3AEFC

Crystal structure of porcine heart mitochondrial complex ii with an empty quinone-binding pocket
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II with an empty quinone-binding pocket
rcsb
molecule tags Oxidoreductase
total genus 50
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3aefC01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3aefC02
4YSXD 3AEGC 1YQ3C 2H88C 3AEFD 3AECC 2WQYC 1K04A 3P4QD 2WP9C 3SFED 3VRBC 4YSXC 3AE3D 3AEFC 3P4QC 1K05A 3SFEC 2G3AA 3AE2D 3P4RD 3AE1D 3AE3C 3AEBD 2H89C 3AE6D 1KF6D 2BS2C 1ZOYD 3AE2C 1KFYD 3P4RC 3P4PD 5C2TC 3AEBC 3AE6C 1KF6C 4YXDD 1KFYC 1OW6A 3P4PC 3AE7D 1NEKD 4YTMD 3VR9D 4YXDC 3CIRC 1KTMA 2B76D 2FBWD 3AE7C 1NEKC 4YTMC 3AEDD 3VR9C 3P4SD 2BS3C 1E7PC 1PV3A 3B71A 2B76C 2FBWC 3AEAD 3AEDC 2WU5D 4YSZD 3P4SC 2WS3D 3AE1C 2BS4C 1YQ4D 3AEAC 1NEND 4YT0D 2WU5C 4KX6D 4YSZC 1ZOYC 2WS3C 1YQ4C 1ZP0D 4YT0C 3AEED 4KX6C 2WDRD 1OW8A 3AE8D 4YTND 3AE4D 2ACZD 1ZP0C 3S9OA 3ABVD 2WDRC 3AE5D 3AE8C 4YTNC 3AE4C 2ACZC 3VR8D 3ABVC 3AE5C 1OW7A 3AE9D 2WU2D 3VR8C 2WDVD 3AE9C 2WU2C 1NENC 3VRAD 1L0VD 2WDVC 2WDQD 1QLBC 2H89D 3SFDD 4YSYD 5C3JD 3AEEC 3VRAC 5C2TD 1L0VC 3SFDC 2WDQC 4YTPD 4YSYC 5C3JC 3AEGD 1YQ3D 2H88D 3AECD 4YTPC 3CIRD 2WQYD 2WP9D 3VRBD
chains in the Genus database with same CATH superfamily
1J1EB 4U3FG 3CCMP 3M0DC 4N6JA 1K04A 4C7NB 1L0LE 3H1KD 1SQXD 2G3AA 1NTKE 1E79H 1W5CE 1HVVA 2HLOA 3L75G 2G8YA 1HH0A 2E76B 1Y9BA 3N7NA 3V2NA 5CJ0A 4EIJA 3PJSK 2OARA 4L73A 3A5TA 2YMYA 1SQPJ 1LT9B 4HH2A 3P4SC 2JDIH 2Y0EA 1NTZJ 1KMIZ 3GW6A 1RY3A 1L4AC 4GODA 1L0LD 3AEED 1IJDB 4YTND 2XV5A 5KLVD 2QA4P 1ZRTE 1NTKD 1JTHB 2K1AA 2WDRC 1SQPG 1N86A 2KSJA 4NPDA 5APSA 1SQVG 4JPZB 4W7YA 1FS0E 4H44D 2WT7A 2AXTH 2E74B 1ZXGA 3CX5E 1SQQD 3H1IJ 4PV1D 4R4MA 1JY3P 1SFCC 1LP1B 3AECD 1SQPK 1NVOA 1EDJA 3VRBD 2ZVNB 2WPRA 3PLNA 1K8AQ 4L74A 4OVNF 2KUBA 3NTNA 4XFJA 4EYYQ 3PRJA 3PTZA 3SFED 4DHZA 3RK3B 1SQVK 4K35A 3RL0B 1NU1J 1RQVA 1N7SC 3AEBD 3CX5I 3HTKB 3LW5J 4IL6X 2BCCD 5AVUB 1KFYC 4ZMDA 3NXSA 3L75D 2PGDA 2OGUA 3I55P 5KKZC 1LTIC 2IFMA 1EZVG 1GL2D 1NU1G 3CX5D 5CCGD 2N1TA 3AE7C 1E7PC 4GDOA 3AE1C 1YQ4D 2ZXXA 2KP8A 2Y0DA 1KFNA 5AW7B 1ZP0C 4TLFA 1AQTA 1SS1A 4O9BA 3ABVD 2JR8A 3AE4C 1XTCC 1NU1K 1LNQA 5CCHC 1OW7A 1QVGO 1SP4A 3BRVB 1OMIA 3VMZA 3V2RA 4H44B 2WDQD 4DDIA 3L73E 3HUSC 3H1LJ 3A3YB 3MGNA 1YQ3D 2P7JA 3CIRD 3WUVA 1TFFA 4I6LA 3CX5H 5AW4B 3A0BE 3H1LG 5EFWB 2OYIA 3PH0A 3T97A 4U7JA 1EQ7A 2XNDH 3L72J 1ZOYD 1CI6A 2IYPA 1KF6C 3CCSP 1VQ7P 3P4PC 1EXJA 2H8PD 3KDPB 2B76D 1GK6A 2HR3A 3L72G 1BSHA 2ZT9B 3B8EB 5AW6B 1RF0A 1EZVD 3Q2YA 5AVVB 1VQMP 5APYA 2YMKA 2ZYGA 1G2CB 2N9BA 1N2DC 1L0NE 2Z5HA 1IK9A 4PJ0E 1ZR4A 2MJZA 4WBAA 5M1BA 4KT0J 4DOJA 2N1TC 1HWTC 3MIWA 3AE8C 3B5ND 3M9BA 1N73B 3FGAD 2WDVD 3Q1MA 3AE9C 1T6AA 2RN0A 1YI2P 2E74C 1AA0A 4JYBA 1RHZB 1OVRA 3SFDC 1M8OB 2H7HA 4H13B 1KORA 2Q6QA 3AEGC 1L0ND 1PP9E 1YJNP 1UIXA 2WP9C 1Q82Q 1QL2A 3P32A 3CCLP 1GL2A 3HE4A 1BDCA 2QM7A 3D71A 5CCGA 1QEXA 2K9JB 3A0BH 1YTZT 1JY2O 2WSSH 2JO1A 1EXIA 4ZNCA 3Q5SA 5APVA 1VQOP 1VQNP 2A06G 3QWOC 1CSBA 4OGQD 3L71G 2OYIC 1FZAA 1HJBA 3KQGA 4YSZD 1A02F 5AVRB 1A02J 2WPSA 1IFIA 1Q90D 3W67A 4IL6E 3TYYA 3A2AA 2E42A 3G71P 2QJKB 4AYCA 4YTNC 3EQ2A 1AJYA 2IBZE 2P2UA 3B5NB 2CPBA 4IOIH 1RF0C 1Y8AA 1FZGA 1OVVA 4OH8B 1X22A 4PJ0H 1IFJA 1WT6A 4LDTA 1L4AB 4Y28J 1FZBA 4Y99C 3Q5PA 4GOEA 1BDDA 3S1KA 3JC22 4H44C 4DJGA 1OXZA 2E5YA 3BRTB 3F5HA 2XU6A 3VONA 1YIJP 3M9HA 3R2PA 1GDTA 4PV1C 2IBZI 1OW8A 3AECC 3TNUA 3VRBC 3CCVP 3SFEC 1SQBE 2FKWB 1RF1B 3P4RD 5CHXA 1GU4A 1NTMG 3AEBC 3BCCD 3L70J 1S72P 1H0TB 1X9VA 1NEKD 1Q2NA 3BVHA 1BCCJ 1PPJE 2HODB 3CCEP 1N7SB 1PV3A 3I5CA 5CCGC 2ZT9C 1NOHA 1S9KE 3O6QA 1L2PA 3KYQA 2AEJA 2AEFA 2WS3D 2NPSA 2KK7A 3L71D 2W6AA 