3AEFC

Crystal structure of porcine heart mitochondrial complex ii with an empty quinone-binding pocket
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of porcine heart mitochondrial complex II with an empty quinone-binding pocket
rcsb
molecule tags Oxidoreductase
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
total genus 50
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3aefC01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3aefC02
3P4SC 3AE7D 5C3JD 3AE6C 1OW7A 3AE6D 3P4RC 3AE2C 4YTMC 3AECC 3AEFD 3SFDC 3VRAC 1YQ4D 3AE5D 1K04A 2WU5D 3P4RD 2WQYD 2WS3C 4YTMD 1KFYD 4YXDC 3P4QC 1L0VC 4YT0C 3AE8C 3VR8D 3VRBD 2G3AA 3AE8D 3VR8C 3VRBC 1QLBC 1ZP0D 2WP9D 4YSXC 2WS3D 3AE4D 2H88C 4YSZC 2WU2D 1L0VD 4YT0D 4YTND 1ZOYD 1ZOYC 5C2TC 3AEAD 3ABVC 3AEEC 1ZP0C 2ACZD 2WP9C 2BS2C 4KX6C 3VR9D 3AEDC 3VR9C 1OW8A 2WDVC 4YTPD 3AE1D 2FBWD 3AE2D 4YTPC 1E7PC 3ABVD 1NEKC 3P4SD 3CIRC 3AE3D 3AE7C 3VRAD 1KF6C 1KF6D 2WDQC 3SFED 2WU5C 1YQ3C 2WDVD 4YSYD 3SFEC 3P4PC 4YSYC 2FBWC 3AEFC 1NEKD 3S9OA 3CIRD 1PV3A 5C3JC 2WQYC 1KFYC 3P4PD 3P4QD 1NENC 1KTMA 4YXDD 3SFDD 2WDRC 2B76C 1YQ4C 2WDRD 3AEAC 2B76D 3AE5C 4YSXD 3AE4C 2WU2C 4KX6D 1NEND 2BS4C 2H88D 1K05A 2BS3C 1OW6A 3AEGC 3AE1C 3AEED 3AE9D 2H89D 3AE9C 2ACZC 3AEDD 3AEBD 4YSZD 2WDQD 4YTNC 3AEBC 1YQ3D 3AEGD 5C2TD 3B71A 3AECD 3AE3C 2H89C
chains in the Genus database with same CATH superfamily
3P4SC 1IFIA 2FYUJ 2ZT9D 3M0AA 3WUUA 1GW4A 5H2FE 4PJ0E 1N73A 1FZCA 1W2EA 3RL0B 2YO3A 1M1JC 5KAFE 1D7MA 2QM7A 1Q2NA 1KFYD 3CWBG 1YTZT 3AE8C 2I1JA 3BASA 1QLBC 1NTKJ 2QJYB 1GDTA 1BCCD 2GUSA 1EDKA 1SS1A 2FXMA 1FZEA 1EQ7A 2AXTH 2NPSB 1KB9D 3I56P 2WMMA 3JCUE 3RGUA 2QJYC 1S1CX 1FJPA 1N7SD 4IL6E 5H2FH 3L72G 1T6AA 1SFCD 3CCUP 3B5NC 4YXDD 1KYOH 5AW5B 1VF5B 2WTYA 2RH0A 2HPCA 2N1TD 2MJZA 1NU1D 2BS4C 2H88D 1BGYJ 3AE1C 2WSSH 1JMMA 3CWBE 1RE3C 2KSEA 3MGNA 3H1JG 4PV1B 2PRRA 3FXEA 4LGDE 2OYHC 5AW6B 3Q2YA 2NZ2A 4ASWA 1SQXG 5AVZB 1KILA 1SVFA 3CCLP 3U1AA 2G8YA 3P8CD 5AW0B 4DHJA 1ZMEC 1A02J 2Q7CA 1IFNA 1NTKE 1FU1A 4OGQB 2QRXA 3H1LG 3NTNA 2KNCB 1OFCX 3Q5RA 2BCCE 1OW8A 4YTPC 1PPJE 1Z56A 1BSHA 1BE3G 3N4XA 1SQQJ 1H8AA 4U3FJ 1GZLA 1Y8AA 2W6BA 1SFCB 2BEQD 2FYUG 5BU8B 4K3AA 3RK2D 3W68A 3M0DC 4GIFA 3H1KE 2IPPA 1PP9D 1FAVA 5AW1B 2FYZA 3AEGC 3L75D 1VF5D 3LIEA 1NU1K 3MIWA 5CCHD 1SQVD 1M56D 1NTME 1T8ZA 1NTZD 1SQQD 4DHIB 5APTA 4IOIH 5TISE 1KZUB 5KLVJ 4Y28J 2IBZD 2ZYGA 3BATA 4H44D 2KLUA 2C9LY 2WSCH 2E5YA 2J59M 2Z5IA 5APSA 3T97A 2IBZE 1Q86Q 4Y99C 4WB4A 3G3ZA 3AE4D 4HB1A 3VP9A 1N7SB 1VQ8P 4H0LC 3H1KJ 5AVVB 4NPFX 1EDLA 1L0NJ 3AE1D 1MFZA 3AE2D 1E7PC 3F5HA 1VQKP 3HUSB 5KLVE 1QGKB 5AW9B 2E74B 3CLQA 5AW8B 1DEEG 4YSYD 1L0LE 4CPGA 2FBWC 1J1DB 2OQQA 5KTBA 2N1TA 1S5LX 1PPJD 1GMJA 3H1LD 5AW4B 2KZJA 5CCHA 1LT1A 3TK1A 3HUSC 1YHQP 5KLVG 2HODB 1S4XA 1CI6A 3H1IE 1LTIC 1EXIA 3M91A 4I2LC 4YTNC 3R4YA 3V2RA 2KS1B 3AE3C 4BXLA 1FE6A 2HODA 2WSEH 3TSIA 2E76B 5AVTB 1R8EA 1N2DC 1XTGB 3CXHH 3V5BA 2P7JA 3CXHD 1NVOA 3AE5D 2W6JH 1K04A 1BDCA 3FX0A 4RO0A 3Q5SA 2E42A 5KKZB 3OJAB 3WU2E 4GDOA 4YSZC 2KS1A 3Q1MA 2ZXXA 2RN0A 3BCCG 3V6IA 3H1HJ 2W90A 3GF7A 4AUWA 4PD4H 5CBOA 1J2JB 2OTJP 3AE7C 1JY3N 3KZIE 1VQ4P 5AW2B 1EZVD 2WU5C 1YQ3C 2KYVA 1J1DC 3B5ND 3LIDA 2K9JA 1SQQE 2IX7C 4ZNCA 5AVRB 3BCCD 3L75J 1BGYD 2JWAA 1FOSE 1P84D 3SFDD 3Q3DA 1ZW0A 1JMBA 2OYIC 2WITA 4H13D 1JY3O 2B89A 1NJIQ 1JCDA 3TGUD 3L74D 2A45H 5KAFH 1L2PA 1RE3A 1SQBD 1S9KD 2A45G 3H1JJ 3MUDA 2OTLP 2O01J 2IBZG 3L74J 1BGYG 3L75E 1EDIA 3MTUE 3AE2C 3SWFA 2IZ0A 5APQA 1YYCA 2IYOA 2FYNC 2IFNA 1SFCC 3GHGB 1L0NG 1BSNA 1MZ9A 1N8RQ 3L36A 2A06D 1LWUA 1M7LA 2IBZI 3H1KG 4YTND 2QVAA 3EQ2A 3HE4B 3LW5J 1URQC 3GG2A 2N1TB 4H44B 2YKPA 3L71G 4BRYB 1SLQA 4LLHA 2M5AA 2J5UA 3H1HE 1URQA 1L0NK 1WMKA 1L0NE 3A0BE 