3AEFC

Crystal structure of porcine heart mitochondrial complex ii with an empty quinone-binding pocket
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
138
structure length
138
Chain Sequence
b'TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II with an empty quinone-binding pocket
rcsb
molecule tags Oxidoreductase
total genus 50
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3aefC01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3aefC02
4YTPD 4YTMC 2B76C 2H89C 3P4PD 4YSXC 3AE1D 3VR8C 2WU5C 3AE2D 3AEFD 3AE5D 3AEDC 3AEBD 2BS2C 2FBWD 1NEND 3P4QD 3AE3C 2ACZC 3AEAD 1PV3A 3AEEC 1KF6D 1NEKD 2WDVC 3AECD 3AEGD 4YXDC 3P4RD 1YQ4D 2H88C 4KX6D 3SFED 1OW7A 3ABVC 2WDRC 3AE6C 2WDQC 3VRAC 1E7PC 1K05A 3CIRC 2WQYD 3AE4D 3AE9C 1ZOYC 5C2TC 3AE2C 4YSZD 1L0VD 1YQ3D 3VR9C 3VRBC 1QLBC 1ZP0C 3AE8C 2WP9C 3AE7C 5C3JC 4YTNC 4YSYC 3SFDC 4YTMD 2WS3C 2B76D 1KFYC 2H89D 3P4SC 4YSXD 2WU2C 3VR8D 2WU5D 3B71A 3AEDD 4YT0C 4YTPC 3P4PC 3AE3D 2ACZD 3AEED 3AE1C 3AEFC 2WDVD 3AE5C 3AEBC 2FBWC 4YXDD 2H88D 1K04A 1NENC 3P4QC 3AEAC 3ABVD 2WDRD 3AE6D 1KF6C 1NEKC 2WDQD 3AECC 3VRAD 1OW6A 2G3AA 3AEGC 3CIRD 1KTMA 1YQ4C 3P4RC 3AE9D 1ZOYD 4KX6C 5C2TD 1OW8A 3SFEC 3VR9D 3VRBD 1ZP0D 3AE8D 2WP9D 3AE7D 5C3JD 4YTND 4YSYD 3SFDD 2WQYC 3S9OA 3AE4C 2WS3D 1KFYD 4YSZC 2BS3C 1YQ3C 1L0VC 3P4SD 2WU2D 2BS4C 4YT0D
chains in the Genus database with same CATH superfamily
5TJHA 1RY3A 4HJGH 1PPJD 3KXDA 3AE1D 4EYYQ 1N86A 3Q3DA 3HUSA 3AE3C 2WDVC 1USDA 3CXHE 1FZBA 1GDTA 1LTAC 3CCQP 3RK3C 1IC2A 4GOFA 3BRTB 2R5BA 1T3JA 2QM8A 5AW0B 5C2TC 1L0VD 1VPCA 2Q9IA 3RK2D 1N7SD 1J1EB 3RBXA 2NRGA 2GM4A 5APYA 5APSA 4C46A 3TDKA 3KPEA 3P7KA 3B5NB 2E5TA 4ZMDA 1J1DB 3M91A 4WY4B 2WU2C 3H1JE 1R5SA 1PPJG 3NTNA 2V4HA 1NKZB 1P84E 1W2EA 1SQBE 1LJ2A 2ACZD 1FJKA 3V4WA 2XNDH 2IZ1A 2C0XA 3W67A 3AEBC 5GTHE 1QVGO 4GDOA 1GZLA 4TT3H 3CPWO 3L71G 2ZT9C 3AECC 4YPCA 1QL1A 1KTMA 3CXHH 4HH2A 1URQB 3VRBD 2IFMA 2IBZI 1FDIA 1EZVI 2Q3IA 1JEKA 3H1LG 2JP3A 3C1LA 2BS3C 1GL2A 4R4MA 1PGJA 2V7QJ 2R5DA 2Z4EA 1JY3O 2B76C 2Q3EA 2D2CC 3P4PD 1MZ9A 3BCCJ 3L74J 1PP9J 3AE5D 1LWUC 1FS0E 4LGDE 1PPJE 2YO2A 2L5GB 1UIIA 1SQXJ 1P84H 1VF5C 5AVSB 1SQQD 1N73B 3V4QA 3A3YB 5GTHH 1KYOI 