2AXCA 1BCCG 1YQ4C 5KKZB 1BE3E 1KQFB 1FZCA 2DW3A 1NTMK 3C9IA 3CWBG 1SQBD 1M57D 1T2KD 2RKLA 1GTWA 3ABVC 4IL6H 5AVYB 5H2FE 2Z4EA 4DDGA 5AVTB 1PPJD 3H1KE 2A45I 3O8ZA 3HE5B 1SQXE 1U57A 3RL0g 2WDQC 1S9KD 2GUVA 3MTUE 2O01H 1JMBA 2J58A 2KIKA 1JY3N 2XZRA 5GTIE 1YQ3C 2LKMA 1BE3D 4K3AA 5KLIB 2JWAA 2Q5UA 1M90Q 3R4YA 4XA4A 3S4RA 3GG2A 1ZN5A 4CPGA 3H1HJ 3EWKA 2ZFCA 2H89C 1AV1A 1NJIQ 1USEA 3SSUA 1VF5D 3VMAA 2K88A 4WY4A 2C9LY 1X0TA 1NTMD 2WT7B 1WRGA 2WTYA 2ZFYA 1W2EA 3H1HG 3M0AA 3P8MC 5KLVE 4GT1A 4DCKA 2B76C 3FXDA 1P84E 3L74J 2YKPA 1S5LX 4YT0D 3D70A 1YJWP 2WSCJ 5CMZA 2BEZF 2ACZD 2V4HA 1KILE 3HE5A 1SQQE 2QJKC 3L74G 3M06A 1MUUA 2YO2A 3VR8D 2M3BA 2A45H 3B5NC 1P84I 2O01N 5C39A 1NKZB 1PIXA 2R44A 5KJ7C 3RBXA 3D6YA 1FZCC 2WDVC 1QLBC 2N1TB 2Q7CA 2P1JA 5C2TD 1P84D 4D6TJ 5H2FH 1NTZG 4DZOA 1LTAC 2BCCE 4OWFA 2GM4A 1OX3A 1LTJA 2ITAA 4BRYA 3AEFD 3VOPA 2B87A 3VYIA 3L75E 4RESB 1KILD 3AE3D 5AW8B 2PFXA 4D6TG 3V4QA 1RF1C 3MUDA 2FYUJ 5GTIH 4DT0A 1R5SA 3SWKA 1JCDA 1IC2A 1NKNA 4L75A 2UWJE 1NTZK 1JY2N 3VR9D 3ZDMA 1IFNA 3H1IG 2FBWD 3W68A 2FYUG 4U3FD 2OTLP 1AFOA 2B89A 5APWA 1RE3A 4HKZH 1Y47A 3AEAD 3C1LA 1WMKA 4KX6D 4DHIB 4YSZC 1DEBA 3L73J 1SQPE 2ZVOB 1U7MA 3KHUA 2Y0CA 1P84H 1SQVE 2OYIB 1HGZA 3CD6P 4I7ZC 2OYHB 4W7ZA 1LT1A 3G4SP 1LTSC 3T97B 1NGMB 2FYUK 3L73G 2WU2D 2LXCB 1CI6B 2KOGA 1YTZI 4TT3H 1NENC 3MD0A 2M8RA 3L4FA 4YTPD 3ITKA 1KZUB 1GW3A 5AVSB 2M0BA 1SQPD 5CBOA 1DIPA 4MN4C 4Y99B 2VRSA 1NTZD 2P10A 1FOSE 5KLIC 2HPCA 1SQVD 3VN0A 1IK7A 3PHLA 5AW1B 1KYOD 3A7OA 4PV1B 1M7LA 1NYHA 3H6PA 2Q9IA 1PL5A 1DX7A 3P4RC 1VPCA 1EZVE 1L0NJ 2FXOA 2R32A 2WWWA 3VP9A 1R8EA 1LTJC 1LWUA 1RE4A 2I1JA 1NEKC 3AEDD 4KJMA 2ZXEB 2KXPB 2OYHA 3B71A 4NPEA 3MUDC 3H1ID 1VQKP 2IZ0A 1JY2P 4N78E 1VQ5P 1EZVI 1AQ5A 2WS3C 3IFMA 1KQLA 2KSEA 2WSFH 1GZLA 1NAYA 1GL2B 3HE4B 3AE5D 2YXRB 3LIDA 2LXBA 3A0HE 1RE3C 1PP9J 1NU1D 1T2KC 1FC2C 1LTTC 4GKGA 3EFFK 1S5LE 1HUCA 1VQLP 4EI2A 2ZYDA 2P58A 1KILA 3HRNA 1PP9G 2W8ZA 1YBKA 1HBWA 5BVZA 3CC7P 2NZ2A 1FE6A 2QM8A 2NPSD 2OTJP 1EDKA 4N78D 4BXLA 2O1KA 2KYVA 2QRXA 2M5AB 1BGYJ 3P4QD 2FY8A 3TF5A 4B86A 3V6IA 1ZMEC 3K5BA 1X79B 1G1JA 3IN6A 3L37A 1KB9E 1BGYG 3L72E 3IF4A 3VMXA 1VF5C 3TK1A 1AVOA 5KTBA 1KTMA 3GHGA 1KFMA 2CK3H 2W27A 5AW9B 5TJHA 1USDA 5AW3B 2O01J 2I1KA 3CXHE 3RK2D 3H1LD 1EDIA 2WMMA 1CW5A 2IBZG 3P8CD 3TSIA 4YT0C 1KB9I 2QSIA 1Q81Q 3M9QA 3TNUB 3E7KA 2K9YA 2PAJA 2ACZC 2KS1A 2OYHC 3D6ZA 1JOCA 2PP6A 4I2LC 1HTLC 3BASA 1HF9A 1KB9D 3VR8C 3CXHI 3L72D 4WY4D 2M5AA 1URQD 3TGUJ 3VRAD 3U1CA 3A0HH 4YSYD 5C3JD 3AEEC 1Z56A 2QIWA 3CXHD 2FXMA 2E43A 1DH3A 2H88D 3O6QB 1S5LH 2NPSB 3TGUG 3BCCE 4FJVA 4JBZA 1IO4A 3OAKA 1FZCB 1T3JA 3AEFC 3H1JJ 3AE1D 1OFCX 1KILC 2KI7B 3AE3C 4RKUJ 2QJYB 2O3JA 3AE6D 3Q3DA 1BE3J 3B4SA 1S3JA 2AEMA 2A06E 5KAFE 1N7LA 1EDLA 3L71E 3H32A 1OW6A 2WZ7A 2JEEA 2ZYAA 3HD7D 3CPWO 3H1JG 1M1KQ 4YPCA 3CMEP 5BU8B 3VR9C 2BS3C 3L36A 1K73Q 2FBWC 2K3RA 3CMAP 1KB9H 2R3CA 3AEAC 1JUNA 3L35A 3H1KJ 3RK2B 1VL2A 2KNCA 1LJ2A 1SQXJ 1GMJA 1VQ6P 4KX6C 2C0XA 1CZQA 4H0LD 4M3LA 2JKVA 3GHGC 4DHJA 3CXHH 3P7KA 1NHLA 5APQA 1FJPA 2YIUB 1GL2C 3KXDA 2WITA 2FXPA 1M56D 4OGQB 4YXWH 1GU5A 3L70G 2A06D 1VQ9P 2IX7C 3VP8A 4HYTB 2WU2C 4WY4B 4IFMA 4PD4D 1URQB 2Y9YA 1FAVA 4I7ZB 2E76D 2ZAEB 5APXA 1QL1A 4L76A 1R5LA 4YTPC 1L0LJ 2WQYD 3WMM0 1PGQA 2D2CD 5KLVJ 1HGVA 1NTKJ 2V7QH 1NTME 2J59M 1FDIA 1L0LG 1ZR2A 2BS2C 2WSEH 2RH0A 3WUUA 1YYCA 5KLVG 2KLVA 3IAOA 2OYOA 4UB8E 1NTKG 3G3ZA 3CCJP 3RK3E 1SQQJ 3CIRC 1SLQA 2B9BA 3F89A 2YKQA 1SFCA 2FFDA 1FDMA 5KAFH 4I1LA 1BCCE 4W80A 3AEDC 3PP5A 3UIAA 1K9MQ 3E1RA 1FBMA 4HJGH 1GW4A 3CWBE 3H25A 1SQQG 3U1AA 1PGJA 1ZOYC 1L0LK 1LTJB 2E74D 4BRYB 1OVUA 2B87B 1URQA 1NTKK 1MV8A 3CC4P 2BCCJ 1PGOA 1QLED 2YKOA 5AW2B 3FWLA 3AE5C 3L75J 2I8DA 4GOFA 4BWNA 