3EHAA 1QPDA 4FV7A 4EH6A 2XANA 5AP2A 2GCDA 1KOBA 3CD3A 4AZSA 1UKIA 3P5KA 3P79A 3OZ6A 4G3CA 4XJ0A 1YXTA 4C37A 4IVCA 3DKOA 4YJVA 1ZYLA 2QR7A 3AD4A 4BCNA 4MXYA 1VZOA 5H9BA 5EKNA 5IISA 1JKTA 1ERKA 2IVUA 5E1EA 2Q0NA 4UZHA 4FTRA 5AV3A 4YU2A 1OBDA 2C68A 3TT0A 3VQUA 4F7NA 5AAGA 1ZY4A 3QU0A 4J8MA 3EWHA 3ZLSA 4FUXA 4K1BA 4IZ5A 5EDPA 3LQ5A 4ZTNA 2QURA 1CTPE 2PVYA 3QYZA 2ERKA 4AUAA 3EQDA 3MPMA 2WU7A 4BZDA 4CCUA 2X9EA 5I0BA 2OZAA 4YTPC 4QTBA 5EH0A 4YSMA 4BVUA 2UW9A 5M4IA 4BDHA 2G1TA 4QQCA 4UZDA 2JAVA 2XCHA 2PE1A 2BUJA 4TNDA 5CNOA 3NZ0A 2OZOA 3OT3A 3LCDA 4KIPA 5HESA 4YO6A 4CKJA 5FGKA 2I7QA 4RZWA 2XEYA 4WHZA 5L6OA 4YR8A 3PZHA 4GU6A 4FSTA 4RC2A 5CALA 5JEBA 2YFXA 3IECA 3LKMA 3AE3C 4C4HA 4QP1A 4YLLA 3OD6X 1KE9A 4JQEA 2BCJA 3ZFXA 5IPJA 3TTJA 4EORA 2YDKA 5FM2A 4YTHA 3O50A 1YOJA 3BEGA 4NW6A 3IW5A 3E87A 4WG4A 3QZIA 3DS6A 4BB4A 5L2SA 3MH0A 4I5CA 3RTPA 1JSTA 3FXWA 4XOZA 3ZUTA 3OBGA 3QUDA 2PWLA 3FYJX 4USFA 2J0KA 1WBNA 4AZFA 5CAPA 3HKOA 5TT7A 3LFBA 2BHHA 3COHA 3UDTA 2HAKA 3OUKA 3VBWA 3EL7A 4R6VA 5IQFA 3JYAA 3ZC6A 2OJJA 2DYLA 5AP5A 1PKGA 3TZ7A 1L8TA 4CFMA 4BDCA 5J8IA 4YJPA 3ZH8A 2XH5A 3F66A 5AP7A 3SRVA 3QA0A 3QQJA 2C5NA 2HW7A 5IDPA 2HYYA 4D4SA 3AMYA 4FOBA 4DBXA 1QLBC 2REIA 2R7IA 1YI4A 2ITQA 1NY3A 2SRCA 5J1VA 4L52A 4C59A 5K5NA 2ITNA 4GYGA 4KINA 3TKHA 1TQIA 4RX8A 2JDVA 3NRMA 5JZNA 2R3KA 5TO8A 3Q5IA 3CIKA 2I0HA 1G8JA 3SFDC 1W0XC 2X2MA 3C4EA 2PK9A 3DDQA 3IW7A 2Y4IB 3ZSHA 4MYGA 4TYHA 3U55A 3LM5A 4CFXA 2W96B 4BYIA 2WELA 3OW3A 4LRMA 3KRWA 2I0YA 4X3JA 4ALWA 3R22A 4FTKA 3VRZA 4EH9A 2UVZA 3W10A 3KXZA 4WUAA 3RCDA 4DG0E 4ZZOA 4MK0A 4RIYB 2EB3A 4EK6A 4MXAA 5C01A 4PMMA 1H07A 4DDIA 4II5A 1Q8WA 4E6QA 1SZMA 3GCSA 4G16A 1ZP0C 5JRSA 3IGOA 4PMSA 4KSPA 3CIRD 2EUFB 3DAKA 3CQWA 4AW1A 3AXWA 5CF8A 3VS0A 2OJFE 4FKWA 4FKSA 2C5OA 4FTIA 4FSRA 5DR6A 2QO7A 4HYHA 2WTIA 4RIWB 4FSUA 3C51A 4RMZA 4CXAA 2V5QA 4IB1A 5I9XA 3VONA 1W8CA 2XK6A 3LXKA 4GV1A 1AQ1A 2C5YA 2IO6A 2O2UA 3SG9A 2QONA 4IAZA 4W4WA 3A7GA 4GKHA 3W2QA 3WF7A 3NUXA 3TNQB 4PNKA 2YCSA 3ZM9A 4ALVA 4DFNA 4FG8A 3C9WA 2FSMX 4FOCA 5E92A 5K9IA 4U42A 3RCJA 3MY5A 3SKCA 3SQQA 4NKAA 4PDYA 5D41A 3SXRA 3BWFA 3IDPA 3Q96A 3AEFC 3AEEC 3P7CA 3QRJA 1RE8A 4TRLA 2O65A 3ULZA 3FPMA 4PUZA 4YZMA 3QTUA 3M42A 2B9IA 2F57A 3A4PA 4HOKA 4JDIA 4RC4A 4NKSA 2BTSA 4AU8A 5KX8A 2ITUA 3FEGA 1R1WA 4F7SA 5LVPA 4XP3A 2ACXA 4LV5A 3BE9A 4F9YA 5CSXA 2DUVA 2P55A 4FZ7A 3ZYAA 2RIOA 1GY3A 5DH3A 3JXWA 5HCYA 1PXOA 2RL5A 2WNTA 4QQJA 4KBKA 4YJOA 4ZSLA 4F0FA 3RK5A 4QMLA 1K9AA 2XNPA 3BQCA 3AE2C 4OT5A 3UP7A 5B2LA 5M53A 2J0IA 4AOIA 1KE8A 2IVVA 4EONA 5C4KA 2F7ZE 2VTTA 4QMPA 3JVSA 3VS2A 2QHNA 5AEPA 1P4OA 5HIDA 1OL6A 3C0HA 5AA8A 4RVKA 4JG6A 2ZJWA 5DGZA 3BKBA 3UC4A 4JDKA 4XH6A 4H3BA 3IONA 4NJ3A 4ASZA 1PY5A 4ID7A 4K11A 