3PRJA 2WDRC 3PHLA 2E76D 1JM0A 3CIRC 1RF1C 5EFWB 5DJTB 5AVYB 1VQ7P 1L0LG 1MKMA 1EDIA 2ZVNB 3AE7C 2N9BA 3A0HE 1FBMA 3VR8D 1PGQA 3H1LE 1NGMB 4AUWA 3L70J 1MUUA 1FZCB 4H13D 1NTMJ 1SVFA 1SQQK 3A7OA 4JF7A 4N6JA 2QE7H 2W6JH 1JY3N 4U7JA 1NU1J 2QG4A 5KAFE 2FXMA 2YMYA 1LTTC 2QJPC 3OJAB 1RE4A 3B5NA 3CC7P 4WY4A 1CZQA 1ZP0D 4DZOA 2WP9D 1BGYG 2KUBA 3CLQA 3JCUE 3CCEP 2K88A 1KC8Q 4ASVA 3P32A 1Y8AA 4DJGA 3A0HH 1VQOP 1TFFA 1PFIA 2O01N 4PD4E 2QJYB 3Q5SA 1L0NJ 1URQA 3MGNA 2YIUB 5H2FE 3P8MC 4YXDC 1IFNA 5AVVB 4KX6D 2OTKE 2QA4P 5APXA 2FY8A 1SQQE 2WSSH 3L72J 1HJ0A 2KS1B 3LW5J 5KAFH 1E7PC 2FYUK 5L8RJ 1T2KC 2WZ7A 4L75A 2H7HA 4GKGA 3U59A 1BGYE 4IL6X 3JCUH 4OH8B 1G1JA 2WU5D 1HBWA 3RK3B 2WSFJ 1N73A 2IYPA 1YTZI 1T3UA 1SLQA 3AE1C 3CWBD 2E74D 1HGVA 2M3EA 1QL2A 4PD4H 2IBZD 4WVZA 3M9BA 2G3AA 2YXQB 5H2FH 1EZVD 1LT9C 3H1KG 2LR2A 3L73G 2Y0DA 2IPPA 4I7ZB 2IZ0A 3JSVC 1FZCA 1IK7A 3V2PA 3H1HG 1L0VC 3RK2C 1N7SC 2LKMA 2BCCD 2O3JA 5KLVJ 1PIXA 4N78E 1NOHA 1EDKA 1QEXA 1LTBC 3D71A 2FFDC 2OYHA 5DJUB 2ACZC 1KYOD 1PV3A 1NEKD 5KJ7D 1RH5B 2MKVA 1NTKG 2HG5D 1X8YA 2P67A 1KB9I 2HR3A 2D2CB 2YXRB 3EFFK 2XKMA 1LWUB 1NWQA 1GW3A 1NKNA 2HYNA 1ZW0A 1OWAA 3M0DA 3VRBC 2YNYA 1VF5B 3H1KE 3L73E 4YTMD 1KILE 3HTKB 1JCCA 1S9KE 2BCCG 1EDJA 1W2BO 2QRXA 3H1HE 1SQPG 4OGQD 3CCMP 5M1BA 3KYQA 3P4PC 2J58A 2KS1A 1JMBA 3AE5C 3TGUG 3VN0A 1MFTA 1FU1A 2KB7P 1KFNA 1ZLLA 4D6TG 5CCGA 3VOPA 3AE9D 1NTKE 2QJKC 2IBZE 3HD7B 1Q86Q 3UIAA 1S5LX 3E1IA 3VYIA 1QVFO 2E76C 2IX7C 1RE3A 1U57A 1BCCG 2KZJA 2FXPA 2XU6A 4KT0J 1Q82Q 2K9JB 4H44C 1KQLA 3VR8C 1N8RQ 1SFCB 4U3FD 2BCCE 1XTGB 1L4AD 4H13C 4Z1MH 1SQPE 3AEAD 2FYZA 2OTLP 2ZXXA 1OMIA 3N4XA 5AVWB 4WWIA 3TGUE 3MTUE 1KN7A 3H1IJ 5KKZC 5C39A 1S4XA 1HVVA 1JY2P 1YQ3D 3B4SA 1ZP0C 3KHUA 2WP9C 2E43A 2K37A 2Q7CA 1EXIA 1A02F 3RL0B 2WSCJ 1FOSF 3L75J 4DHIB 4BRYB 1BCCE 4KJMA 3R2PA 3ZDMA 3TF5A 3QH9A 2O01H 1BE3D 1X22A 1M57D 5KTBA 4IL6E 1LWUA 2RN0A 3GHGC 2AXCA 3VRAD 3SWKA 1FOSE 3H32B 4TLFA 3HTKA 4KX6C 1VQ4P 3PJSK 1M1JC 4FJVA 2OTJP 3CC4P 3C8VA 1K9MQ 2ITAA 3U1CA 2BS4C 3VP9A 2IFNA 2KI7B 3Q2YA 1IFMA 1H8AA 2WU5C 1NAFA 1BE3G 1IFIA 2KLVA 1FAVA 2PFXA 2WSEH 1AFOA 2ZFYA 5KLIC 3HD7A 3EFGA 2O1KA 1S1CX 2E74C 1AQ5A 2YO3A 3RK2B 1SQVG 4IL6H 5CCHA 