3JSVC 4JQ0D 3RK3D 2WVRA 3L70D 3RL0D 1LGHB 2BCCG 1SQQK 3OJAB 1JEKA 3MHVA 3M91A 2B88A 1KQSO 1BCCD 2WPQA 2LR2A 4LLHA 3VMYA 3CWBD 2XNXA 3RGUA 2NPSC 2WSFJ 2D2CB 1M1JA 4IFDK 3HD7A 3P4QC 3AE2D 5KAIE 2H43A 1OZHA 1VQ8P 5CCHA 4RO0A 4U3FE 4WVZA 1JMMA 2KLUA 2QJYC 3CI9A 4I6MC 4HB1A 3H1HE 1H89A 1SQVJ 2NRGA 3TDKA 1KC8Q 3HUSA 1QX8A 2N9YB 2W6BA 2XDJA 2KZIA 1ZLLA 3GLMA 2C0WA 5AVQB 4UB8H 2WU5D 2MKVA 2JJLA 1G1IA 2PRRA 5DJTB 4GIFA 3RK2C 1DEEG 2Y9ZA 3L74E 4C7NA 3CCUP 1VF5B 5B66E 1MKMA 1MFZA 3OA7A 2GA1A 2HPCB 2M3EA 1S1CX 5CJ4A 3GF7A 3CC2P 1FOSF 2YIUC 2FFDC 3N4XA 5L8RJ 4OGQC 5AW5B 3H1HD 3II6A 5K5GB 1ZRTD 4WY4C 1LWUB 1NTZE 3KZIE 1L0VD 3NMDA 1URQC 3G6EP 4Z1MH 3VRAC 1AVYA 3FX0A 4YSYC 1LT9A 5C3JC 1JM0A 1KYOE 1PGPA 1DD4A 4D6TE 3L74D 4N3YB 3Q5RA 2H88C 4YSXD 2W90A 2ZT9D 1JTHA 2Q1KA 3WUTA 1YJ9P 5E79E 3I56P 2ZJSE 3H1IE 2YNYA 1KD1Q 3AE6C 4YXDD 2FYUE 3OW2O 1JB0J 2HYNA 2YXQB 5AVWB 1KYOI 3FWNA 4YTMD 1N8RQ 5KAIH 3C8VA 1M1JC 2E75D 2C9NY 3HD7C 2O1JA 4ZKPA 2QVAA 1KILB 1SVFA 1TU3F 2IDBA 3MZWB 1LP1A 1T3UA 1JO5A 1NU1E 4D6TD 5AVZB 1IZNB 3CCRP 3CLQA 1GK4A 4KHXA 1HJ0A 2K37A 3E1IA 2QJPB 2HFED 4XE5B 4H0LC 1OWAA 2OQQA 1L0NG 3HTKA 1JY3O 4H13D 5B66H 1Q7YQ 1NH4A 1OIPA 2FYUD 5GTHE 1J1EC 2WSCH 3VTPC 1ZW0A 1MFTA 2H89D 3GHGB 2BEQD 1GD2E 5B5EE 2R3SA 4WB4A 2R5BA 4EDFA 2P67A 4WWIA 2FYNB 1JCCA 2E76C 4EOTA 1QVFO 3KZIH 1L0NK 2WQYC 2D2CC 3L73D 2IZ1A 2Q3EA 2L5GB 1VQ4P 1KYOH 1D7MA 5CBNA 1PZQA 2KS1B 1FJKA 1LT9C 4AUWA 3H1LE 2OTKE 3LIEA 3FXEA 1KN7A 2YO3A 3P8CE 2QE7H 5TISE 2POHA 2E75B 3P4SD 2IYOA 5E79H 4AQRD 1NWQA 4ASWA 2W6JH 5DJUB 1L4AD 5KJ7D 2BS4C 2Q3IA 3V4WA 1MZ9A 4JYCA 3SWYA 3RBZA 1J2JB 2WDRD 1VDFA 2V7QJ 3G9RA 4RJTA 1J1DB 3BCCJ 2WSEJ 1X8YA 2QG4A 3LW5H 3BATA 3H32B 4LGDE 1W2BO 1H88A 3RK3C 2WPVB 1LWUC 1RE4C 1SFCD 3BCCG 5APUA 3RL0C 5APTA 3L71J 5GTHH 3V2QA 5AW0B 1RQUA 4IFFA 2IPPA 1S2EA 2KNCB 1E5WA 1G2CA 2SPZA 1SQBJ 5B5EH 1Q86Q 1N7SD 1XTGB 1K05A 1BGYE 1IFDA 1QGKB 2GUSA 3V2PA 3AE2C 1KFYD 2KZJA 5C2TC 3GF3A 2JWDA 1SQBG 1N73A 1FU1A 1PP9D 1IFMA 3AE7D 1T8ZA 1RH5B 2E5TA 3WU2E 1VQPP 1FZEA 2L91A 1LTGC 1PPJG 1NEND 2WU5C 1PFIA 3U59A 5TISH 3JCUE 1ZP0D 3AE4D 1SQBK 4UB6E 1KQGB 4PD4E 4R4LA 1BGYD 3S9OA 5CCHD 1YITP 2QJPC 2A45G 4A7PA 2K9JA 1BE3G 1NO4A 1UIIA 2RMZA 1FZFA 1NTMJ 3M0DA 1LTBC 2HG5D 3CL3D 2IFNA 4LC1A 2W83C 4NPFX 4QMAA 3GMAA 3TGUE 2IBZD 3KPEA 1L0VC 1SFCB 1FDOA 2FFDB 3SWFA 4PD4I 1EC5A 2FYNC 2Z5IA 3H1KG 1S4XA 1SQXG 3V5BA 4YSXC 3QH9A 1KV4A 3CWBJ 2R5DA 1DD3A 3B5NA 1KF6D 3H1JE 3P4PD 1L4AA 5KJ7A 1U7JA 1H8AA 4YXDC 1SQXK 4YTMC 2XKMA 2BASA 4C7RA 3TGUD 3MP7B 2E75C 1ZV8A 1BSNA 3WU2H 2CPSA 2KB7P 1N73C 2N1TD 5BU5A 1YHQP 1M1JB 3IR9A 3AE8D 3L70E 3HD7B 1RF1A 4C46A 1J1DC 2AXTE 2JP3A 3H1JD 3JCUH 3AE9D 1IFPA 4JF7A 4H13C 1H0TA 4UB6H 4PD4H 4U3FJ 1JNMA 5KLVK 2HODA 3SFDD 3HUSB 3NFQA 1NAFA 1N7SA 4H0LB 2J5UA 3CCQP 4ZKUA 2FYZA 3USSA 3AEGD 5AVXB 2QEXP 3EFGA 2WP9D 4ASVA
chains in the Genus database with same CATH topology
4YSXD 3Q5RA 3AEGC 1YQ3C 2H88C 2D2CD 4XFJA 1DIPA 3AEFD 3AECC 1K04A 2WQYC 1UIXA 2WSFJ 2D2CB 2WP9C 3P4QD 3SFED 2P10A 3VRBC 5KLIC 4YSXC 2D2CC 3AE3D 2ZT9D 3AEFC 3P4QC 1K05A 3SFEC 2G3AA 3R4YA 3D71A 3AE2D 1RQVA 3P4RD 3AE1D 1ZMEC 1IK7A 3AE3C 1FDIA 3EWKA 3AEBD 4RKUJ 4U7JA 2H89C 1DD3A 3AE6D 1KF6D 2BS2C 4PV1B 1ZOYD 1NYHA 2G8YA 2QJYC 1PL5A 3AE2C 3LW5J 3Q3DA 1KFYD 4IL6X 2E76B 3P4RC 3IN6A 3P4PD 1Y9BA 5C2TC 3AEBC 3GF3A 1VF5D 3IAOA 3AE6C 1KF6C 4YXDD 1JB0J 1KFYC 3RK3E 1OW6A 3P4PC 1R8EA 2JO1A 1EXIA 3AE7D 1NEKD 4YTMD 3Q5SA 1VF5C 3VR9D 5KKZC 4YXDC 3CIRC 1EXJA 3C8VA 1KTMA 2E75D 2B76D 2FBWD 3AE7C 1NEKC 4YTMC 3AEDD 3VR9C 2E75B 4OGQD 2BS3C 3P4SD 1E7PC 2ZT9B 1PV3A 3GLMA 3B71A 2E75C 2B76C 2FBWC 3AEAD 1TU3F 2IDBA 2ZT9C 2O01J 3AEDC 3Q2YA 2WU5D 4YSZD 3O6QA 2MKVA 3P4SC 2WP9D 4GDOA 3AE1C 