1URQD 1NYHA 1KF6C 1E79H 3EFFK 2H7HA 4HYTB 3CCEP 2KB7P 4YSYC 3CIRD 1CSBA 2Z5HA 1HGZA 1HJBA 3CCVP 3D70A 2JR8A 5TJHA 1KTMA 1FZCC 3S1KA 2FXPA 3AE5C 3SWKA 5CCGC 3NMDA 2JKVA 1KQLA 4L75A 3L72J 2E43A 3MUDC 1GK6A 2Q3EA 3L72D 1VQ6P 2ACZC 2QE7H 3AEDD 4YSZD 1YQ3D 1X9VA 3FWNA 2QJPB 2M8RA 3O8ZA 3MP7B 2QJPC 2WT7A 3SFDC 4I6LA 5TISH 2ZFYA 4FJVA 2WU5D 2ZT9B 1WRGA 3P4QC 2LXBA 1K8AQ 3AE8D 2AEFA 2WSFH 4OGQD 1ZP0D 1DIPA 2P1JA 5CCGA 1JB0J 4DCKA 1PL5A 4PV1D 1ZP0C 4OGQC 1YJNP 1VF5C 2WDVC 2KK7A 2FBWD 3H6PA 1LWUC 1E5WA 4D6TJ 3D6ZA 2L5GB 3D71A 4Z1MH 1KYOD 4H0LB 2LR2A 3CPWO 3SFED 2WDVD 2FFDC 1SQXJ 2FFDA 2JDIH 2OARA 1RQUA 5AVXB 3L71D 2V7QJ 1H88A 1FC2C 4GODA 3WUTA 3AEED 1LT9A 2XKMA 4W7YA 3A5TA 2D2CD 2OYOA 2WDQD 1NAYA 1CW5A 3B8EB 4TLFA 2WPSA 3L73D 2OYIA 4MN4C 3AE6C 1OW7A 4RESB 1G1JA 5AW7B 1LTJA 2KLVA 2K37A 1JUNA 1HUCA 1LTTC 3L70E 2QG4A 2N9BA 2YNYA 2O1KA 4D6TG 3E1IA 1LTSC 1SQPK 5GTHH 1L0VC 3M9BA 3M9HA 5BVZA 3A0BH 2HYNA 1RY3A 2G3AA 1OVUA 2QJKB 3H1IG 1RF0A 5DJTB 1USDA 5KLVK 1L0VD 3ITKA 1S5LH 1KILE 4I1LA 3CX5I 2R3CA 1P84I 3H1ID 4GT1A 1NGMB 3G71P 1K73Q 3AE3D 2Y0DA 2A45I 1AQTA 4DT0A 2W83C 4C7NB 4XA4A 3B4SA 5B66E 1FZGA 2R5DA 2NPSD 3RK3E 1NTZE 1GD2E 1KB9E 2YMYA 3FXDA 1AA0A 1RQVA 2WDRC 4KJMA 1NWQA 4N78D 5GTIH 1ZV8A 1PP9G 4HH2A 3V2PA 1AQ5A 2KUBA 1HJ0A 1GU4A 1ZR4A 2E75B 3G4SP 2W8ZA 3TF5A 1L0LK 1G1IA 1U57A 4EI2A 4HKZH 1AV1A 1GW3A 3KZIH 3AE7D 1BCCJ 4KHXA 2Q6QA 1H0TA 1LWUB 2RKLA 3NXSA 4AQRD 1YI2P 1NHLA 1KFNA 2C0WA 5B66H 1YQ4D 1S72P 1OWAA 3HE5A 2J58A 3H1LJ 1M1JA 3FWLA 4YTMD 3S4RA 3UIAA 4XE5B 3VP8A 3VR8D 1M8OB 2WP9D 1H0TB 4EIJA 1ZOYD 4ZKPA 4PV1C 3MHVA 4H0LD 2WP9C 1BCCE 2AXTE 1DX7A 3CCMP 3CIRC 1FDIA 4WY4A 2E74C 3C1LA 2HPCB 4K35A 1J1EC 3C9IA 2WDQC 2ZVOB 3SFEC 4LC1A 3S9OA 1XTCC 1SQXD 3IF4A 3KXDA 3OAKA 2WPVB 1BCCG 4OH8B 4DOJA 2NPSA 2Y0EA 3RK3C 1PGOA 3O6QA 1SQBJ 1RHZB 3N7NA 4BWNA 1A02F 5APUA 3V2NA 1OW6A 1S2EA 3P8MC 1EC5A 4N6JA 1VQMP 1OIPA 3T97B 1KMIZ 1SQPD 2FY8A 3II6A 2L91A 1PGQA 3CC7P 1AVYA 2Q3IA 1SQPJ 5KAIH 3WMM0 2KOGA 1RH5B 2YMKA 1OMIA 1VL2A 4LDTA 1VDFA 1DD4A 3AE6D 4TT3H 1MFTA 2IYPA 4QMAA 1HWTC 3E1RA 2WPRA 2V4HA 4EDFA 1EZVI 3PTZA 3BRVB 3GW6A 2YKQA 5C39A 1KC8Q 2CK3H 2W27A 1KILB 1CZQA 3CC4P 2WS3D 3H32B 3MD0A 3OW2O 4RJTA 5CHXA 2DW3A 4B86A 1RF1A 3H1IJ 2XV5A 1JTHA 4KX6C 1QL2A 4C46A 1G2CA 4AYCA 4PD4E 4JYCA 1FDMA 2E5TA 2HFED 5GTIE 4GOEA 1KQFB 3CCJP 3VONA 3OA7A 5AVSB 2E75D 5B5EH 5E79E 2YIUC 3P4PD 1AJYA 5BU5A 1Y9BA 3VMAA 2WT7B 2PAJA 4UB8H 2WZ7A 1YQ4C 1VQOP 2WDRD 2OTKE 4YSXD 2D2CC 2WU2C 1ZRTD 1FZFA 2O01H 2XU6A 1ZLLA 3L70J 3IN6A 2OYHB 5GTHE 1NTMG 4N78E 1MKMA 2GM4A 4L73A 1FS0E 2B88A 3VMXA 2BCCG 2B87B 3A2AA 3RK3D 1NH4A 2AEMA 5L8RJ 2JWDA 4R4MA 2E74D 1FBMA 2Y9YA 3L4FA 1PPJG 1L0ND 3JC22 2AXCA 3VMYA 1VPCA 3L75G 4YT0C 3USSA 3VRBD 1X8YA 4NPDA 3RL0D 1RF0C 1NKNA 1LP1B 4YT0D 4DDGA 1ZOYC 3GMAA 3A0HH 4UB6H 4HJGH 1NTKG 4O9BA 2E76C 4DDIA 3CMAP 4W80A 3CWBJ 3TGUG 2FYUK 2K88A 2SPZA 1YIJP 1KV4A 1KF6D 4IFFA 2QJKC 1SQXE 1QVFO 4WVZA 4OWFA 2WQYC 5B5EE 4N3YB 5K5GB 1L4AB 2FYNB 2B76C 1HTLC 3AEAC 1JY3P 1SQPG 2WVRA 4A7PA 3K5BA 3PHLA 1P84H 1SQVG 4KX6D 2O3JA 2KIKA 3HD7A 3Q5PA 3TDKA 2W6AA 1GL2A 3PLNA 5KJ7A 3AE9D 1IZNB 1TU3F 3AEBD 1HBWA 3PH0A 2QA4P 2AEJA 3CCRP 3VTPC 3L35A 1DH3A 1T2KC 1GTWA 2E75C 4PD4I 3VOPA 4WBAA 4YTMC 3EWKA 3HE4A 1ZRTE 4IL6H 1EZVE 3VN0A 1L4AD 3RK2B 1KYOI 1L0LG 2A06G 3TGUJ 5KAIE 1S3JA 1R5LA 2LXCB 1BGYE 3L71J 1QX8A 1M90Q 4IL6X 1WT6A 2R3SA 2H88C 2KI7B 3LW5H 3ABVC 2WSEJ 1MUUA 1R5SA 1BE3D 4ZMDA 4D6TD 3HRNA 1VQLP 1DEBA 1ZR2A 3ABVD 2IFMA 1SQVE 4WY4C 5AW3B 1JY2P 2QSIA 4JF7A 3HD7D 2FFDB 1NTMK 1Y47A 3I55P 3MZWB 1KORA 1OVVA 2FXOA 3TNUB 2PFXA 4DJGA 4EYYQ 1LT9C 1NOHA 2I1KA 4JYBA 3A7OA 2OYIB 2IDBA 5M1BA 3M0DA 4C7NA 1SQXK 2K9JB 1GU5A 1PIXA 3L73G 1K9MQ 3GHGA 1YBKA 