4O7WA 5CEPA 2Q0BA 3ZRMA 4BTMA 5EYMA 3VRYA 3EQHA 3NSZA 5LOHA 4PWNA 4EQCA 4B9DA 4ZXTA 4U8ZA 1GZ8A 5LQFA 4ZTSA 2XIYA 2C6KA 2ZM1A 3D9VA 5AADA 4M14A 1KSWA 2YITA 3PJ1A 2OJ9A 5C9CA 4DGMA 5A9UA 3SW4A 3ZSIA 3NNWA 3P7BA 3ZO2A 4Q5HA 3RZBA 1XWSA 1U54B 3D4QA 4YSXD 2EXCX 2R3FA 3GU5A 4K33A 4TN6A 3ALNA 2WTKC 3KF4A 1NVSA 4X7QA 3QQFA 5LWMA 2YM8A 3R1NA 3C4FA 3HP5A 4O7VA 2OG8A 1P14A 3QCQA 2H88D 4QTAA 3MY1A 1Z5MA 3UVQA 5JGDA 5KMMA 3R73A 3TV4A 3NUUA 1OVEA 3ML1A 2BIYA 2OH0E 3BHHA 4IWQA 3BCEA 5CZIA 3KVXA 3BGZA 3L8SA 4YJUA 4CVAA 3MSSA 4A7CA 5EI6A 2PSQA 4C0TA 5BV3A 2UZBA 3ZUVA 2OF4A 2FBWC 4FJVA 2YA9A 3I79A 3P4SD 4W8DA 2WMXA 2XMYA 4P90A 1OIYA 3AE8C 4BKJA 2ZB1A 2OXXA 1BX6A 5HQ0A 2QHMA 3VR8C 5DE2A 1PRYA 2O0UA 3MY0A 3Q5ZA 4XP0A 4YHFA 4IX4A 4D55A 3NW6A 4FIIA 1JSVA 5CAUA 2ZDTA 3QTIA 1OIUA 2PE2A 3CBLA 4RIXB 3PXZA 4K77A 5IQBA 1ZAOA 3DXQA 3O51A 2GU8A 4KWPA 1Q8ZA 5ANOA 3C4WA 3FC2A 3E3PA 3EN4A 5GNKA 4AACA 2FYSA 4BIDA 5JFXA 4DH3A 3CP9A 4IAIA 4W4XA 1M14A 1WVWA 3RAIA 4EL9A 2WDRC 4O2PA 4RVMA 1CSNA 2B9FA 2J0JA 4ZMEA 4DFXE 5L6WL 1ZYDA 2ACZD 2J51A 4KS8A 4E20A 4X0MA 4EZ7A 4EKLA 4TL0A 2YIQA 2X39A 1PKDA 3OOMA 5IH5A 4FSQA 3QRUA 5E1SA 4J99A 3BL9A 2B0QA 2YWPA 4QYGA 3CJGA 3EIDA 4GS6A 3VJNA 3M1SA 1OGUA 4QT1A 4ACHA 4MBJA 3RHXA 2AYPA 2WKMA 4IAAA 3PXQA 4S32A 4F6UA 2CLXA 3QTXA 4HZSA 1NENC 4JXFA 4DT8A 3DFCB 4XBRA 4XHKB 4DHFA 1UA2A 1FVRA 2C3KA 3FYKX 3K54A 2VWYA 2WQMA 3K3JA 4WA9A 3OVVA 4GG5A 4DCAA 3P78A 3LMGA 2VWVA 1KE7A 3MVMA 4ERKA 4L67A 3SFED 4PTEA 4XG4A 4E5WA 4J96A 1BLXA 1V0OA 2O3PA 3VVHA 2VO6A 4USEA 2B4SB 3BV2A 4IWPA 2PVKA 3UOJA 1WBPA 4U7ZA 4YLKA 3P1AA 4Q9SA 4NZWB 1GZKA 2RFNA 1OB3A 4BTKA 1J7LA 1OPLA 2V7AA 3AC2A 3DA6A 5H8BA 2WTKB 3KB7A 2PULA 3I5NA 4QRCA 2R3IA 3EFLA 3DK3A 3FQEA 2XUUA 3NIEA 3ZLYA 2OWBA 3IK3A 3DB8A 3Q9ZA 2QOLA 5B0XA 5LMKA 4O7SA 4BJJA 3UBDA 3VUMA 5M4UA 2J0LA 4O21A 5A3XA 3CY2A 3PJCA 3P08A 4UYNA 4QTEA 3CPCA 2C6TA 3KRRA 3ZRKA 4X2NA 5BMSA 4X6RA 4EOOA 5CX9A 4IE9A 4FIJA 1ST4A 2BR1A 3BHUA 3TDWA 5A6NA 3TN8A 4X3FA 3R83A 2HZ0A 2CGXA 3HAVA 4QMOA 3VRAD 3AE5D 2IZUA 2VTMA 3CKXA 3JR1A 4QMSA 5HD7A 2Y4PA 2GNGA 2VTLA 4D1ZA 3PFQA 3SLSA 3PG3A 5LJJA 3EQPA 3SW7A 1PW2A 4PQNA 5B2MA 4YTNC 2WO6A 4ZTMA 4CLIA 2J2IB 2XIXA 4WNPA 3AECD 3FMKA 4HNIA 5HLNA 4BCGA 2G15A 4Z7HA 5JFVA 4FUYA 3CS9A 3QAME 5DR2A 4ZTRA 3VBVA 2B76C 1NT2A 5KE0A 4OTQA 4RWLA 3UG2A 1ZARA 4BDAA 1MQ4A 2R3QA 5LWNA 2ERZE 3VRBD 4LM5A 4YBKA 3RNYA 3HUCA 4H3QA 4U0IA 4I6HA 3CY3A 4M0ZA 4APPA 4QYYA 2XCKA 4KIQA 3ITZA 5LVOA 1OKZA 3AC5A 4ZLOA 4FGRA 5CI7A 4EYJA 2RG5A 3V5PA 4ENXA 3QZHA 2VV9A 4WBOA 1IA9A 3HLLA 4NM7A 4DEGA 4YHTA 4UN0C 3TM0A 4WUNA 4YT0D 4YBJA 4B0GA 3P4PD 3PVBA 2FSLX 1GIJA 1O6LA 1QCFA 3DGKA 5HE3A 4LL0A 5CXHA 4CV9A 2J9MA 5AUWA 3UNZA 5I9ZA 3BHTA 2WU5C 4E1ZA 4E7WA 5IA2A 