2BS4C 2WS3D 1S5LX 3AEAC 1NEND 1YQ4D 4YT0D 3H25A 3D70A 1WMKA 1VL2A 2WU5C 4KX6D 4YSZC 1KMIZ 1ZOYC 2WSCJ 1Q90D 1GMJA 2YMKA 2E74D 2WS3C 1YQ4C 1VF5B 1ZP0D 4YT0C 1MKMA 1KQFB 3AEED 4KX6C 2QSIA 1HJ0A 2WDRD 2BEZF 2V7QJ 3AE8D 4H0LD 4YTND 3AE4D 5M1BA 2ACZD 1ZRTE 1ZP0C 3G9RA 1KILE 1KQGB 1S1CX 4KT0J 4R4LA 3S9OA 2K9YA 3ABVD 2WDRC 3GF7A 2QJPC 4I7ZC 3AE5D 2QJKC 3AE8C 4H0LC 4YTNC 3AE4C 1AJYA 2ACZC 2FXPA 2OQQA 2YIUC 2WSEJ 2JP3A 3T97B 4OGQB 3D6ZA 4H13D 5L8RJ 3VR8D 3ABVC 3AE5C 1NGMB 4OGQC 1OW7A 3AE9D 1HF9A 2WU2D 4H13C 3VR8C 3FGAD 4Y28J 1PIXA 4TT3H 3AE9C 3Q1MA 2WDVD 1OMIA 2WU2C 4H44D 1NENC 3Q5PA 3D6YA 3VRAD 1L0VD 2E74B 2WPVB 4H44B 2WDVC 2WDQD 1QLBC 2H89D 3SFDD 4YSYD 2E74C 1U57A 2BEQD 4H44C 3RL0g 5C3JD 3AEEC 4I7ZB 4Z1MH 4H0LB 4PV1D 4R4MA 3GMAA 3VRAC 5C2TD 1L0VC 2J5UA 1FDOA 2E76D 3SFDC 2WDQC 4YTPD 4YSYC 2QIWA 5C3JC 2NZ2A 3AEGD 4PV1C 1RQUA 1YQ3D 2FYNC 2H88D 3AECD 2E76C 4YTPC 3CIRD 2WQYD 1DD4A 4H13B 1OW8A 1KORA 3VRBD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YSX D;  3AEG C;  1YQ3 C;  2H88 C;  3AEF D;  3AEC C;  2WQY C;  1K04 A;  3P4Q D;  2WP9 C;  3SFE D;  3VRB C;  4YSX C;  3AE3 D;  3AEF C;  3P4Q C;  1K05 A;  3SFE C;  2G3A A;  3AE2 D;  3P4R D;  3AE1 D;  3AE3 C;  3AEB D;  2H89 C;  3AE6 D;  1KF6 D;  2BS2 C;  1ZOY D;  3AE2 C;  1KFY D;  3P4R C;  3P4P D;  5C2T C;  3AEB C;  3AE6 C;  1KF6 C;  4YXD D;  1KFY C;  1OW6 A;  3P4P C;  3AE7 D;  1NEK D;  4YTM D;  3VR9 D;  4YXD C;  3CIR C;  1KTM A;  2B76 D;  2FBW D;  3AE7 C;  1NEK C;  4YTM C;  3AED D;  3VR9 C;  3P4S D;  2BS3 C;  1E7P C;  1PV3 A;  3B71 A;  2B76 C;  2FBW C;  3AEA D;  3AED C;  2WU5 D;  4YSZ D;  3P4S C;  2WS3 D;  3AE1 C;  2BS4 C;  1YQ4 D;  3AEA C;  1NEN D;  4YT0 D;  2WU5 C;  4KX6 D;  4YSZ C;  1ZOY C;  2WS3 C;  1YQ4 C;  1ZP0 D;  4YT0 C;  3AEE D;  4KX6 C;  2WDR D;  1OW8 A;  3AE8 D;  4YTN D;  3AE4 D;  2ACZ D;  1ZP0 C;  3S9O A;  3ABV D;  2WDR C;  3AE5 D;  3AE8 C;  4YTN C;  3AE4 C;  2ACZ C;  3VR8 D;  3ABV C;  3AE5 C;  1OW7 A;  3AE9 D;  2WU2 D;  3VR8 C;  2WDV D;  3AE9 C;  2WU2 C;  1NEN C;  3VRA D;  1L0V D;  2WDV C;  2WDQ D;  1QLB C;  2H89 D;  3SFD D;  4YSY D;  5C3J D;  3AEE C;  3VRA C;  5C2T D;  1L0V C;  3SFD C;  2WDQ C;  4YTP D;  4YSY C;  5C3J C;  3AEG D;  1YQ3 D;  2H88 D;  3AEC D;  4YTP C;  3CIR D;  2WQY D;  2WP9 D;  3VRB D; 
#chains in the Genus database with same CATH topology
 1J1E B;  4U3F G;  3CCM P;  3M0D C;  4N6J A;  1K04 A;  4C7N B;  1L0L E;  3H1K D;  1SQX D;  2G3A A;  1NTK E;  1E79 H;  1W5C E;  1HVV A;  2HLO A;  3L75 G;  2G8Y A;  1HH0 A;  2E76 B;  1Y9B A;  3N7N A;  3V2N A;  5CJ0 A;  4EIJ A;  3PJS K;  2OAR A;  4L73 A;  3A5T A;  2YMY A;  1SQP J;  1LT9 B;  4HH2 A;  3P4S C;  2JDI H;  2Y0E A;  1NTZ J;  1KMI Z;  3GW6 A;  1RY3 A;  1L4A C;  4GOD A;  1L0L D;  3AEE D;  1IJD B;  4YTN D;  2XV5 A;  5KLV D;  2QA4 P;  1ZRT E;  1NTK D;  1JTH B;  2K1A A;  2WDR C;  1SQP G;  1N86 A;  2KSJ A;  4NPD A;  5APS A;  1SQV G;  4JPZ B;  4W7Y A;  1FS0 E;  4H44 D;  2WT7 A;  2AXT H;  2E74 B;  1ZXG A;  3CX5 E;  1SQQ D;  3H1I J;  4PV1 D;  4R4M A;  1JY3 P;  1SFC C;  1LP1 B;  3AEC D;  1SQP K;  1NVO A;  1EDJ A;  3VRB D;  2ZVN B;  2WPR A;  3PLN A;  1K8A Q;  4L74 A;  4OVN F;  2KUB A;  3NTN A;  4XFJ A;  4EYY Q;  3PRJ A;  3PTZ A;  3SFE D;  4DHZ A;  3RK3 B;  1SQV K;  4K35 A;  3RL0 B;  1NU1 J;  1RQV A;  1N7S C;  3AEB D;  3CX5 I;  3HTK B;  3LW5 J;  4IL6 X;  2BCC D;  5AVU B;  1KFY C;  4ZMD A;  3NXS A;  3L75 D;  2PGD A;  2OGU A;  3I55 P;  5KKZ C;  1LTI C;  2IFM A;  1EZV G;  1GL2 D;  1NU1 G;  3CX5 D;  5CCG D;  2N1T A;  3AE7 C;  1E7P C;  4GDO A;  3AE1 C;  1YQ4 D;  2ZXX A;  2KP8 A;  2Y0D A;  1KFN A;  5AW7 B;  1ZP0 C;  4TLF A;  1AQT A;  1SS1 A;  4O9B A;  3ABV D;  2JR8 A;  3AE4 C;  