4I6MC 1SP4A 1TFFA 3H32A 3RL0g 2MKVA 3CL3D 1IFMA 4UB8E 2FYUE 1CI6B 1KD1Q 2D2CB 3P4RC 1JY2N 2E76D 2ZAEB 1LTGC 1M1KQ 3H25A 1LJ2A 2ZYDA 1EDJA 4YPCA 1KFMA 4BRYA 1JOCA 2CPSA 3P4RD 1NU1G 2POHA 5CJ0A 2WS3C 3CCQP 2FYUD 3L73E 3W67A 4W7ZA 3VRBC 1NTKK 3JSVC 5CCGD 1S5LE 1PFIA 3AEAD 3HUSA 1L0LD 4U7JA 5KLVD 3P7KA 1SFCA 3AEDC 2PGDA 1NTKD 1GK4A 1AFOA 1VQNP 2C9NY 2LKMA 1JEKA 1M57D 2OYHA 2BASA 3P4PC 3AEFC 1NEKD 3KDPB 2C0XA 2XNXA 3R2PA 1ZXGA 1W2BO 2NPSC 5C3JC 3ZDMA 2JP3A 2ZYAA 1Q90D 1NTMD 1URQB 3VYIA 1KYOE 2H43A 2I8DA 3AE4C 3QWOC 2ZXEB 3FGAD 3C8VA 3L73J 1K05A 1PP9E 1NAFA 4PJ0H 2YIUB 3L74G 1MV8A 3AE9C 4I7ZC 2YKOA 1BE3J 1NU1E 1PGJA 1SQBG 3HD7C 1KB9H 2V7QH 5C2TD 3A3YB 2H89C 4U3FE 2ZVNB 1T2KD 2JEEA 1JTHB 3L72E 2IZ1A 1N7SA 3BRTB 2QEXP 1OZHA 1L4AC 3KYQA 1LNQA 4ZKUA 3IFMA 1EZVG 2Z4EA 4WWIA 2HG5D 3CX5H 4IFMA 3VR8C 1FDOA 3CI9A 1W5CE 3L70D 2WU2D 2R5BA 3AEEC 4DHZA 3TNUA 1EXJA 4IFDK 1RF1C 1Q81Q 3VR9D 2P58A 3H1HG 2JO1A 4YTPD 2VRSA 3U59A 1N73B 3BCCJ 1GL2B 4NPEA 2WSFJ 3P4SD 3P8CE 4RKUJ 2ZT9C 1ZN5A 2BCCD 3V2QA 3L70G 3RBZA 2P2UA 5APYA 1PV3A 1RF1B 5AVQB 1KFYC 1RE4C 4D6TE 4L76A 2RMZA 3JCUH 1N86A 1SQBE 1PGPA 1YJWP 3PP5A 3TGUE 3H1LE 3RL0C 1NEND 2OGUA 2ZFCA 2Y9ZA 2BS3C 2YXQB 3A0HE 2P10A 1T3JA 1IFPA 3IAOA 1FOSF 5CCHC 2WWWA 1PZQA 2A06E 3B71A 3RBXA 1YTZI 2GA1A 2H8PD 1IK9A 1VQ5P 4GOFA 1NTZJ 5C3JD 2JJLA 1SQQG 5APVA 5AVUB 1DD3A 3M06A 4U3FG 1KQSO 1X79B 2KNCA 1FZAA 2ZJSE 2WQYD 3G6EP 4YXDC 1HVVA 3G9RA 2XZRA 4U3FD 4H13C 1P84E 4EOTA 1JY2O 1NTZK 3VMZA 2B87A 1SQQK 3CWBD 5C2TC 2QIWA 2PP6A 4I7ZB 1NKZB 3B5NA 2ITAA 2R44A 3IR9A 1QEXA 4JPZB 2R32A 1N7LA 3O6QB 5CMZA 2K1AA 1LGHB 3E7KA 3WU2H 4KT0J 4JQ0D 1IFJA 1JCCA 1IO4A 2KZIA 3V4QA 4GKGA 2M5AB 3D6YA 1NTMJ 1FJKA 1VQ9P 1VQPP 2Q9IA 3EFGA 1IFDA 3GLMA 1VQ7P 4DZOA 2KSJA 2NRGA 1IC2A 2N1TC 3GHGC 2P67A 4UB6E 1IJDB 1X22A 4XFJA 1L4AA 3H1KD 3HTKB 3AECD 1N73C 1AVOA 3CX5E 1KILD 2BEZF 1HF9A 3AECC 3CD6P 1SQVJ 2Y0CA 4OVNF 3VRAC 3RK3B 3NFQA 2O1JA 1H89A 2Q5UA 2UWJE 1UIXA 5KKZC 3P32A 5APWA 2HLOA 1L0LJ 1SQPE 2ACZD 2WPQA 1U7JA 2BS2C 3VR9C 4M3LA 1USEA 3H1HD 3TYYA 1NEKC 3KPEA 1BE3E 1NU1J 1KN7A 2M3BA 5AVWB 1KB9I 3HTKA 1LT9B 2CPBA 1NTZG 5EFWB 2YXRB 4PD4D 4H44C 2M3EA 3KQGA 3CC2P 3P4QD 2O01N 3SWYA 3QH9A 1LTJC 2B9BA 2QM8A 2B76D 4WY4B 5APXA 4L74A 1KQGB 3L37A 3V4WA 2H89D 3WUVA 3AEBC 1LP1A 3SSUA 3HD7B 1SQVK 3AEGD 2FKWB 1GL2C 5KJ7C 1FZCB 4H13B 1S9KE 1IK7A 3F89A 3L74E 1GL2D 1JO5A 2Q1KA 5KJ7D 1BDDA 1G2CB 3AEFD 3CMEP 5DJUB 3B5NB 1N7SC 5E79H 1SQBK 1Q7YQ 1NO4A 1LTAC 3PRJA 3BCCE 1YITP 4YSXC 1J1EB 1U7MA 3CXHE 1JM0A 1T3UA 2GUVA 1HGVA 4YXWH 1KILC 3KHUA 2BCCJ 1QLED 3GF3A 3CCSP 1QL1A 4R4LA 3I5CA 1JNMA 3VRAD 2N9YB 5CBNA 4C7RA 4WY4D 4ASVA 2WSCJ 2KP8A 5KLIC 1UIIA 5AVYB 2XNDH 1OVRA 4JBZA 1QVGO 3CX5D 5KLIB 1FZBA 3H1JD 2KXPB 3RK2C 1NENC 1LTJB 3H1JE 1OX3A 1OXZA 2HR3A 1YJ9P 2K9YA 3CXHI 3M9QA 1X0TA 4Y99B 1Q82Q 1HH0A 2XDJA 2K3RA 1PP9J 2M0BA 1RE4A 3BVHA 3L71E 3HE5B 1LTBC 1M1JB 2YO2A 5CJ4A 3U1CA 3PJSK
chains in the Genus database with same CATH topology
3P4SC 2ZT9D 3AE7D 3Q2YA 2NZ2A 2E75C 3AE6C 5C3JD 1DD4A 1OW7A 2BEZF 2D2CB 2E76B 3AE6D 4TT3H 3P4RC 1DD3A 1R8EA 2QJPC 1HF9A 2E76D 3AE2C 3EWKA 4YTMC 3AECC 1ZRTE 3AEFD 3H25A 3SFDC 3VRAC 5L8RJ 4R4MA 2E74D 1YQ4D 2G8YA 4Y28J 3AE5D 1K04A 2WU5D 2FYNC 3P4RD 2ZT9B 4H44D 2WQYD 2WS3C 4YTMD 1KFYD 4YXDC 3G9RA 1ZMEC 3P4QC 1L0VC 4YT0C 3Q5SA 3AE8C 3VR8D 3VRBD 4H13C 2G3AA 3AE8D 1UIXA 1FDOA 3VRBC 3VR8C 1QLBC 5KKZC 4OGQD 1ZP0D 1DIPA 4IL6X 2WP9D 4YSXC 2WS3D 4OGQB 3AE4D 2H88C 4GDOA 1JB0J 4YSZC 2WU2D 1L0VD 3Q1MA 4YT0D 1ZOYD 4YTND 1PL5A 4PV1D 1ZOYC 5C2TC 3AEAD 4PV1C 3LW5J 4H0LC 3ABVC 2QIWA 3AEEC 3GMAA 1KILE 4H0LD 1ZP0C 4OGQC 2ACZD 2WSEJ 4U7JA 1EXJA 4H44B 2WP9C 4I7ZB 1VF5C 3Q5RA 2BS2C 4KX6C 3VR9D 2J5UA 3AEDC 3VR9C 1OW8A 3GF7A 