2WOTA 3CTHA 1YW2A 3ZS5A 5HCZA 1H01A 5KO1A 4RQVA 4WO5A 1FGIA 2CN8A 2OO8X 3QLGA 2QLUA 3BHYA 3IG7A 4OGRA 5CU3A 2Z7RA 3TUCA 4HGSA 3MFTA 1ZXEA 3UDZA 4KX6C 4WIHA 1W83A 4CMOA 1CKIA 2PZIA 1M7NA 3L9PA 3JUHA 4MVFA 4ZSGA 4FNZA 3D2KA 4DTBA 4NM0A 1R0EA 4FKVA 2WFYA 1H1WA 2XKEA 2XRUA 5AWMA 5EM6A 4AAYA 3AKJA 5M09A 1FVTA 2W4JA 3W0OA 3IQ7A 4G1WA 4JBVA 4FICA 5CF5A 2JIUA 4HPUE 3FI3A 4L8MA 5EQEA 4XV2A 5FRIA 4LDTA 2X6EA 4PV0A 1OUKA 3VS6A 4N6ZA 4KAOA 5JRQA 3MTLA 5DNRA 4NUSA 1B38A 4EZ3A 3D83A 3B8RA 3LE6A 4GL9A 3V8SA 1KUTA 3PPZA 4G31A 1RQQA 4HW7A 4CG8A 5J9LA 4F63A 5HLWA 3VUGA 5JK3A 4ZEGA 2W1GA 4EWQA 2X8IA 2PY3A 3AEBC 3NCZA 3ORMA 3QGWA 2VTRA 5KKRC 5H3QA 4JG8A 2GHLA 3OUNB 3DK6A 4BBFA 1S9JA 2JIIA 4R3RA 1E9HA 4L42A 2CDZA 3NUYA 4GJ3A 5IMEA 3GC0A 3T3VA 5M4FA 2WEIA 3ORKA 3O23A 3EJ1A 1H1PA 3FKNA 4L00A 5DYJA 3I7BA 3BIZA 4PL3A 1APME 3HP2A 4I24A 4D9UA 3WF6A 4QMXA 3LMIA 4QTCA 4O7YA 3W0SA 3C0IA 5IEXA 2FGIA 3O0GA 3NFFB 5EI8A 3BLQA 2BRGA 5BMMA 4HCVA 1GIIA 4GJ2A 3NFGB 3U8WA 3K5VA 3KXXA 4W8EA 2YM7A 3FWQA 5DLSA 1E1VA 4ZAUA 3BRBA 4BHZA 2ETMA 4I22A 4AGWA 4D4RA 1PXNA 4TWCA 2OIBA 2JFLA 1T46A 5E8ZA 3NIZA 2ZV2A 3PXYA 5IA0A 3SA0A 4Y72A 3VF9A 2EU9A 5IDNA 2ETKA 4WG3A 3TJCA 3RAHA 2WMBA 1YQ3C 3FUPA 3LJ1A 4ZY4A 2OKRA 5GIOE 4J97A 4I1ZA 3ZXTA 2R3GA 3UPZA 4DLJA 5HO8A 3OTVA 1MRVA 3C1XA 4BDBA 3KXMA 3ZO1A 4DITA 3NDMA 3C7QA 4FEXA 4NH1A 1OKWA 3TNHA 2QOFA 3D5UA 3QCSA 2C1BA 2PPQA 3Q04A 4L3LA 2G2HA 2C5XA 3R9NA 3QTWA 3FZ1A 1ZMWA 1H8FA 2JKOA 4EOKA 4QPAA 2UV2A 2XP2A 4B4LA 2WU6A 3FZRA 3QALE 5CZHA 1YOLA 4R7HA 4XS2A 1O6KA 4YTFA 3AT4A 3L9LA 3PE1A 2CN5A 4R77A 3TEIA 2UZLA 1ST0A 2GSFA 5CWZA 4BDEA 4CQEA 1CKPA 1XR1A 2YACA 2HXLA 3PIYA 4QP9A 4R3CA 4RG0A 2YEXA 5HVKA 3AC4A 4YURA 5JFWA 3ACJA 3R1QA 3FLNC 5CSVA 4LMNA 3HV5A 4LGHA 4CTBA 3AC1A 4D9TA 1TQPA 4JQ8A 1OITA 3U87A 4Z55A 4G3EA 4KA3A 4K8AA 5KKRB 2A0CX 4DFZE 3BLAA 5FDXA 3P0MA 5LVMA 2WDQC 2QG7A 4JQ7A 4ASDA 2RFSA 3QXPA 3ID6C 4PRJA 1CMKE 3VUHA 4O0YA 1J91A 5E8SA 4XMOA 2V62A 3M11A 5C3JD 4FSYA 4LV8A 3KEXA 4Y46A 3A8WA 3H10A 1OIRA 5CNNA 3AE1D 4MF1A 3R01A 5IUGA 3WE4A 1L3RE 1ND4A 2NPQA 3TZMA 2YM4A 5AUUA 5FBNC 4RQKA 3W2SA 3EN5A 4YJTA 4IBMA 4UX9A 2CKQA 4IB5A 4C2WA 3W32A 1F3MC 1YOMA 4BTJA 2ITPA 3NYXA 4FNXA 3OW4A 4C2VA 4BDJA 4A07A 3GCVA 1DAWA 4X2FA 3VULA 5D7VA 4FG7A 4IIRA 5HG5A 1QPCA 2I1MA 2YZAA 4JNWA 5AP3A 4DGGA 2X8EA 4PNIA 3UVPA 1HOWA 2WMTA 3HRBA 3SOCA 4UWBA 4C62A 4GFMA 2WHBA 2OI4X 2WP9C 3PRFA 4OR5A 5AFVA 4RSSA 3C50A 3TCPA 2C5VA 2I0VA 1PF8A 3NUNA 4EH8A 3FV8A 1A06A 3O5AA 3QQKA 4EOMA 4PX6A 3VR9D 2X81A 3W0PA 1LEZA 5BVNA 1Y6AA 3AMAA 3RPRA 3P4RD 1YXUA 4RVTA 5D7AA 4AN3A 4M69B 4DN5A 4Q9ZA 4DFUA 2VX0A 3C5UA 5EW9A 3VS4A 4C3RA 3ALOA 4PL4A 1JKLA 2F2CB 2XZSA 3PVUA 2R7BA 4D2RA 1PMEA 1ZYCA 3COKA 2YWVA 3A7IA 4LYNA 4EHZA 