1XTC C;  1NU1 K;  1LNQ A;  5CCH C;  1OW7 A;  1QVG O;  1SP4 A;  3BRV B;  1OMI A;  3VMZ A;  3V2R A;  4H44 B;  2WDQ D;  4DDI A;  3L73 E;  3HUS C;  3H1L J;  3A3Y B;  3MGN A;  1YQ3 D;  2P7J A;  3CIR D;  3WUV A;  1TFF A;  4I6L A;  3CX5 H;  5AW4 B;  3A0B E;  3H1L G;  5EFW B;  2OYI A;  3PH0 A;  3T97 A;  4U7J A;  1EQ7 A;  2XND H;  3L72 J;  1ZOY D;  1CI6 A;  2IYP A;  1KF6 C;  3CCS P;  1VQ7 P;  3P4P C;  1EXJ A;  2H8P D;  3KDP B;  2B76 D;  1GK6 A;  2HR3 A;  3L72 G;  1BSH A;  2ZT9 B;  3B8E B;  5AW6 B;  1RF0 A;  1EZV D;  3Q2Y A;  5AVV B;  1VQM P;  5APY A;  2YMK A;  2ZYG A;  1G2C B;  2N9B A;  1N2D C;  1L0N E;  2Z5H A;  1IK9 A;  4PJ0 E;  1ZR4 A;  2MJZ A;  4WBA A;  5M1B A;  4KT0 J;  4DOJ A;  2N1T C;  1HWT C;  3MIW A;  3AE8 C;  3B5N D;  3M9B A;  1N73 B;  3FGA D;  2WDV D;  3Q1M A;  3AE9 C;  1T6A A;  2RN0 A;  1YI2 P;  2E74 C;  1AA0 A;  4JYB A;  1RHZ B;  1OVR A;  3SFD C;  1M8O B;  2H7H A;  4H13 B;  1KOR A;  2Q6Q A;  3AEG C;  1L0N D;  1PP9 E;  1YJN P;  1UIX A;  2WP9 C;  1Q82 Q;  1QL2 A;  3P32 A;  3CCL P;  1GL2 A;  3HE4 A;  1BDC A;  2QM7 A;  3D71 A;  5CCG A;  1QEX A;  2K9J B;  3A0B H;  1YTZ T;  1JY2 O;  2WSS H;  2JO1 A;  1EXI A;  4ZNC A;  3Q5S A;  5APV A;  1VQO P;  1VQN P;  2A06 G;  3QWO C;  1CSB A;  4OGQ D;  3L71 G;  2OYI C;  1FZA A;  1HJB A;  3KQG A;  4YSZ D;  1A02 F;  5AVR B;  1A02 J;  2WPS A;  1IFI A;  1Q90 D;  3W67 A;  4IL6 E;  3TYY A;  3A2A A;  2E42 A;  3G71 P;  2QJK B;  4AYC A;  4YTN C;  3EQ2 A;  1AJY A;  2IBZ E;  2P2U A;  3B5N B;  2CPB A;  4IOI H;  1RF0 C;  1Y8A A;  1FZG A;  1OVV A;  4OH8 B;  1X22 A;  4PJ0 H;  1IFJ A;  1WT6 A;  4LDT A;  1L4A B;  4Y28 J;  1FZB A;  4Y99 C;  3Q5P A;  4GOE A;  1BDD A;  3S1K A;  3JC2 2;  4H44 C;  4DJG A;  1OXZ A;  2E5Y A;  3BRT B;  3F5H A;  2XU6 A;  3VON A;  1YIJ P;  3M9H A;  3R2P A;  1GDT A;  4PV1 C;  2IBZ I;  1OW8 A;  3AEC C;  3TNU A;  3VRB C;  3CCV P;  3SFE C;  1SQB E;  2FKW B;  1RF1 B;  3P4R D;  5CHX A;  1GU4 A;  1NTM G;  3AEB C;  3BCC D;  3L70 J;  1S72 P;  1H0T B;  1X9V A;  1NEK D;  1Q2N A;  3BVH A;  1BCC J;  1PPJ E;  2HOD B;  3CCE P;  1N7S B;  1PV3 A;  3I5C A;  5CCG C;  2ZT9 C;  1NOH A;  1S9K E;  3O6Q A;  1L2P A;  3KYQ A;  2AEJ A;  2AEF A;  2WS3 D;  2NPS A;  2KK7 A;  3L71 D;  2W6A A;  2AXC A;  1BCC G;  1YQ4 C;  5KKZ B;  1BE3 E;  1KQF B;  1FZC A;  2DW3 A;  1NTM K;  3C9I A;  3CWB G;  1SQB D;  1M57 D;  1T2K D;  2RKL A;  1GTW A;  3ABV C;  4IL6 H;  5AVY B;  5H2F E;  2Z4E A;  4DDG A;  5AVT B;  1PPJ D;  3H1K E;  2A45 I;  3O8Z A;  3HE5 B;  1SQX E;  1U57 A;  3RL0 g;  2WDQ C;  1S9K D;  2GUV A;  3MTU E;  2O01 H;  1JMB A;  2J58 A;  2KIK A;  1JY3 N;  2XZR A;  5GTI E;  1YQ3 C;  2LKM A;  1BE3 D;  4K3A A;  5KLI B;  2JWA A;  2Q5U A;  1M90 Q;  3R4Y A;  4XA4 A;  3S4R A;  3GG2 A;  1ZN5 A;  4CPG A;  3H1H J;  3EWK A;  2ZFC A;  2H89 C;  1AV1 A;  1NJI Q;  1USE A;  3SSU A;  1VF5 D;  3VMA A;  2K88 A;  4WY4 A;  2C9L Y;  1X0T A;  1NTM D;  2WT7 B;  1WRG A;  2WTY A;  2ZFY A;  1W2E A;  3H1H G;  3M0A A;  3P8M C;  5KLV E;  4GT1 A;  4DCK A;  2B76 C;  3FXD A;  1P84 E;  3L74 J;  2YKP A;  1S5L X;  4YT0 D;  3D70 A;  1YJW P;  2WSC J;  5CMZ A;  2BEZ F;  2ACZ D;  2V4H A;  1KIL E;  3HE5 A;  1SQQ E;  2QJK C;  3L74 G;  3M06 A;  1MUU A;  2YO2 A;  3VR8 D;  2M3B A;  2A45 H;  3B5N C;  1P84 I;  2O01 N;  5C39 A;  1NKZ B;  1PIX A;  2R44 A;  5KJ7 C;  3RBX A;  3D6Y A;  1FZC C;  2WDV C;  1QLB C;  2N1T B;  2Q7C A;  2P1J A;  5C2T D;  1P84 D;  4D6T J;  5H2F H;  1NTZ G;  4DZO A;  1LTA C;  2BCC E;  4OWF A;  2GM4 A;  1OX3 A;  1LTJ A;  2ITA A;  4BRY A;  3AEF D;  3VOP A;  2B87 A;  3VYI A;  3L75 E;  4RES B;  1KIL D;  3AE3 D;  5AW8 B;  2PFX A;  4D6T G;  3V4Q A;  1RF1 C;  3MUD A;  2FYU J;  5GTI H;  4DT0 A;  1R5S