2WDVC 2JO1A 3GF3A 1WMKA 4YTPD 1NGMB 3AE1D 2FBWD 2E76C 3D6ZA 3AE2D 4YTPC 1E7PC 3ABVD 1NEKC 4R4LA 2WSFJ 3CIRC 3P4SD 4RKUJ 3D71A 2ZT9C 3AE7C 3AE3D 1FDIA 1NYHA 3VRAD 1KF6C 4Z1MH 2E74C 1KF6D 2QJYC 2QSIA 2E74B 1S1CX 4H0LB 2WDQC 1KQFB 4KT0J 2WU5C 1YQ3C 2WSCJ 2WDVD 4YSYD 3SFED 3SFEC 5KLIC 3P4PC 2FBWC 4YSYC 3AEFC 2QJKC 1NEKD 3S9OA 3CIRD 1KORA 2OQQA 3RK3E 1PV3A 1S5LX 3D70A 2E75D 5C3JC 2WPVB 2WQYC 4H44C 1GMJA 2JP3A 1KFYC 2YIUC 1Q90D 2BEQD 2YMKA 1AJYA 3P4PD 3D6YA 3P4QD 1Y9BA 1NENC 1KTMA 4YXDD 1RQVA 3SFDD 3Q3DA 2WDRC 1VF5B 2K9YA 3O6QA 2B76C 2FXPA 1YQ4C 3AEAC 2WDRD 1RQUA 3AE5C 4H13D 2B76D 4YSXD 2D2CC 3AE4C 2V7QJ 2IDBA 5M1BA 2WU2C 4KX6D 1NEND 3FGAD 3C8VA 1EXIA 2BS4C 2H88D 1K05A 1KQGB 3Q5PA 2BS3C 1OW6A 1HJ0A 3AEGC 3AE1C 3AEED 3GLMA 2E75B 2P10A 3AE9D 3T97B 1PIXA 3AE9C 2H89D 1KMIZ 4I7ZC 1VF5D 3IAOA 2D2CD 1U57A 3IN6A 2ACZC 1TU3F 3AEDD 3AEBD 4YSZD 3RL0g 2WDQD 4PV1B 3AEBC 2MKVA 1YQ3D 4XFJA 4YTNC 3R4YA 3AEGD 5C2TD 1MKMA 2O01J 3B71A 4H13B 3AECD 3AE3C 2H89C 1IK7A 1OMIA 1VL2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P4S C;  3AE7 D;  5C3J D;  3AE6 C;  1OW7 A;  3AE6 D;  3P4R C;  3AE2 C;  4YTM C;  3AEC C;  3AEF D;  3SFD C;  3VRA C;  1YQ4 D;  3AE5 D;  1K04 A;  2WU5 D;  3P4R D;  2WQY D;  2WS3 C;  4YTM D;  1KFY D;  4YXD C;  3P4Q C;  1L0V C;  4YT0 C;  3AE8 C;  3VR8 D;  3VRB D;  2G3A A;  3AE8 D;  3VR8 C;  3VRB C;  1QLB C;  1ZP0 D;  2WP9 D;  4YSX C;  2WS3 D;  3AE4 D;  2H88 C;  4YSZ C;  2WU2 D;  1L0V D;  4YT0 D;  4YTN D;  1ZOY D;  1ZOY C;  5C2T C;  3AEA D;  3ABV C;  3AEE C;  1ZP0 C;  2ACZ D;  2WP9 C;  2BS2 C;  4KX6 C;  3VR9 D;  3AED C;  3VR9 C;  1OW8 A;  2WDV C;  4YTP D;  3AE1 D;  2FBW D;  3AE2 D;  4YTP C;  1E7P C;  3ABV D;  1NEK C;  3P4S D;  3CIR C;  3AE3 D;  3AE7 C;  3VRA D;  1KF6 C;  1KF6 D;  2WDQ C;  3SFE D;  2WU5 C;  1YQ3 C;  2WDV D;  4YSY D;  3SFE C;  3P4P C;  4YSY C;  2FBW C;  3AEF C;  1NEK D;  3S9O A;  3CIR D;  1PV3 A;  5C3J C;  2WQY C;  1KFY C;  3P4P D;  3P4Q D;  1NEN C;  1KTM A;  4YXD D;  3SFD D;  2WDR C;  2B76 C;  1YQ4 C;  2WDR D;  3AEA C;  2B76 D;  3AE5 C;  4YSX D;  3AE4 C;  2WU2 C;  4KX6 D;  1NEN D;  2BS4 C;  2H88 D;  1K05 A;  2BS3 C;  1OW6 A;  3AEG C;  3AE1 C;  3AEE D;  3AE9 D;  2H89 D;  3AE9 C;  2ACZ C;  3AED D;  3AEB D;  4YSZ D;  2WDQ D;  4YTN C;  3AEB C;  1YQ3 D;  3AEG D;  5C2T D;  3B71 A;  3AEC D;  3AE3 C;  2H89 C; 
#chains in the Genus database with same CATH topology
 3P4S C;  1IFI A;  2FYU J;  2ZT9 D;  3M0A A;  3WUU A;  1GW4 A;  5H2F E;  4PJ0 E;  1N73 A;  1FZC A;  1W2E A;  3RL0 B;  2YO3 A;  1M1J C;  5KAF E;  1D7M A;  2QM7 A;  1Q2N A;  1KFY D;  3CWB G;  1YTZ T;  3AE8 C;  2I1J A;  3BAS A;  1QLB C;  1NTK J;  2QJY B;  1GDT A;  1BCC D;  2GUS A;  1EDK A;  1SS1 A;  2FXM A;  1FZE A;  1EQ7 A;  2AXT H;  2NPS B;  1KB9 D;  3I56 P;  2WMM A;  3JCU E;  3RGU A;  2QJY C;  1S1C X;  1FJP A;  1N7S D;  4IL6 E;  5H2F H;  3L72 G;  1T6A A;  1SFC D;  3CCU P;  3B5N C;  4YXD D;  1KYO H;  5AW5 B;  1VF5 B;  2WTY A;  2RH0 A;  2HPC A;  2N1T D;  2MJZ A;  1NU1 D;  2BS4 C;  2H88 D;  1BGY J;  3AE1 C;  2WSS H;  1JMM A;  3CWB E;  1RE3 C;  2KSE A;  3MGN A;  3H1J G;  4PV1 B;  2PRR A;  3FXE A;  4LGD E;  2OYH C;  5AW6 B;  3Q2Y A;  2NZ2 A;  4ASW A;  1SQX G;  5AVZ B;  1KIL A;  1SVF A;  3CCL P;  3U1A A;  2G8Y A;  3P8C D;  5AW0 B;  4DHJ A;  1ZME C;  1A02 J;  2Q7C A;  1IFN A;  1NTK E;  1FU1 A;  4OGQ B;  2QRX A;  3H1L G;  3NTN A;  2KNC B;  1OFC X;  3Q5R A;  2BCC E;  1OW8 A;  4YTP C;  1PPJ E;  1Z56 A;  1BSH A;  1BE3 G;  3N4X A;  1SQQ J;  1H8A A;  4U3F J;  1GZL A;  1Y8A A;  2W6B A;  1SFC B;  2BEQ D;  2FYU G;  5BU8 B;  4K3A A;  3RK2 D;  3W68 A;  3M0D C;  4GIF A;  3H1K E;  2IPP A;  1PP9 D;  1FAV A;  5AW1 B;  2FYZ A;  3AEG C;  3L75 