4F65A 5CEOA 4RVLA 3KRLA 3LQ3A 2ZYBA 5E9EA 1PXIA 1XBBA 1SVGA 3Q4TA 2PYWA 4IADA 3DZOA 3V6RA 2QQ7A 4JJRA 4EOJA 3ORIA 2AEGA 4P5QA 2W5HA 2IVSA 3AOXA 3DU8A 4IAKA 5CF4A 2VNYA 1KOAA 2BIKB 3EFWA 3QCYA 1W98A 3BYUA 4IWOA 3UIBA 4BCOA 4EK4A 3HECA 3PA3A 4NCTC 4QQTA 2VTSA 4NTSA 4ZOGA 4H3PA 4RPVA 3C13A 2Y8OA 3VUIA 4D4YA 3BYMA 1XQZA 3AT3A 2WTJA 3H9RA 4ITIA 4AWIA 4YC6A 4EYMA 3F9NA 4F9WA 4FTAA 4L53A 5CU4A 4GK2A 2IJMA 3SXSA 1JKKA 3AKLA 3UNKA 3G5DA 4AGDA 1FMOE 3F3TA 3OMVA 4R5SA 1PMNA 4TYJA 2Z2WA 3AE6C 3AEGC 3FY2A 5D1JA 2Y4IC 4FV6A 4ZSJA 5FTGA 5CY3A 4AXEA 1ZYSA 3ZDIA 4JVGA 4DFYA 4EI4A 5EYDA 3RPVA 2IZRA 2WQEA 2FVDA 3MS9A 4FEVA 2WOUA 3ZLWA 1KF6D 5ANIA 4O38A 3VHEA 5C2TC 2HY0A 3SVVA 3O8TA 4FI1A 4XG6A 2WU2C 3WZKA 4UEUA 3AEAC 1KFYC 3DJ5A 3R7UA 4QYHA 3MIAA 1I09A 4YC3A 4BBEA 3MDYA 5J9YA 3BBTB 3NUAA
chains in the Genus database with same CATH topology
4F0GA 2R3NA 4S33A 4PP7A 2YIRA 4BDFA 1KE5A 1VYZA 3FXXA 3LFCA 4EJNA 3HV3A 3UOKA 2C3JA 2CNUA 2ZFYA 3LJ2A 3PJ3A 3T9IA 4O27B 4ANSA 5HE2A 3AC3A 2VTJA 1YDSE 3RNIA 5M57A 3ET7A 2HW6A 4I0SA 1OECA 3PY3A 2XALA 3WBLA 2OLCA 3DBQA 4IJ9A 5DN3A 5EOBA 3W2OA 1UNGA 4MD8E 3R00A 3RM6A 4CZTA 2QOHA 3Q53A 3KIOC 3V5JA 2B54A 3KULA 4F0IA 3LXNA 5KZ0A 4CGAA 4ZTQA 1SNXA 1OUYA 2IG7A 3K2LA 2BKZA 2LGCA 2QD9A 4FT7A 4O0XA 4QP6A 3SRVB 4LFIA 4FNWA 3GU7A 4BCPA 2W9ZB 1A48A 4NM3A 4YZ9A 2GFCA 1WBTA 4QMUA 3D7TA 4I92A 5BYLA 3WZDA 4I5HA 3OG7A 4OTWA 3SDJA 3EMGA 4AE6A 4FA2A 1PXJA 3ZUUA 3ZHPC 4F99A 1XH4A 1V1KA 4ZZMA 2PVMA 2XJ1A 3LFQA 3F5PA 3OY1A 4F9AA 4WOVA 3QHRA 5ETFA 4L6QA 4RJ6A 4D28A 3R8UA 1Q61A 4AF3A 5LXMA 3SXFA 5F20A 2Z02A 3PA4A 5LARA 3BPRA 3ACKA 3W33A 5TOZA 2GQGA 4WT6A 4IC8A 4CLJA 1MQBA 4GT5A 1H1SA 5DFPA 3FLYA 3KA0A 5KHWA 5C8MA 5CQUA 4FSNA 2IW8A 5E4HA 4GYIA 3NW5A 2VWBA 4EK5A 3LW0A 1REJA 2XBAA 4IANA 3WF5A 3WIGA 3D0EA 4DEBA 2ZDUA 3REPA 5F9EA 2JEDA 3D14A 1E1XA 4ZSEA 2YM6A 2VTAA 5BQ0A 4BTFA 1B6CB 3MV5A 4FIGA 3P7AA 4X2KA 4Y85A 2WMSA 1PYXA 2GNHA 4MEDA 5E8TA 3RM7A 3RKBA 4FV4A 1R78A 3E8CA 4M97A 4EH2A 4AZTA 4FTQA 4JG7A 3EFKA 4XX9A 3HEGA 3OOGA 4C34A 3N9XA 2B9JA 4FEQA 4QNYA 3H9FA 5AJQA 4RRVA 4ACGA 2FSOX 4IEBA 4KABA 4H1MA 5KBQA 3UQCA 1SVEA 3FJQE 4FTTA 3KXGA 3UQGA 1M7QA 2PMLX 3PRIA 3MA3A 2VU3A 3IOKA 3PXRA 4O91A 4QMMA 5CI6A 3FLZA 5EG3A 2UVYA 5BVKA 3R7YA 4BZNA 4L45A 3LQ8A 4YPDA 4FKLA 4RX5A 5F94A 4BI0A 2W5AA 4GIIA 4L68A 4MXOA 5CEMA 3N4VA 4NIFB 1UWJA 4IX5A 3R9HA 5IG1A 2LAVA 3S2PA 2Z7LA 2XM8A 4XUFA 4HVHA 1BL7A 4LQMA 1Q62A 1KV2A 2I40A 4JT3A 3ORLA 3ZTXA 3NUSA 3Q3BA 1U4DA 4I6QA 2PHKA 4AOTA 3SG8A 3GOPA 3VUKA 5EW3A 2WTWA 2B1PA 3OHTA 5AUXA 5DT4A 2W9FB 4NCTA 5CT7A 1WAKA 3PVWA 4D4VA 1OGYA 5CU6A 1Z9XA 4CT2A 3KMMA 4MH7A 4AX8A 1H4LA 1Z57A 4F9BA 3FI8A 5JN2A 3HUBA 2WEVA 3RAWA 1UV5A 3BGPA 3VWAA 5J87A 3NGAA 1H25A 