A;  3SWK A;  1JCD A;  1IC2 A;  1NKN A;  4L75 A;  2UWJ E;  1NTZ K;  1JY2 N;  3VR9 D;  3ZDM A;  1IFN A;  3H1I G;  2FBW D;  3W68 A;  2FYU G;  4U3F D;  2OTL P;  1AFO A;  2B89 A;  5APW A;  1RE3 A;  4HKZ H;  1Y47 A;  3AEA D;  3C1L A;  1WMK A;  4KX6 D;  4DHI B;  4YSZ C;  1DEB A;  3L73 J;  1SQP E;  2ZVO B;  1U7M A;  3KHU A;  2Y0C A;  1P84 H;  1SQV E;  2OYI B;  1HGZ A;  3CD6 P;  4I7Z C;  2OYH B;  4W7Z A;  1LT1 A;  3G4S P;  1LTS C;  3T97 B;  1NGM B;  2FYU K;  3L73 G;  2WU2 D;  2LXC B;  1CI6 B;  2KOG A;  1YTZ I;  4TT3 H;  1NEN C;  3MD0 A;  2M8R A;  3L4F A;  4YTP D;  3ITK A;  1KZU B;  1GW3 A;  5AVS B;  2M0B A;  1SQP D;  5CBO A;  1DIP A;  4MN4 C;  4Y99 B;  2VRS A;  1NTZ D;  2P10 A;  1FOS E;  5KLI C;  2HPC A;  1SQV D;  3VN0 A;  1IK7 A;  3PHL A;  5AW1 B;  1KYO D;  3A7O A;  4PV1 B;  1M7L A;  1NYH A;  3H6P A;  2Q9I A;  1PL5 A;  1DX7 A;  3P4R C;  1VPC A;  1EZV E;  1L0N J;  2FXO A;  2R32 A;  2WWW A;  3VP9 A;  1R8E A;  1LTJ C;  1LWU A;  1RE4 A;  2I1J A;  1NEK C;  3AED D;  4KJM A;  2ZXE B;  2KXP B;  2OYH A;  3B71 A;  4NPE A;  3MUD C;  3H1I D;  1VQK P;  2IZ0 A;  1JY2 P;  4N78 E;  1VQ5 P;  1EZV I;  1AQ5 A;  2WS3 C;  3IFM A;  1KQL A;  2KSE A;  2WSF H;  1GZL A;  1NAY A;  1GL2 B;  3HE4 B;  3AE5 D;  2YXR B;  3LID A;  2LXB A;  3A0H E;  1RE3 C;  1PP9 J;  1NU1 D;  1T2K C;  1FC2 C;  1LTT C;  4GKG A;  3EFF K;  1S5L E;  1HUC A;  1VQL P;  4EI2 A;  2ZYD A;  2P58 A;  1KIL A;  3HRN A;  1PP9 G;  2W8Z A;  1YBK A;  1HBW A;  5BVZ A;  3CC7 P;  2NZ2 A;  1FE6 A;  2QM8 A;  2NPS D;  2OTJ P;  1EDK A;  4N78 D;  4BXL A;  2O1K A;  2KYV A;  2QRX A;  2M5A B;  1BGY J;  3P4Q D;  2FY8 A;  3TF5 A;  4B86 A;  3V6I A;  1ZME C;  3K5B A;  1X79 B;  1G1J A;  3IN6 A;  3L37 A;  1KB9 E;  1BGY G;  3L72 E;  3IF4 A;  3VMX A;  1VF5 C;  3TK1 A;  1AVO A;  5KTB A;  1KTM A;  3GHG A;  1KFM A;  2CK3 H;  2W27 A;  5AW9 B;  5TJH A;  1USD A;  5AW3 B;  2O01 J;  2I1K A;  3CXH E;  3RK2 D;  3H1L D;  1EDI A;  2WMM A;  1CW5 A;  2IBZ G;  3P8C D;  3TSI A;  4YT0 C;  1KB9 I;  2QSI A;  1Q81 Q;  3M9Q A;  3TNU B;  3E7K A;  2K9Y A;  2PAJ A;  2ACZ C;  2KS1 A;  2OYH C;  3D6Z A;  1JOC A;  2PP6 A;  4I2L C;  1HTL C;  3BAS A;  1HF9 A;  1KB9 D;  3VR8 C;  3CXH I;  3L72 D;  4WY4 D;  2M5A A;  1URQ D;  3TGU J;  3VRA D;  3U1C A;  3A0H H;  4YSY D;  5C3J D;  3AEE C;  1Z56 A;  2QIW A;  3CXH D;  2FXM A;  2E43 A;  1DH3 A;  2H88 D;  3O6Q B;  1S5L H;  2NPS B;  3TGU G;  3BCC E;  4FJV A;  4JBZ A;  1IO4 A;  3OAK A;  1FZC B;  1T3J A;  3AEF C;  3H1J J;  3AE1 D;  1OFC X;  1KIL C;  2KI7 B;  3AE3 C;  4RKU J;  2QJY B;  2O3J A;  3AE6 D;  3Q3D A;  1BE3 J;  3B4S A;  1S3J A;  2AEM A;  2A06 E;  5KAF E;  1N7L A;  1EDL A;  3L71 E;  3H32 A;  1OW6 A;  2WZ7 A;  2JEE A;  2ZYA A;  3HD7 D;  3CPW O;  3H1J G;  1M1K Q;  4YPC A;  3CME P;  5BU8 B;  3VR9 C;  2BS3 C;  3L36 A;  1K73 Q;  2FBW C;  2K3R A;  3CMA P;  1KB9 H;  2R3C A;  3AEA C;  1JUN A;  3L35 A;  3H1K J;  3RK2 B;  1VL2 A;  2KNC A;  1LJ2 A;  1SQX J;  1GMJ A;  1VQ6 P;  4KX6 C;  2C0X A;  1CZQ A;  4H0L D;  4M3L A;  2JKV A;  3GHG C;  4DHJ A;  3CXH H;  3P7K A;  1NHL A;  5APQ A;  1FJP A;  2YIU B;  1GL2 C;  3KXD A;  2WIT A;  2FXP A;  1M56 D;  4OGQ B;  4YXW H;  1GU5 A;  3L70 G;  2A06 D;  1VQ9 P;  2IX7 C;  3VP8 A;  4HYT B;  2WU2 C;  4WY4 B;  4IFM A;  4PD4 D;  1URQ B;  2Y9Y A;  1FAV A;  4I7Z B;  2E76 D;  2ZAE B;  5APX A;  1QL1 A;  4L76 A;  1R5L A;  4YTP C;  1L0L J;  2WQY D;  3WMM 0;  1PGQ A;  2D2C D;  5KLV J;  1HGV A;  1NTK J;  2V7Q H;  1NTM E;  2J59 M;  1FDI A;  1L0L G;  1ZR2 A;  2BS2 C;  2WSE H;  2RH0 A;  3WUU A;  1YYC A;  5KLV G;  2KLV A;  3IAO A;  2OYO A;  4UB8 E;  1NTK G;  3G3Z A;  3CCJ P;  3RK3 E;  1SQQ J;  3CIR C;  1SLQ A;  2B9B A;  3F89 A;  2YKQ A;  