D;  1VF5 D;  3LIE A;  1NU1 K;  3MIW A;  5CCH D;  1SQV D;  1M56 D;  1NTM E;  1T8Z A;  1NTZ D;  1SQQ D;  4DHI B;  5APT A;  4IOI H;  5TIS E;  1KZU B;  5KLV J;  4Y28 J;  2IBZ D;  2ZYG A;  3BAT A;  4H44 D;  2KLU A;  2C9L Y;  2WSC H;  2E5Y A;  2J59 M;  2Z5I A;  5APS A;  3T97 A;  2IBZ E;  1Q86 Q;  4Y99 C;  4WB4 A;  3G3Z A;  3AE4 D;  4HB1 A;  3VP9 A;  1N7S B;  1VQ8 P;  4H0L C;  3H1K J;  5AVV B;  4NPF X;  1EDL A;  1L0N J;  3AE1 D;  1MFZ A;  3AE2 D;  1E7P C;  3F5H A;  1VQK P;  3HUS B;  5KLV E;  1QGK B;  5AW9 B;  2E74 B;  3CLQ A;  5AW8 B;  1DEE G;  4YSY D;  1L0L E;  4CPG A;  2FBW C;  1J1D B;  2OQQ A;  5KTB A;  2N1T A;  1S5L X;  1PPJ D;  1GMJ A;  3H1L D;  5AW4 B;  2KZJ A;  5CCH A;  1LT1 A;  3TK1 A;  3HUS C;  1YHQ P;  5KLV G;  2HOD B;  1S4X A;  1CI6 A;  3H1I E;  1LTI C;  1EXI A;  3M91 A;  4I2L C;  4YTN C;  3R4Y A;  3V2R A;  2KS1 B;  3AE3 C;  4BXL A;  1FE6 A;  2HOD A;  2WSE H;  3TSI A;  2E76 B;  5AVT B;  1R8E A;  1N2D C;  1XTG B;  3CXH H;  3V5B A;  2P7J A;  3CXH D;  1NVO A;  3AE5 D;  2W6J H;  1K04 A;  1BDC A;  3FX0 A;  4RO0 A;  3Q5S A;  2E42 A;  5KKZ B;  3OJA B;  3WU2 E;  4GDO A;  4YSZ C;  2KS1 A;  3Q1M A;  2ZXX A;  2RN0 A;  3BCC G;  3V6I A;  3H1H J;  2W90 A;  3GF7 A;  4AUW A;  4PD4 H;  5CBO A;  1J2J B;  2OTJ P;  3AE7 C;  1JY3 N;  3KZI E;  1VQ4 P;  5AW2 B;  1EZV D;  2WU5 C;  1YQ3 C;  2KYV A;  1J1D C;  3B5N D;  3LID A;  2K9J A;  1SQQ E;  2IX7 C;  4ZNC A;  5AVR B;  3BCC D;  3L75 J;  1BGY D;  2JWA A;  1FOS E;  1P84 D;  3SFD D;  3Q3D A;  1ZW0 A;  1JMB A;  2OYI C;  2WIT A;  4H13 D;  1JY3 O;  2B89 A;  1NJI Q;  1JCD A;  3TGU D;  3L74 D;  2A45 H;  5KAF H;  1L2P A;  1RE3 A;  1SQB D;  1S9K D;  2A45 G;  3H1J J;  3MUD A;  2OTL P;  2O01 J;  2IBZ G;  3L74 J;  1BGY G;  3L75 E;  1EDI A;  3MTU E;  3AE2 C;  3SWF A;  2IZ0 A;  5APQ A;  1YYC A;  2IYO A;  2FYN C;  2IFN A;  1SFC C;  3GHG B;  1L0N G;  1BSN A;  1MZ9 A;  1N8R Q;  3L36 A;  2A06 D;  1LWU A;  1M7L A;  2IBZ I;  3H1K G;  4YTN D;  2QVA A;  3EQ2 A;  3HE4 B;  3LW5 J;  1URQ C;  3GG2 A;  2N1T B;  4H44 B;  2YKP A;  3L71 G;  4BRY B;  1SLQ A;  4LLH A;  2M5A A;  2J5U A;  3H1H E;  1URQ A;  1L0N K;  1WMK A;  1L0N E;  3A0B E;  1URQ D;  1NYH A;  1KF6 C;  1E79 H;  3EFF K;  2H7H A;  4HYT B;  3CCE P;  2KB7 P;  4YSY C;  3CIR D;  1CSB A;  2Z5H A;  1HGZ A;  1HJB A;  3CCV P;  3D70 A;  2JR8 A;  5TJH A;  1KTM A;  1FZC C;  3S1K A;  2FXP A;  3AE5 C;  3SWK A;  5CCG C;  3NMD A;  2JKV A;  1KQL A;  4L75 A;  3L72 J;  2E43 A;  3MUD C;  1GK6 A;  2Q3E A;  3L72 D;  1VQ6 P;  2ACZ C;  2QE7 H;  3AED D;  4YSZ D;  1YQ3 D;  1X9V A;  3FWN A;  2QJP B;  2M8R A;  3O8Z A;  3MP7 B;  2QJP C;  2WT7 A;  3SFD C;  4I6L A;  5TIS H;  2ZFY A;  4FJV A;  2WU5 D;  2ZT9 B;  1WRG A;  3P4Q C;  2LXB A;  1K8A Q;  3AE8 D;  2AEF A;  2WSF H;  4OGQ D;  1ZP0 D;  1DIP A;  2P1J A;  5CCG A;  1JB0 J;  4DCK A;  1PL5 A;  4PV1 D;  1ZP0 C;  4OGQ C;  1YJN P;  1VF5 C;  2WDV C;  2KK7 A;  2FBW D;  3H6P A;  1LWU C;  1E5W A;  4D6T J;  3D6Z A;  2L5G B;  3D71 A;  4Z1M H;  1KYO D;  4H0L B;  2LR2 A;  3CPW O;  3SFE D;  2WDV D;  2FFD C;  1SQX J;  2FFD A;  2JDI H;  2OAR A;  1RQU A;  5AVX B;  3L71 D;  2V7Q J;  1H88 A;  1FC2 C;  4GOD A;  3WUT A;  3AEE D;  1LT9 A;  2XKM A;  4W7Y A;  3A5T A;  2D2C D;  2OYO A;  2WDQ D;  1NAY A;  1CW5 A;  3B8E B;  4TLF A;  2WPS A;  3L73 D;  2OYI A;  4MN4 C;  3AE6 C;  1OW7 A;  4RES B;  1G1J A;  5AW7 B;  1LTJ A;  2KLV A;  2K37 A;  1JUN A;  1HUC A;  1LTT C;  3L70 E;  2QG4 A;  2N9B A;  2YNY A;  2O1K A;  4D6T G;  3E1I A;  1LTS C;  1SQP K;  5GTH H;  1L0V C;  3M9B A;  3M9H A;  5BVZ A;  3A0B H;  2HYN A;  1RY3 A;  2G3A A;  1OVU A;  2QJK B;  3H1I G;  1RF0 A;  5DJT B;  1USD A;  5KLV K;  1L0V D;  3ITK A;  1S5L H;  1KIL E;  4I1L