1KWPA 4MKCA 2NO3A 2I0EA 1YWRA 4FZFB 3DJ7A 1J1CA 2BVAA 4TYGA 2JGZA 3LXLA 3W2PA 4FKJA 4WNOA 4E6DA 1G8KA 3E5AA 1ZZ2A 5JQ5A 3A7FA 4CKRA 3S4QA 5HBEA 4E4NA 3KK9A 5DR9A 5C4LA 4Z16A 3EQCA 3FMLA 4OTIA 1URCA 3EQBA 3QWJA 5DEWA 1XH9A 4IM0A 3A2CA 4U79A 3EQFA 4MD7E 4K9YA 4ZTLA 3GP0A 2VWWA 2X7FA 3THBA 4DTKA 3PXFA 5TR6A 4HVGA 1XKKA 3MVJA 3Q6UA 3HMPA 4HGEA 3W55A 4C4FA 3Q4CA 2PVLA 3FMEA 5AX9A 3UODA 2JBOA 4PTGA 2R3MA 5EM7A 3R8PA 4KBCA 4FV5A 1SMHA 4RIWA 3OF0A 2WMVA 3MJ1A 4DBNA 1WVXA 4FV9A 5EHLA 3WARA 4AA0A 2YM3A 2FSTX 3UQFA 4FKRA 4M7IA 3BL7A 4O0VA 5DT0A 3E7VA 3ZZEA 1QPJA 4JBOA 2QOOA 1VR2A 2YISA 4NFNA 5IEVA 3CGOA 1XO2B 4ORKA 4S34A 2W17A 4YC8A 1YXXA 3F2AA 3O71A 3LMHA 3QD0A 4BCKA 4C36A 3QHWA 5CSPA 4AA4A 2ITYA 2RGPA 3DXPA 3MYGA 5DRBA 4EK3A 2HCKA 1PMUA 2CGVA 3DT1A 3Q9YA 2R0UA 3LM0A 3C0GA 3LOKA 4QMVA 5ANJA 4ZJJA 4EH3A 5HD4A 5BYZA 4UBAA 3E88A 4FVPA 4CTCA 4ZJIA 4R1YA 4XYFA 3F5UA 5E8XA 5D11A 1Q41A 2IW9A 1NVQA 5EYKA 4G9RA 1BKXA 4OLIA 4XRJA 5M55A 1UKHA 2AC3A 3QF9A 4I93A 4FBXA 4FT3A 4H36A 3UDSA 3ZC5A 5K4IA 1WVYA 4BN1A 3QTZA 4TYEA 2ZB0A 4GVJA 1PXPA 3ZU7A 3DAJA 5HX8A 5EHYA 3FKLA 1K3AA 2F49A 3GENA 3LCKA 4R5YA 2XA4A 4YNEA 2J50A 2I6LA 5ANGA 5HTBA 4I41A 5HLPA 3SD0A 2X8DA 2RG6A 3Q4UA 2JITA 5DT3A 2VD5A 4ZMFA 1PHKA 3IDBA 4U44A 3LCTA 2JAMA 2CCIA 3LFDA 4O7NA 2KTYA 4Q5EA 4ZY5A 4YJSA 2A1AB 3B8QA 4U40A 5C26A 4QMZA 4BGQA 2VWZA 4MAOA 1Y6BA 2GNJA 5AV1A 3KRXA 3HMNA 3DPKA 5F1ZA 5FQDC 3RWQA 3UMWA 1REKA 3A60A 5EOLA 2NYAA 4BYJA 5BYYA 3U4UA 3I4BA 5FD2A 2QO2A 2NNWB 2VN9A 3CQEA 3GU8A 3VJOA 1YVJA 4WKQA 4IVDA 4MWHA 4G5JA 5GIPE 4JIKA 1IASA 4ZSAA 3VAPA 2UW8A 3H4JA 3JS2A 3COIA 3IO7A 1OL5A 4E5AX 4ZK5A 3E3BX 3JY9A 4IW0A 4XLIA 1U54A 1XH5A 3QQLA 1G8AA 3DDPA 5J5SA 5AV0A 5GJFA 3MJ2A 4BDIA 3IGGA 3FLWA 2AC5A 3F3VA 1GNGA 4DGLC 4CRLA 3ZO4A 2C6DA 4F4PA 3DTWA 4FE2A 2XNOA 3U6HA 4M68A 3VF8A 1Q4LA 1GOLA 4RA5A 4FC0A 5M4CA 2GHMA 4IWDA 2XYNA 4EH7A 4QTDA 5DHJA 4FODA 4BJJB 4EBWA 4HJOA 5BUJA 3HYHA 5KMNA 1ZLTA 3TACA 1SYKA 4HVDA 2JD5A 4XG8A 3I0QA 1NW1A 2CKEA 3FL5A 3PVGA 4EBVA 3PY0A 4AZVA 3AD6A 4BRXA 1ZRZA 5JFSA 3E93A 3PLSA 2UW6A 4YUQA 4X3FB 1XBCA 2W06A 4CRSA 2ONLC 3LFEA 3ZOSA 4YZNA 3VIDA 2QG5A 4NM5A 4R7BA 5ETCA 3LIJA 4WRSA 3FMHA 3I6WA 4JAIA 4RIXA 4C7TA 3GC7A 2ZM3A 3OROA 3ROCA 2J90A 4A9TA 4BZOA 2NP8A 4IMYA 4O7TA 2WD1A 2PL0A 4GT4A 3BU6A 3FY0A 4ANMA 2EWAA 2GHGA 4E6AA 3DKCA 4JBQA 3VBQA 2R9SA 3HA6A 3V8WA 5IUHA 4O0SA 1UNHA 4X21A 2XS0A 4EWHA 2VWXA 3UPXA 4O84A 3QLFA 3E64A 5AP6A 1IA8A 5HU3A 4C3PA 1YKRA 1WBWA 5CT0A 3QYWA 5KBRA 2BAKA 3DZQA 2ZV7A 2QKRA 1YWVA 3PIZA 5IQAA 3R8VA 3WOWA 3F6XA 4AG8A 3CLYA 4V05A 5HE0A 4O2ZA 5BNJA 5HIBA 5IA1A 2VO0A 5HU9A 4O83A 2BAQA 2BZHB 4FIHA 4EH4A 5H2UA 1JWHA 5I9YA 1X8BA 1YWNA 3QCXA 1T45A 3HV4A 5G1XA 1LP4A 5HG9A 3VO3A 4AA5A 