1SFC A;  2FFD A;  1FDM A;  5KAF H;  4I1L A;  1BCC E;  4W80 A;  3AED C;  3PP5 A;  3UIA A;  1K9M Q;  3E1R A;  1FBM A;  4HJG H;  1GW4 A;  3CWB E;  3H25 A;  1SQQ G;  3U1A A;  1PGJ A;  1ZOY C;  1L0L K;  1LTJ B;  2E74 D;  4BRY B;  1OVU A;  2B87 B;  1URQ A;  1NTK K;  1MV8 A;  3CC4 P;  2BCC J;  1PGO A;  1QLE D;  2YKO A;  5AW2 B;  3FWL A;  3AE5 C;  3L75 J;  2I8D A;  4GOF A;  4BWN A;  3JSV C;  4JQ0 D;  3RK3 D;  2WVR A;  3L70 D;  3RL0 D;  1LGH B;  2BCC G;  1SQQ K;  3OJA B;  1JEK A;  3MHV A;  3M91 A;  2B88 A;  1KQS O;  1BCC D;  2WPQ A;  2LR2 A;  4LLH A;  3VMY A;  3CWB D;  2XNX A;  3RGU A;  2NPS C;  2WSF J;  2D2C B;  1M1J A;  4IFD K;  3HD7 A;  3P4Q C;  3AE2 D;  5KAI E;  2H43 A;  1OZH A;  1VQ8 P;  5CCH A;  4RO0 A;  4U3F E;  4WVZ A;  1JMM A;  2KLU A;  2QJY C;  3CI9 A;  4I6M C;  4HB1 A;  3H1H E;  1H89 A;  1SQV J;  2NRG A;  3TDK A;  1KC8 Q;  3HUS A;  1QX8 A;  2N9Y B;  2W6B A;  2XDJ A;  2KZI A;  1ZLL A;  3GLM A;  2C0W A;  5AVQ B;  4UB8 H;  2WU5 D;  2MKV A;  2JJL A;  1G1I A;  2PRR A;  5DJT B;  4GIF A;  3RK2 C;  1DEE G;  2Y9Z A;  3L74 E;  4C7N A;  3CCU P;  1VF5 B;  5B66 E;  1MKM A;  1MFZ A;  3OA7 A;  2GA1 A;  2HPC B;  2M3E A;  1S1C X;  5CJ4 A;  3GF7 A;  3CC2 P;  1FOS F;  2YIU C;  2FFD C;  3N4X A;  5L8R J;  4OGQ C;  5AW5 B;  3H1H D;  3II6 A;  5K5G B;  1ZRT D;  4WY4 C;  1LWU B;  1NTZ E;  3KZI E;  1L0V D;  3NMD A;  1URQ C;  3G6E P;  4Z1M H;  3VRA C;  1AVY A;  3FX0 A;  4YSY C;  1LT9 A;  5C3J C;  1JM0 A;  1KYO E;  1PGP A;  1DD4 A;  4D6T E;  3L74 D;  4N3Y B;  3Q5R A;  2H88 C;  4YSX D;  2W90 A;  2ZT9 D;  1JTH A;  2Q1K A;  3WUT A;  1YJ9 P;  5E79 E;  3I56 P;  2ZJS E;  3H1I E;  2YNY A;  1KD1 Q;  3AE6 C;  4YXD D;  2FYU E;  3OW2 O;  1JB0 J;  2HYN A;  2YXQ B;  5AVW B;  1KYO I;  3FWN A;  4YTM D;  1N8R Q;  5KAI H;  3C8V A;  1M1J C;  2E75 D;  2C9N Y;  3HD7 C;  2O1J A;  4ZKP A;  2QVA A;  1KIL B;  1SVF A;  1TU3 F;  2IDB A;  3MZW B;  1LP1 A;  1T3U A;  1JO5 A;  1NU1 E;  4D6T D;  5AVZ B;  1IZN B;  3CCR P;  3CLQ A;  1GK4 A;  4KHX A;  1HJ0 A;  2K37 A;  3E1I A;  2QJP B;  2HFE D;  4XE5 B;  4H0L C;  1OWA A;  2OQQ A;  1L0N G;  3HTK A;  1JY3 O;  4H13 D;  5B66 H;  1Q7Y Q;  1NH4 A;  1OIP A;  2FYU D;  5GTH E;  1J1E C;  2WSC H;  3VTP C;  1ZW0 A;  1MFT A;  2H89 D;  3GHG B;  2BEQ D;  1GD2 E;  5B5E E;  2R3S A;  4WB4 A;  2R5B A;  4EDF A;  2P67 A;  4WWI A;  2FYN B;  1JCC A;  2E76 C;  4EOT A;  1QVF O;  3KZI H;  1L0N K;  2WQY C;  2D2C C;  3L73 D;  2IZ1 A;  2Q3E A;  2L5G B;  1VQ4 P;  1KYO H;  1D7M A;  5CBN A;  1PZQ A;  2KS1 B;  1FJK A;  1LT9 C;  4AUW A;  3H1L E;  2OTK E;  3LIE A;  3FXE A;  1KN7 A;  2YO3 A;  3P8C E;  2QE7 H;  5TIS E;  2POH A;  2E75 B;  3P4S D;  2IYO A;  5E79 H;  4AQR D;  1NWQ A;  4ASW A;  2W6J H;  5DJU B;  1L4A D;  5KJ7 D;  2BS4 C;  2Q3I A;  3V4W A;  1MZ9 A;  4JYC A;  3SWY A;  3RBZ A;  1J2J B;  2WDR D;  1VDF A;  2V7Q J;  3G9R A;  4RJT A;  1J1D B;  3BCC J;  2WSE J;  1X8Y A;  2QG4 A;  3LW5 H;  3BAT A;  3H32 B;  4LGD E;  1W2B O;  1H88 A;  3RK3 C;  2WPV B;  1LWU C;  1RE4 C;  1SFC D;  3BCC G;  5APU A;  3RL0 C;  5APT A;  3L71 J;  5GTH H;  3V2Q A;  5AW0 B;  1RQU A;  4IFF A;  2IPP A;  1S2E A;  2KNC B;  1E5W A;  1G2C A;  2SPZ A;  1SQB J;  5B5E H;  1Q86 Q;  1N7S D;  1XTG B;  1K05 A;  1BGY E;  1IFD A;  1QGK B;  2GUS A;  3V2P A;  3AE2 C;  1KFY D;  2KZJ A;  5C2T C;  3GF3 A;  2JWD A;  1SQB G;  1N73 A;  1FU1 A;  1PP9 D;  1IFM A;  3AE7 D;  1T8Z A;  1RH5 B;  2E5T A;  3WU2 E;  1VQP P;  1FZE A;  2L91 A;  1LTG C;  1PPJ G;  1NEN D;  2WU5 C;  1PFI A;  3U59 A;  5TIS H;  3JCU E;  1ZP0 D;  3AE4 D;  1SQB K;  4UB6 E;  1KQG B;  4PD4 E;  4R4L A;  1BGY D;  3S9O A;  5CCH D;  1YIT P;  2QJP C;  2A45 G;  4A7P A;  2K9J A;  1BE3 G;  1NO4 A;  1UII