A;  3CX5 I;  2R3C A;  1P84 I;  3H1I D;  4GT1 A;  1NGM B;  3G71 P;  1K73 Q;  3AE3 D;  2Y0D A;  2A45 I;  1AQT A;  4DT0 A;  2W83 C;  4C7N B;  4XA4 A;  3B4S A;  5B66 E;  1FZG A;  2R5D A;  2NPS D;  3RK3 E;  1NTZ E;  1GD2 E;  1KB9 E;  2YMY A;  3FXD A;  1AA0 A;  1RQV A;  2WDR C;  4KJM A;  1NWQ A;  4N78 D;  5GTI H;  1ZV8 A;  1PP9 G;  4HH2 A;  3V2P A;  1AQ5 A;  2KUB A;  1HJ0 A;  1GU4 A;  1ZR4 A;  2E75 B;  3G4S P;  2W8Z A;  3TF5 A;  1L0L K;  1G1I A;  1U57 A;  4EI2 A;  4HKZ H;  1AV1 A;  1GW3 A;  3KZI H;  3AE7 D;  1BCC J;  4KHX A;  2Q6Q A;  1H0T A;  1LWU B;  2RKL A;  3NXS A;  4AQR D;  1YI2 P;  1NHL A;  1KFN A;  2C0W A;  5B66 H;  1YQ4 D;  1S72 P;  1OWA A;  3HE5 A;  2J58 A;  3H1L J;  1M1J A;  3FWL A;  4YTM D;  3S4R A;  3UIA A;  4XE5 B;  3VP8 A;  3VR8 D;  1M8O B;  2WP9 D;  1H0T B;  4EIJ A;  1ZOY D;  4ZKP A;  4PV1 C;  3MHV A;  4H0L D;  2WP9 C;  1BCC E;  2AXT E;  1DX7 A;  3CCM P;  3CIR C;  1FDI A;  4WY4 A;  2E74 C;  3C1L A;  2HPC B;  4K35 A;  1J1E C;  3C9I A;  2WDQ C;  2ZVO B;  3SFE C;  4LC1 A;  3S9O A;  1XTC C;  1SQX D;  3IF4 A;  3KXD A;  3OAK A;  2WPV B;  1BCC G;  4OH8 B;  4DOJ A;  2NPS A;  2Y0E A;  3RK3 C;  1PGO A;  3O6Q A;  1SQB J;  1RHZ B;  3N7N A;  4BWN A;  1A02 F;  5APU A;  3V2N A;  1OW6 A;  1S2E A;  3P8M C;  1EC5 A;  4N6J A;  1VQM P;  1OIP A;  3T97 B;  1KMI Z;  1SQP D;  2FY8 A;  3II6 A;  2L91 A;  1PGQ A;  3CC7 P;  1AVY A;  2Q3I A;  1SQP J;  5KAI H;  3WMM 0;  2KOG A;  1RH5 B;  2YMK A;  1OMI A;  1VL2 A;  4LDT A;  1VDF A;  1DD4 A;  3AE6 D;  4TT3 H;  1MFT A;  2IYP A;  4QMA A;  1HWT C;  3E1R A;  2WPR A;  2V4H A;  4EDF A;  1EZV I;  3PTZ A;  3BRV B;  3GW6 A;  2YKQ A;  5C39 A;  1KC8 Q;  2CK3 H;  2W27 A;  1KIL B;  1CZQ A;  3CC4 P;  2WS3 D;  3H32 B;  3MD0 A;  3OW2 O;  4RJT A;  5CHX A;  2DW3 A;  4B86 A;  1RF1 A;  3H1I J;  2XV5 A;  1JTH A;  4KX6 C;  1QL2 A;  4C46 A;  1G2C A;  4AYC A;  4PD4 E;  4JYC A;  1FDM A;  2E5T A;  2HFE D;  5GTI E;  4GOE A;  1KQF B;  3CCJ P;  3VON A;  3OA7 A;  5AVS B;  2E75 D;  5B5E H;  5E79 E;  2YIU C;  3P4P D;  1AJY A;  5BU5 A;  1Y9B A;  3VMA A;  2WT7 B;  2PAJ A;  4UB8 H;  2WZ7 A;  1YQ4 C;  1VQO P;  2WDR D;  2OTK E;  4YSX D;  2D2C C;  2WU2 C;  1ZRT D;  1FZF A;  2O01 H;  2XU6 A;  1ZLL A;  3L70 J;  3IN6 A;  2OYH B;  5GTH E;  1NTM G;  4N78 E;  1MKM A;  2GM4 A;  4L73 A;  1FS0 E;  2B88 A;  3VMX A;  2BCC G;  2B87 B;  3A2A A;  3RK3 D;  1NH4 A;  2AEM A;  5L8R J;  2JWD A;  4R4M A;  2E74 D;  1FBM A;  2Y9Y A;  3L4F A;  1PPJ G;  1L0N D;  3JC2 2;  2AXC A;  3VMY A;  1VPC A;  3L75 G;  4YT0 C;  3USS A;  3VRB D;  1X8Y A;  4NPD A;  3RL0 D;  1RF0 C;  1NKN A;  1LP1 B;  4YT0 D;  4DDG A;  1ZOY C;  3GMA A;  3A0H H;  4UB6 H;  4HJG H;  1NTK G;  4O9B A;  2E76 C;  4DDI A;  3CMA P;  4W80 A;  3CWB J;  3TGU G;  2FYU K;  2K88 A;  2SPZ A;  1YIJ P;  1KV4 A;  1KF6 D;  4IFF A;  2QJK C;  1SQX E;  1QVF O;  4WVZ A;  4OWF A;  2WQY C;  5B5E E;  4N3Y B;  5K5G B;  1L4A B;  2FYN B;  2B76 C;  1HTL C;  3AEA C;  1JY3 P;  1SQP G;  2WVR A;  4A7P A;  3K5B A;  3PHL A;  1P84 H;  1SQV G;  4KX6 D;  2O3J A;  2KIK A;  3HD7 A;  3Q5P A;  3TDK A;  2W6A A;  1GL2 A;  3PLN A;  5KJ7 A;  3AE9 D;  1IZN B;  1TU3 F;  3AEB D;  1HBW A;  3PH0 A;  2QA4 P;  2AEJ A;  3CCR P;  3VTP C;  3L35 A;  1DH3 A;  1T2K C;  1GTW A;  2E75 C;  4PD4 I;  3VOP A;  4WBA A;  4YTM C;  3EWK A;  3HE4 A;  1ZRT E;  4IL6 H;  1EZV E;  3VN0 A;  1L4A D;  3RK2 B;  1KYO I;  1L0L G;  2A06 G;  3TGU J;  5KAI E;  1S3J A;  1R5L A;  2LXC B;  1BGY E;  3L71 J;  1QX8 A;  1M90 Q;  4IL6 X;  1WT6 A;  2R3S A;  2H88 C;  2KI7 B;  3LW5 H;  3ABV C;  2WSE J;  1MUU A;  1R5S A;  1BE3 D;  4ZMD A;  4D6T D;  3HRN A;  1VQL P;  1DEB A;  1ZR2 A;  3ABV D;  2IFM A;  1SQV E;  4WY4 C;  5AW3 B;  1JY2 P;  