3TUDA 4DCEA 4Z7GA 2A19B 3DJ6A 3GBZA 4YTCA 2C3IB 5LMAA 3VUDA 2C30A 5KMLA 4U6RA 4YZCA 4MNEB 2QI8A 3KQ7A 2XYUA 4V0GB 3D2IA 2YZLA 2OIQA 5AIRA 2FUMA 2QODA 5CEQA 4OBPA 1PYEA 4TY1A 5M56A 4TWOA 3KC3A 4EOPA 2BPMA 2P0CA 4IAFA 4C58A 5HTCA 5KNJA 3FPQA 4A4XA 3COMA 3UG1A 2PUNA 2P33A 4OBOA 4EHGA 1IAHA 4ENYA 4F70A 5KMKA 1J3HA 3P86A 4RJ8A 5IF1A 4C3FA 4FKQA 4Y95A 2YN8A 4RA4A 3EQGA 3KCFA 4CV8A 2PZRA 4EH5A 2QC6A 5CSHA 2UZUE 3OTUA 4CNHA 3RVGA 4L43A 1W82A 4MBIA 2ZOQA 5D10A 4D0WA 3U6JA 2R2PA 1WBSA 2VGPA 3O7LD 2H96A 4OT6A 2A2AA 2PVJA 3BE2A 4OTFA 3S00A 5FEDA 2R5TA 3DXNA 1H26A 4ZP5A 3IW4A 2BFYA 5JMSA 3GGFA 3FXZA 5A4LA 4UV0A 3DB6A 3G9LX 3T9TA 4CMTA 4RFYA 1WBVA 2VTOA 5E8UA 2E9OA 4FV8A 5AAFA 5EKOA 4E4XA 4I94A 3D15A 5K4JA 2WMRA 2UZVA 2XRWA 3GOKA 3UE4A 2OF2A 2W1ZA 3TIYA 4YNOA 4DE4A 2Z8CA 1V0BA 3C4CA 2JFMA 4CFNA 5JSMA 2H34A 3GI3A 4YO4A 3B2WA 2YIWA 3TWJA 5CAOA 4I21A 2IW6A 3PJ2A 4NW5A 4QP3A 1P5EA 4FTCA 3LLTA 3TV7A 3PUPA 2VUWA 4GU9A 3QGYA 3OXTA 4FSMA 3QFVA 2F7XE 4DTAA 4KUJA 4YMJA 4DEEA 4APCA 2GMXA 2ESMA 2YAAA 2BDJA 5CASA 1Q8UA 2PUIA 4O86A 5ANKA 3G6HA 3RK7A 3D7ZA 4ACCA 3F88A 4P5ZA 3W2CA 4BF2A 4KNBA 5IQHA 5I9VA 2W05A 4JRVA 3ATTA 3DBCA 3NX8A 2C6LA 3Q60A 3NAYA 4A9UA 4XV9A 4RLKA 2Z7QA 4FGBA 5ANDA 5C8KA 3GVUA 3GC8A 3SHEA 4ARKA 4IACA 2VTQA 4AXDA 4MHAA 1JSUA 1ATPE 2BILB 3E92A 3S0OA 4GT3A 3F82A 5M06A 3GT8A 1KE6A 1OBGA 3E7OA 3GEQA 3OXIA 3HNGA 1M52A 2R3RA 5KMIA 1YHWA 4M84A 3PSCA 5IA4A 3KF7A 3I5ZA 4YPSA 3NWWA 2NRUA 5AUZA 4FSZA 5J1WA 4QMWA 4UWCA 3FZSA 3ZMMA 5J7HA 5ICPA 3KY2A 3G6GA 1RW8A 2GTMA 3MH1A 4BICA 4IC7A 3WYXA 3N4UA 2UW4A 4TYIA 3PPKA 2HWOA 1Q3DA 4BIBA 4G17A 4DGNA 3Q52A 5EQPA 4YLJA 3TZ9A 2PVFA 1YHVA 2J4ZA 5A54A 5FG8A 4O0TA 3EB0A 5HBJA 3G9NA 1LR4A 4GRBA 5CF6A 1H1QA 3UYTA 3ZEPA 4B8MA 2XNBA 3GUBA 5IH4A 3GCQA 2OICA 3MWUA 4CFVA 3OFMA 4U81A 3V5WA 2WMWA 2QU6A 4I23A 4DEIA 4DH7A 4HPTE 3KMWA 3EH9A 2IZTA 4R3PA 4F64A 1OL1A 3KGAA 5C27A 1Y8YA 5IQDA 3RWPA 3ZBFA 1OL2A 3AGLA 2OBJA 5DVRA 3DOGA 4IH8A 5CEKA 3ORTA 3QD4A 4FL2A 4HGTA 4F7LA 3F61A 5EYCA 4AQCA 2HXQA 3EN9A 4KRCA 2UZNA 3I0OA 4FKPA 4QYFA 3UIMA 4EUTA 1ZZLA 4AXAA 2YDJA 1JAMA 4TXCA 4C61A 4G3FA 3BELA 5DPVA 3NUPA 3VHKA 4KKEA 4FK3A 2BROA 3R9OA 4N4SA 5EM8A 3UZRA 4MXXA 3KVWA 2J7TA 4E5BA 1JLUE 2XNEA 4QEBA 1XH7A 1YXVA 3UIUA 3D94A 3VQHA 3EYHA 5IA5A 3BU5A 2XK9A 2JDTA 3WILA 4D1SA 4X2GA 3I6UA 3E8NA 3ZLXA 1CKJA 1TQMA 4BCHA 3MI9A 4YJRA 2WIHA 2BRHA 3DK7A 3SGCA 2UW0A 4D58A 2QOQA 3NYOA 3KRJA 1M2QA 4IDTA 3F5GA 4O82A 3PIXA 3POOA 1U46A 4FYOA 5KZIA 4XG9A 3H30A 5HCXA 3ZO3A 5J9ZA 4FKIA 5L6PA 4BCJA 1PJKA 4I4FA 1V0PA 5HI2A 1OI9A 3F3WA 4DG2E 2PZPA 3UOHA 1OIQA 2PZYA 4WBBB 2V55A 3TIZA 3WI6A 4EOLA 5HIEA 3DLZA 5DG5A 3RI1A 3DBDA 4DHZA 4XEYA 2XM9A 4Y5QA 1Q5KA 2GPHA 5IH6A 5JH6A 3OP5A 2QOBA 2GFSA 4RWJA 