A;  2RMZ A;  1FZF A;  1NTM J;  3M0D A;  1LTB C;  2HG5 D;  3CL3 D;  2IFN A;  4LC1 A;  2W83 C;  4NPF X;  4QMA A;  3GMA A;  3TGU E;  2IBZ D;  3KPE A;  1L0V C;  1SFC B;  1FDO A;  2FFD B;  3SWF A;  4PD4 I;  1EC5 A;  2FYN C;  2Z5I A;  3H1K G;  1S4X A;  1SQX G;  3V5B A;  4YSX C;  3QH9 A;  1KV4 A;  3CWB J;  2R5D A;  1DD3 A;  3B5N A;  1KF6 D;  3H1J E;  3P4P D;  1L4A A;  5KJ7 A;  1U7J A;  1H8A A;  4YXD C;  1SQX K;  4YTM C;  2XKM A;  2BAS A;  4C7R A;  3TGU D;  3MP7 B;  2E75 C;  1ZV8 A;  1BSN A;  3WU2 H;  2CPS A;  2KB7 P;  1N73 C;  2N1T D;  5BU5 A;  1YHQ P;  1M1J B;  3IR9 A;  3AE8 D;  3L70 E;  3HD7 B;  1RF1 A;  4C46 A;  1J1D C;  2AXT E;  2JP3 A;  3H1J D;  3JCU H;  3AE9 D;  1IFP A;  4JF7 A;  4H13 C;  1H0T A;  4UB6 H;  4PD4 H;  4U3F J;  1JNM A;  5KLV K;  2HOD A;  3SFD D;  3HUS B;  3NFQ A;  1NAF A;  1N7S A;  4H0L B;  2J5U A;  3CCQ P;  4ZKU A;  2FYZ A;  3USS A;  3AEG D;  5AVX B;  2QEX P;  3EFG A;  2WP9 D;  4ASV A; 
#chains in the Genus database with same CATH homology
 4YSX D;  3Q5R A;  3AEG C;  1YQ3 C;  2H88 C;  2D2C D;  4XFJ A;  1DIP A;  3AEF D;  3AEC C;  1K04 A;  2WQY C;  1UIX A;  2WSF J;  2D2C B;  2WP9 C;  3P4Q D;  3SFE D;  2P10 A;  3VRB C;  5KLI C;  4YSX C;  2D2C C;  3AE3 D;  2ZT9 D;  3AEF C;  3P4Q C;  1K05 A;  3SFE C;  2G3A A;  3R4Y A;  3D71 A;  3AE2 D;  1RQV A;  3P4R D;  3AE1 D;  1ZME C;  1IK7 A;  3AE3 C;  1FDI A;  3EWK A;  3AEB D;  4RKU J;  4U7J A;  2H89 C;  1DD3 A;  3AE6 D;  1KF6 D;  2BS2 C;  4PV1 B;  1ZOY D;  1NYH A;  2G8Y A;  2QJY C;  1PL5 A;  3AE2 C;  3LW5 J;  3Q3D A;  1KFY D;  4IL6 X;  2E76 B;  3P4R C;  3IN6 A;  3P4P D;  1Y9B A;  5C2T C;  3AEB C;  3GF3 A;  1VF5 D;  3IAO A;  3AE6 C;  1KF6 C;  4YXD D;  1JB0 J;  1KFY C;  3RK3 E;  1OW6 A;  3P4P C;  1R8E A;  2JO1 A;  1EXI A;  3AE7 D;  1NEK D;  4YTM D;  3Q5S A;  1VF5 C;  3VR9 D;  5KKZ C;  4YXD C;  3CIR C;  1EXJ A;  3C8V A;  1KTM A;  2E75 D;  2B76 D;  2FBW D;  3AE7 C;  1NEK C;  4YTM C;  3AED D;  3VR9 C;  2E75 B;  4OGQ D;  2BS3 C;  3P4S D;  1E7P C;  2ZT9 B;  1PV3 A;  3GLM A;  3B71 A;  2E75 C;  2B76 C;  2FBW C;  3AEA D;  1TU3 F;  2IDB A;  2ZT9 C;  2O01 J;  3AED C;  3Q2Y A;  2WU5 D;  4YSZ D;  3O6Q A;  2MKV A;  3P4S C;  2WP9 D;  4GDO A;  3AE1 C;  2BS4 C;  2WS3 D;  1S5L X;  3AEA C;  1NEN D;  1YQ4 D;  4YT0 D;  3H25 A;  3D70 A;  1WMK A;  1VL2 A;  2WU5 C;  4KX6 D;  4YSZ C;  1KMI Z;  1ZOY C;  2WSC J;  1Q90 D;  1GMJ A;  2YMK A;  2E74 D;  2WS3 C;  1YQ4 C;  1VF5 B;  1ZP0 D;  4YT0 C;  1MKM A;  1KQF B;  3AEE D;  4KX6 C;  2QSI A;  1HJ0 A;  2WDR D;  2BEZ F;  2V7Q J;  3AE8 D;  4H0L D;  4YTN D;  3AE4 D;  5M1B A;  2ACZ D;  1ZRT E;  1ZP0 C;  3G9R A;  1KIL E;  1KQG B;  1S1C X;  4KT0 J;  4R4L A;  3S9O A;  2K9Y A;  3ABV D;  2WDR C;  3GF7 A;  2QJP C;  4I7Z C;  3AE5 D;  2QJK C;  3AE8 C;  4H0L C;  4YTN C;  3AE4 C;  1AJY A;  2ACZ C;  2FXP A;  2OQQ A;  2YIU C;  2WSE J;  2JP3 A;  3T97 B;  4OGQ B;  3D6Z A;  4H13 D;  5L8R J;  3VR8 D;  3ABV C;  3AE5 C;  1NGM B;  4OGQ C;  1OW7 A;  3AE9 D;  1HF9 A;  2WU2 D;  4H13 C;  3VR8 C;  3FGA D;  4Y28 J;  1PIX A;  4TT3 H;  3AE9 C;  3Q1M A;  2WDV D;  1OMI A;  2WU2 C;  4H44 D;  1NEN C;  3Q5P A;  3D6Y A;  3VRA D;  1L0V D;  2E74 B;  2WPV B;  4H44 B;  2WDV C;  2WDQ D;  1QLB C;  2H89 D;  3SFD D;  4YSY D;  2E74 C;  1U57 A;  2BEQ D;  4H44 C;  3RL0 g;  5C3J D;  3AEE C;  4I7Z B;  4Z1M H;  4H0L B;  4PV1 D;  4R4M A;  3GMA A;  3VRA C;  5C2T D;  1L0V C;  2J5U A;  1FDO A;  2E76 D;  3SFD C;  2WDQ C;  4YTP D;  4YSY C;  2QIW A;  5C3J C;  2NZ2 A;  3AEG D;  4PV1 C;  1RQU A;  1YQ3 D;  2FYN C;  2H88 D;  3AEC D;  2E76 C;  4YTP C;  3CIR D;  2WQY D;  1DD4 A;  4H13 B;  1OW8 A;  1KOR A;  3VRB D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...