2QSI A;  4JF7 A;  3HD7 D;  2FFD B;  1NTM K;  1Y47 A;  3I55 P;  3MZW B;  1KOR A;  1OVV A;  2FXO A;  3TNU B;  2PFX A;  4DJG A;  4EYY Q;  1LT9 C;  1NOH A;  2I1K A;  4JYB A;  3A7O A;  2OYI B;  2IDB A;  5M1B A;  3M0D A;  4C7N A;  1SQX K;  2K9J B;  1GU5 A;  1PIX A;  3L73 G;  1K9M Q;  3GHG A;  1YBK A;  4I6M C;  1SP4 A;  1TFF A;  3H32 A;  3RL0 g;  2MKV A;  3CL3 D;  1IFM A;  4UB8 E;  2FYU E;  1CI6 B;  1KD1 Q;  2D2C B;  3P4R C;  1JY2 N;  2E76 D;  2ZAE B;  1LTG C;  1M1K Q;  3H25 A;  1LJ2 A;  2ZYD A;  1EDJ A;  4YPC A;  1KFM A;  4BRY A;  1JOC A;  2CPS A;  3P4R D;  1NU1 G;  2POH A;  5CJ0 A;  2WS3 C;  3CCQ P;  2FYU D;  3L73 E;  3W67 A;  4W7Z A;  3VRB C;  1NTK K;  3JSV C;  5CCG D;  1S5L E;  1PFI A;  3AEA D;  3HUS A;  1L0L D;  4U7J A;  5KLV D;  3P7K A;  1SFC A;  3AED C;  2PGD A;  1NTK D;  1GK4 A;  1AFO A;  1VQN P;  2C9N Y;  2LKM A;  1JEK A;  1M57 D;  2OYH A;  2BAS A;  3P4P C;  3AEF C;  1NEK D;  3KDP B;  2C0X A;  2XNX A;  3R2P A;  1ZXG A;  1W2B O;  2NPS C;  5C3J C;  3ZDM A;  2JP3 A;  2ZYA A;  1Q90 D;  1NTM D;  1URQ B;  3VYI A;  1KYO E;  2H43 A;  2I8D A;  3AE4 C;  3QWO C;  2ZXE B;  3FGA D;  3C8V A;  3L73 J;  1K05 A;  1PP9 E;  1NAF A;  4PJ0 H;  2YIU B;  3L74 G;  1MV8 A;  3AE9 C;  4I7Z C;  2YKO A;  1BE3 J;  1NU1 E;  1PGJ A;  1SQB G;  3HD7 C;  1KB9 H;  2V7Q H;  5C2T D;  3A3Y B;  2H89 C;  4U3F E;  2ZVN B;  1T2K D;  2JEE A;  1JTH B;  3L72 E;  2IZ1 A;  1N7S A;  3BRT B;  2QEX P;  1OZH A;  1L4A C;  3KYQ A;  1LNQ A;  4ZKU A;  3IFM A;  1EZV G;  2Z4E A;  4WWI A;  2HG5 D;  3CX5 H;  4IFM A;  3VR8 C;  1FDO A;  3CI9 A;  1W5C E;  3L70 D;  2WU2 D;  2R5B A;  3AEE C;  4DHZ A;  3TNU A;  1EXJ A;  4IFD K;  1RF1 C;  1Q81 Q;  3VR9 D;  2P58 A;  3H1H G;  2JO1 A;  4YTP D;  2VRS A;  3U59 A;  1N73 B;  3BCC J;  1GL2 B;  4NPE A;  2WSF J;  3P4S D;  3P8C E;  4RKU J;  2ZT9 C;  1ZN5 A;  2BCC D;  3V2Q A;  3L70 G;  3RBZ A;  2P2U A;  5APY A;  1PV3 A;  1RF1 B;  5AVQ B;  1KFY C;  1RE4 C;  4D6T E;  4L76 A;  2RMZ A;  3JCU H;  1N86 A;  1SQB E;  1PGP A;  1YJW P;  3PP5 A;  3TGU E;  3H1L E;  3RL0 C;  1NEN D;  2OGU A;  2ZFC A;  2Y9Z A;  2BS3 C;  2YXQ B;  3A0H E;  2P10 A;  1T3J A;  1IFP A;  3IAO A;  1FOS F;  5CCH C;  2WWW A;  1PZQ A;  2A06 E;  3B71 A;  3RBX A;  1YTZ I;  2GA1 A;  2H8P D;  1IK9 A;  1VQ5 P;  4GOF A;  1NTZ J;  5C3J D;  2JJL A;  1SQQ G;  5APV A;  5AVU B;  1DD3 A;  3M06 A;  4U3F G;  1KQS O;  1X79 B;  2KNC A;  1FZA A;  2ZJS E;  2WQY D;  3G6E P;  4YXD C;  1HVV A;  3G9R A;  2XZR A;  4U3F D;  4H13 C;  1P84 E;  4EOT A;  1JY2 O;  1NTZ K;  3VMZ A;  2B87 A;  1SQQ K;  3CWB D;  5C2T C;  2QIW A;  2PP6 A;  4I7Z B;  1NKZ B;  3B5N A;  2ITA A;  2R44 A;  3IR9 A;  1QEX A;  4JPZ B;  2R32 A;  1N7L A;  3O6Q B;  5CMZ A;  2K1A A;  1LGH B;  3E7K A;  3WU2 H;  4KT0 J;  4JQ0 D;  1IFJ A;  1JCC A;  1IO4 A;  2KZI A;  3V4Q A;  4GKG A;  2M5A B;  3D6Y A;  1NTM J;  1FJK A;  1VQ9 P;  1VQP P;  2Q9I A;  3EFG A;  1IFD A;  3GLM A;  1VQ7 P;  4DZO A;  2KSJ A;  2NRG A;  1IC2 A;  2N1T C;  3GHG C;  2P67 A;  4UB6 E;  1IJD B;  1X22 A;  4XFJ A;  1L4A A;  3H1K D;  3HTK B;  3AEC D;  1N73 C;  1AVO A;  3CX5 E;  1KIL D;  2BEZ F;  1HF9 A;  3AEC C;  3CD6 P;  1SQV J;  2Y0C A;  4OVN F;  3VRA C;  3RK3 B;  3NFQ A;  2O1J A;  1H89 A;  2Q5U A;  2UWJ E;  1UIX A;  5KKZ C;  3P32 A;  5APW A;  2HLO A;  1L0L J;  1SQP E;  2ACZ D;  2WPQ A;  1U7J A;  2BS2 C;  3VR9 C;  4M3L A;  1USE A;  3H1H D;  3TYY A;  1NEK C;  3KPE A;  1BE3 E;  1NU1 J;  1KN7 A;  2M3B A;  5AVW B;  1KB9 I;  3HTK A;  1LT9 B;  2CPB A;  1NTZ G;  5EFW B;  2YXR B;  4PD4 D;  4H44 C;  2M3E A;  3KQG A;  3CC2 P;  3P4Q D;  2O01 N;  3SWY A;  3QH9 A;  1LTJ C;  2B9B A;  2QM8 A;  2B76 D;  4WY4 B;  5APX A;  4L74 A;  1KQG B;  3L37 A;  3V4W A;  2H89 D;  