4W4VA 3RALA 3VW8A 3MESA 4O7LA 2XF0A 3R8LA 2X6DA 3O8PA 3DBFA 4R78A 4IHPA 3BLHA 3CPBA 4IQ6A 2G2FA 3PWYA 3GC9A 4MX9A 2ITOA 4GVAA 4TW9A 5HICA 5CENA 5K3YA 5CAVA 2Y0AA 3EL8A 3KU2A 4RX9A 5BVFA 4LUDA 5KCVA 2RF9A 2UZTA 4M8TA 2JDSA 2GS7A 2JDRA 3WF8A 2BTRA 4HYUA 2BHEA 5DRDA 3H0YA 3ULIA 4WNMA 3AD5A 1NVRA 1VYWA 3FE3A 3CR0A 4FV1A 3MW1A 3AKKA 2GS6A 4J8NA 4ANQA 3NYNA 3F2NA 3DCVA 2OXYA 2ITZA 3UGCA 3R7EA 1F5QA 1K2PA 5CSWA 2IWIA 3ORNA 3BBWA 4GFOA 4BDDA 3DNEA 1Q8TA 3VBXA 4QPSA 5IMXA 1FBNA 4J71A 4JMQA 1DAYA 2IN6A 5FEQA 3DNDA 3BI6A 2JC6A 4DLIA 4AXCA 5FXSA 2GNLA 4FVRA 5I9WA 1FMKA 3R7OA 4KS7A 3MFSA 4OBQA 2CSNA 3ZDUA 4DA5A 4AT4A 2CKOA 3AQVA 2UZDA 3HA8A 4O0UA 2QOIA 4DHJA 5HNIX 5DEYA 4RT7A 2W1FA 3QC4A 4CZUA 3RPSA 2JDOA 2YCRA 3C5IA 3RAKA 3SV0A 2R64A 4EZ5A 2QNJA 4XP2A 4QP8A 2H9VA 4RJ4A 3PLAE 1A9UA 2CNVA 2H6DA 2HWPA 3HGKA 3VW6A 3ELJA 3FSFA 2PTKA 3L9NA 2PMOX 1Q24A 2OZAB 3LPBA 4MQ2A 4RJ3A 3KN6A 1YRPA 4E26A 4OTRA 3TI1A 1IEPA 2BKKA 3R2YA 5CAQA 4JAJA 4V04A 1JPAA 1OM1A 1F0QA 1R3CA 3RJCA 4C02A 4CG9A 4CCBA 1EH4A 2R3LA 2WGJA 3HMOA 3UZTA 2HZIA 3OCSA 4GG7A 5LCKA 2B9HA 4O7RA 2RKUA 3KXHA 5J95A 3GQLA 5BVEA 4H39A 3MFUA 2E9NA 4U5JA 2QLQA 2WTCA 1LEWA 4RFZA 3F69A 3WZUA 3KULB 1AD5A 4WNKA 4LOPA 2PVHA 3NR9A 4BY9E 2YJRA 4CKIA 3C4ZA 1OZ1A 4LMUA 2CNQA 4K6ZA 4LGGA 4M0YA 3TG1A 4C4GA 3BYSA 4OTDA 3NNXA 4IJPA 4M67A 1J7IA 4IZYA 4Y5HA 2VTIA 1U59A 2O5KA 4PDSA 4F6SA 3Q2MA 3ORZA 4XV1A 3S1HA 4KIOA 1ZMUA 4GK4A 3EZVA 4J98A 2R0IA 4TZRA 5BVDA 3A99A 2VZ6A 3ZM4A 2R3PA 5JZJA 2X1NA 3GB2A 4IFGA 4JL9A 4LG4A 3ZSGA 4G6OA 3W0QA 4AP7A 2YCQA 3OCBA 5HORA 4MWIA 3HL7A 3R1SA 4UB7A 4JRNA 1OKVA 4U80A 3WIKA 3MFRA 4I6LA 3WYYA 4FL1A 3D5VA 2OK1A 4K18A 4JX7A 3TL8A 1UVRA 3IPHA 4I0RA 3ROYA 4F08A 2F2UA 4PY1A 3ZFMA 5AP4A 4E8AA 2C6IA 2E9UA 1H27A 3FQSA 4YZBA 2WQNA 4NYEA 4I5MA 5FM3A 5ACKA 3MIYA 2VTPA 3GXLA 1IRKA 3R6XA 4MUQA 4U3YA 3H0ZA 2XARA 2C0TA 2HOGA 4LI5A 1XMMA 3II5A 3QUEA 2HY81 5HHWA 4GUEA 5BUEA 2X2LA 2YDIA 4F1MA 1ZYJA 3DQXA 4OUCA 2PU8A 3CJFA 5L8KA 4TYHB 1PXKA 3EKNA 2J5EA 5L2IA 4AN9A 1G5SA 3OEZA 1XMLA 1FQ1B 4XLVA 2P4IA 2YIYA 3PP0A 1HCKA 4ZTHA 3W8QA 3KFAA 4AZEA 3MH2A 2XNMA 1TKIA 2PVRA 3CGFA 4F9CA 4BIEA 1WCCA 5DIAA 4QMQA 5IQIA 5LVNA 5GJGA 3FHRA 3FMMA 4HCUA 2XEZA 4QO9A 5L8LA 2YCFA 4KKGA 4L7SA 2ITXA 4PDOA 4JLCA 3DTCA 5EHOA 5A46A 2V0DA 5HG7A 4Y73A 2C3LA 5FBOA 1Q97A 5HO7A 3QRIA 4QP2A 3Q2JA 4HCTA 3WZJA 2E9PA 3NLBA 2X7OA 1GZOA 4RGJA 2UVXA 2F7EE 1GAGA 2XIKA 5EDRA 3R28A 2Y7JA 3FQHA 4FT9A 4J52A 5AP0A 5KMOA 3TNIA 4NFMA 2R4BA 4C33A 5HNBA 3IW6A 5FTQA 3ENMA 3PTGA 4ACDA 5IQGA 5M08A 2WPAA 2GTNA 4TPTA 4RJ5A 4RX7A 5AV4A 2W1DA 1SM2A 4ASXA 4KRDA 4GMYA 4X2JA 4FEUA 5GHVA 3R1YA 5BVOA 4IM3A 3CXWA 4OW8A 3ATSA 1W84A 4QP4A 2R3HA 3CKWA 4KBAA 4QDVA 5E7RA 1ZOGA 3TKIA 3RHKA 3KCKA 3HMIA 3T8OA 4CFWA 1DM2A 2VO3A 3LFFA 4FTOA 4L3PA 4YHJA 5DWRA 3P5JC 2HZ4A 4X6QC 3Q4ZA 2W1IA 4JOAA 2B7AA 2X9FA 3ZRLA 3A61A 2QOCA 3R7VA 2XJ2A 4A06A 5L2TA 1BMKA 4NL0A 1CM8A 4XG7A 4FT5A 4IDVA 3R04A 1ZOHA 2BDWA 2IZSA 2UW7A 4FKTA 3ODYX 2QOKA 3ANRA 2WTVA 2XIZA 3QC9A 3RMFA 3W0NA 2BZJA 2FA2A 3DAEA 3DV3A 2HELA 3KXNA 3AMBA 2P2HA 3LZBA 3UMXA 3E62A 3JVRA 2QCSA 4G9CA 4TT7A 3SC1A 4IX6A 2EXMA 2YERA 4L01A 4Y83A 4CFUA 5T68A 4D5KA 3G90X 1VJYA 3OCGA 4I4EA 4ZY6A 4ASEA 3VBTA 4RIYA 3RPOA 3KK8A 1UU7A 2XNNA 4IAYA 4TTHB 2XK3A 4AGCA 2PMNX 4U9AA 5AM6A 1ZOEA 5CQWA 4HGLA 1DS5A 5G6VA 5C8NA 2E9VA 2YM5A 2XJ0A 3HRCA 2VO7A 3TNWA 4YJNA 5T6KA 3ZONA 4NT4A 3FI4A 3QTQA 4FIEA 4U3ZA 3QRKA 4DFLA 2RFEA 4M15A 3U6IA 3F3ZA 4S30A 2WIPA 3QQUA 5CEIA 3A7HA 3MPTA 4AW2A 3UO5A 4J1RA 2J0MB 3R02A 4BCMA 5LMKC 2C69A 4LUEA 5FEEA 1R0PA 4AFEA 2WB8A 4RIOA 5BPYA 5KUPA 1H1RA 4WG5A 4NTTA 1O9UA 2XNGA 3O96A 4BBMA 5M51A 1B39A 4XOYA 4F78A 5DA3A 5LMBA 2OGVA 3CQUA 3D5XA 4LOOA 2YAKA 1YHSA 5E8VA 2F9GA 4YJQA 3HRFA 3ORPA 4IFCA 2QVSE 3HX4A 4XNEA 5AUYA 3V51A 4AE9A 2C1AA 4P2KA 4UALA 4X3FC 5L8JA 4ACMA 2WQOA 5A14A 4N6YA 3RP9A 4O6LA 4A9RA 5HZNA 5AM7A 3PE2A 3GFEA 3PDTA 2QR8A 3BZ3A 3FMJA 2Z7SA 4O6EA 4P7EA 3EN7A 3PXKA 3G33A 4B99A 4CMUA 3PSBA 3I81A 3M2WA 5AX3A 3W8LA 1GIHA 1J1BA 1VLRA 2C0OA 3T3UA 3F3UA 4FSWA 2OFVA 1YI6A 3MA6A 4G6LA 5A4EA 3HVCA 4CEGA 1KV1A 4NSTA 2Y6MA 5EFQA 4Z9LA 4GW8A 3HZTA 3A4OX 3FBVA 1JOWB 4YP8A 3R0TA 4FZDB 2R3JA 3AC8A 5C1QB 3KMUA 2O63A 2XAMA 3BHVA 3JPVA 3FI2A 4A9YA 1OL7A 4AOJA 3FAAA 5DBXA 3L8XA 4QQ5A 2CHLA 2OJGA 3NVMB 4IM2A 4W4YA 4BCQA 4B7TA 4L44A 1PMVA 3N4TA 4G3DA 2GQSA 3TDVA 4N70A 4BDKA 2P2IA 4IZAA 4NJDA 4DF3A 2EB2A 4MD9E 1ZMVA 1MRYA 5AMNA 4BDGA 3R2BA 3QXOA 5JKGA 2YHVA 4MBLA 5AIKA 1P2AA 4IX3A 4ZS4A 3PA5A 5L3AA 4E4MA 1H0WA 1UU8A 3FC1X 4QMNA 4J7BA 4HZRA 4XG2A 1QPEA 4O0WA 2XVDA 3W16A 5HG8A 5LVLA 3U9NA 4EUUA 1P4FA 2A4LA 3FZPA 3NW7A 3OEFX 4FL3A 3ZZWA 3LCOA 3AG9A 5F95A 3G51A 4HVIA 5CXZA 2CGUA 4DH1A 2VWIA 3LLAA 4KB8A 1OPKA 3IW8A 4GCJA 3R71A 3W0MA 3MVHA 4D0XA 4ZLZA 5A4TA 4O81A 4PTCA 1LUFA 5CVGA 3Q9XA 5AA9A 1BL6A 3R21A 1Q8YA 1YQJA 2HK5A 2OJIA 4ZLYA 1STCE 3A8XA 4XCUA 4IB0A 2CCHA 3DY7A 4HYIA 4R7IA 4LV7A 3EZRA 3BGQA 3PZEA 3KREA 3OCTA 3R8ZA 5KHXA 4P4CA 1UWHA 4JBPA 4PMTA 4BHNA 2QO9A 2BRBA 4CD0A 3R9DA 2W4OA 5FTOA 1MRUA 3LVPA 3NNVA 4BCIA 5T3QA 5A4CA 2DWBA 2JBPA 3A7JA 3V5TA 2OFUA 5HE1A 5M44A 1Q3WA 2AUHA 4C4JA 2BAJA 4TKSA 4DH8A 4XV3A 3R9RA 3NS9A 3R30A 2B52A 3I60A 4GK3A 3ZXZA 4TWNA 3OWKA 5FXQA 3C4XA 4J53A 1G8SA 4RLLA 2G01A 4E4LA 3MN3A 4BR3A 3P9JA 4NU1A 1OMWA 2V22A 5CYIA 2C6OA 4FTUA 5IQCA 3CSVA 4M3QA 3E63A 3JY0A 3LFAA 5AP1A 3GNIB 5F4NA 4AGUA 3ZBXA 2C4GA 2ITWA 2WAJA 2YABA 3KL8A 2XBJA 3G2FA 3QQGA 4FKOA 4HYSA 5DI1A 2BMCA 2W0JA 3UC3A 4A4OA 3E8DA<