3WUV A;  3AEB C;  1LP1 A;  3SSU A;  3HD7 B;  1SQV K;  3AEG D;  2FKW B;  1GL2 C;  5KJ7 C;  1FZC B;  4H13 B;  1S9K E;  1IK7 A;  3F89 A;  3L74 E;  1GL2 D;  1JO5 A;  2Q1K A;  5KJ7 D;  1BDD A;  1G2C B;  3AEF D;  3CME P;  5DJU B;  3B5N B;  1N7S C;  5E79 H;  1SQB K;  1Q7Y Q;  1NO4 A;  1LTA C;  3PRJ A;  3BCC E;  1YIT P;  4YSX C;  1J1E B;  1U7M A;  3CXH E;  1JM0 A;  1T3U A;  2GUV A;  1HGV A;  4YXW H;  1KIL C;  3KHU A;  2BCC J;  1QLE D;  3GF3 A;  3CCS P;  1QL1 A;  4R4L A;  3I5C A;  1JNM A;  3VRA D;  2N9Y B;  5CBN A;  4C7R A;  4WY4 D;  4ASV A;  2WSC J;  2KP8 A;  5KLI C;  1UII A;  5AVY B;  2XND H;  1OVR A;  4JBZ A;  1QVG O;  3CX5 D;  5KLI B;  1FZB A;  3H1J D;  2KXP B;  3RK2 C;  1NEN C;  1LTJ B;  3H1J E;  1OX3 A;  1OXZ A;  2HR3 A;  1YJ9 P;  2K9Y A;  3CXH I;  3M9Q A;  1X0T A;  4Y99 B;  1Q82 Q;  1HH0 A;  2XDJ A;  2K3R A;  1PP9 J;  2M0B A;  1RE4 A;  3BVH A;  3L71 E;  3HE5 B;  1LTB C;  1M1J B;  2YO2 A;  5CJ4 A;  3U1C A;  3PJS K; 
#chains in the Genus database with same CATH homology
 3P4S C;  2ZT9 D;  3AE7 D;  3Q2Y A;  2NZ2 A;  2E75 C;  3AE6 C;  5C3J D;  1DD4 A;  1OW7 A;  2BEZ F;  2D2C B;  2E76 B;  3AE6 D;  4TT3 H;  3P4R C;  1DD3 A;  1R8E A;  2QJP C;  1HF9 A;  2E76 D;  3AE2 C;  3EWK A;  4YTM C;  3AEC C;  1ZRT E;  3AEF D;  3H25 A;  3SFD C;  3VRA C;  5L8R J;  4R4M A;  2E74 D;  1YQ4 D;  2G8Y A;  4Y28 J;  3AE5 D;  1K04 A;  2WU5 D;  2FYN C;  3P4R D;  2ZT9 B;  4H44 D;  2WQY D;  2WS3 C;  4YTM D;  1KFY D;  4YXD C;  3G9R A;  1ZME C;  3P4Q C;  1L0V C;  4YT0 C;  3Q5S A;  3AE8 C;  3VR8 D;  3VRB D;  4H13 C;  2G3A A;  3AE8 D;  1UIX A;  1FDO A;  3VRB C;  3VR8 C;  1QLB C;  5KKZ C;  4OGQ D;  1ZP0 D;  1DIP A;  4IL6 X;  2WP9 D;  4YSX C;  2WS3 D;  4OGQ B;  3AE4 D;  2H88 C;  4GDO A;  1JB0 J;  4YSZ C;  2WU2 D;  1L0V D;  3Q1M A;  4YT0 D;  1ZOY D;  4YTN D;  1PL5 A;  4PV1 D;  1ZOY C;  5C2T C;  3AEA D;  4PV1 C;  3LW5 J;  4H0L C;  3ABV C;  2QIW A;  3AEE C;  3GMA A;  1KIL E;  4H0L D;  1ZP0 C;  4OGQ C;  2ACZ D;  2WSE J;  4U7J A;  1EXJ A;  4H44 B;  2WP9 C;  4I7Z B;  1VF5 C;  3Q5R A;  2BS2 C;  4KX6 C;  3VR9 D;  2J5U A;  3AED C;  3VR9 C;  1OW8 A;  3GF7 A;  2WDV C;  2JO1 A;  3GF3 A;  1WMK A;  4YTP D;  1NGM B;  3AE1 D;  2FBW D;  2E76 C;  3D6Z A;  3AE2 D;  4YTP C;  1E7P C;  3ABV D;  1NEK C;  4R4L A;  2WSF J;  3CIR C;  3P4S D;  4RKU J;  3D71 A;  2ZT9 C;  3AE7 C;  3AE3 D;  1FDI A;  1NYH A;  3VRA D;  1KF6 C;  4Z1M H;  2E74 C;  1KF6 D;  2QJY C;  2QSI A;  2E74 B;  1S1C X;  4H0L B;  2WDQ C;  1KQF B;  4KT0 J;  2WU5 C;  1YQ3 C;  2WSC J;  2WDV D;  4YSY D;  3SFE D;  3SFE C;  5KLI C;  3P4P C;  2FBW C;  4YSY C;  3AEF C;  2QJK C;  1NEK D;  3S9O A;  3CIR D;  1KOR A;  2OQQ A;  3RK3 E;  1PV3 A;  1S5L X;  3D70 A;  2E75 D;  5C3J C;  2WPV B;  2WQY C;  4H44 C;  1GMJ A;  2JP3 A;  1KFY C;  2YIU C;  1Q90 D;  2BEQ D;  2YMK A;  1AJY A;  3P4P D;  3D6Y A;  3P4Q D;  1Y9B A;  1NEN C;  1KTM A;  4YXD D;  1RQV A;  3SFD D;  3Q3D A;  2WDR C;  1VF5 B;  2K9Y A;  3O6Q A;  2B76 C;  2FXP A;  1YQ4 C;  3AEA C;  2WDR D;  1RQU A;  3AE5 C;  4H13 D;  2B76 D;  4YSX D;  2D2C C;  3AE4 C;  2V7Q J;  2IDB A;  5M1B A;  2WU2 C;  4KX6 D;  1NEN D;  3FGA D;  3C8V A;  1EXI A;  2BS4 C;  2H88 D;  1K05 A;  1KQG B;  3Q5P A;  2BS3 C;  1OW6 A;  1HJ0 A;  3AEG C;  3AE1 C;  3AEE D;  3GLM A;  2E75 B;  2P10 A;  3AE9 D;  3T97 B;  1PIX A;  3AE9 C;  2H89 D;  1KMI Z;  4I7Z C;  1VF5 D;  3IAO A;  2D2C D;  1U57 A;  3IN6 A;  2ACZ C;  1TU3 F;  3AED D;  3AEB D;  4YSZ D;  3RL0 g;  2WDQ D;  4PV1 B;  3AEB C;  2MKV A;  1YQ3 D;  4XFJ A;  4YTN C;  3R4Y A;  3AEG D;  5C2T D;  1MKM A;  2O01 J;  3B71 A;  4H13 B;  3AEC D;  3AE3 C;  2H89 C;  1IK7 A;  1OMI A;  1VL2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...