3EWKA 1DX7A 3V6IA 3CX5I 2K9JA 3K5BA 3I56P 5AW2B 1SFCA 1NTZK 2YKQA 1WRGA 1AVYA 4NPEA 4W80A 3CMAP 3H1JJ 2KLUA 1ZV8A 3D6YA 1GL2D 1NTZJ 5K5GB 1SQBJ 3AEED 1LP1B 3P8CE 1KV4A 4IFMA 1GMJA 1BE3E 1RF0A 1K04A 1ZRTD 2Y9ZA 3LIEA 3BCCD 3L74D 1PP9D 1NEKC 5KJ7C 3CL3D 4H0LD 1JTHB 1SQXD 1SQVE 1KQGB 1EQ7A 1PL5A 2WMMA 4BRYA 1VDFA 1AV1A 4DOJA 2P58A 2XZRA 4RO0A 1Q2NA 4YTMC 3I55P 1S5LE 2N1TB 3H32A 1BDCA 4OGQC 2E76B 3WUVA 3H25A 1E79H 3L74G 1PP9G 3L70D 3AEGD 2NPSB 1KB9E 4PV1B 1NTMD 1SQXK 2YKPA 2ZYDA 1Z56A 3L71J 4C7NB 3AE9C 4H13B 1NU1D 1QLBC 2QIWA 3B5ND 4WY4D 1MV8A 4M3LA 2JO1A 2WVRA 3H1LJ 1LTIC 2B9BA 3B71A 1PGOA 1CW5A 3FGAD 1VQ6P 1S5LH 2I1JA 1L4AC 1NTMK 3AEAC 2FYNC 3BASA 4H44D 2A45I 1OW6A 1ZR2A 1OXZA 2ZFCA 4BXLA 1DH3A 1ZRTE 1KMIZ 1L0ND 3OAKA 1KB9H 3L74E 3CCRP 4ZKUA 1PP9E 3VR9D 1NU1K 1RQUA 3VTPC 4O9BA 1FJPA 5AW7B 4B86A 3FWNA 1HF9A 2BEZF 1YQ3C 1SQQG 1LP1A 2PRRA 1L0LJ 3L72D 2KYVA 4YT0D 1YJNP 4YTPD 2MJZA 1VQNP 1G1IA 2WITA 4WBAA 1VL2A 3G3ZA 1JTHA 3P4QD 1DEBA 2FYUD 3GW6A 2VRSA 2QVAA 1K8AQ 2E75B 1KILB 1Y47A 4Y28J 4HYTB 3CX5D 2KK7A 3MIWA 1L0NK 3L36A 1M90Q 3CMEP 1RQVA 3R4YA 3HUSC 4LLHA 3VRAC 2V7QH 1R8EA 5AVZB 1AJYA 2N1TA 2P7JA 3AE2C 2WTYA 5KLIB 4BWNA 1JNMA 3CCLP 2KZIA 2J59M 1BGYJ 1X9VA 3OW2O 3FXEA 2NPSA 2JDIH 2RH0A 3A2AA 3TNUB 1VQMP 1BSHA 2FYUG 1QX8A 4C7NA 1ZN5A 3MHVA 5KLVD 1LT1A 1SS1A 3CCSP 4IFDK 3MUDA 4MN4C 2OQQA 1ZOYD 1OW8A 3BVHA 1E5WA 2ZJSE 1LTJC 3PH0A 5AW4B 5CBNA 1IFJA 3CXHI 2XV5A 5CJ0A 2LXCB 1OZHA 1JMMA 2W90A 1GL2C 2FBWD 1PGPA 5KLVK 3AEEC 1KD1Q 1IZNB 3PP5A 2FYUE 3S1KA 2ZT9B 3E1RA 4K3AA 2N9YB 3B8EB 1FZAA 3U1AA 3VMXA 4H0LC 3C9IA 2WQYD 5CCGD 3CWBG 2IYOA 3H1KJ 3VP8A 3SWFA 2M5AB 3L73J 4GT1A 2PAJA 4RKUJ 2IBZG 1KQFB 1KILA 3H1HJ 1AQTA 1EZVG 3AEDD 5AVTB 4W7ZA 3WU2E 1J2JB 4I6MC 3LW5H 2Z5HA 3M9HA 2FKWB 1FZFA 5CMZA 4DDIA 3V2RA 2LXBA 2WPSA 1FZGA 2ZYGA 3AEGC 3Q1MA 3TYYA 4DHZA 4ASWA 5AW6B 1NTKJ 5BVZA 3Q5PA 1RHZB 4L74A 1RF1B 2PGDA 4YTND 3SFDD 2WSFH 1G2CB 1J1EC 3TNUA 3P4SD 3GF7A 4OWFA 1YHQP 1LTSC 3B5NC 3H1ID 1DD3A 3CWBE 1GD2E 1J1DC 4WY4C 3NFQA 1VQ8P 2O01J 3O6QB 2M3BA 2SPZA 1OVRA 5APVA 2B88A 3AEFD 2BS2C 4EOTA 5AW8B 2KSJA 1SQPJ 1EZVE 1QLED 3II6A 2RKLA 1KF6D 3L75D 4EI2A 3M06A 2H8PD 3WU2H 1K73Q 3TGUJ 3MZWB 5AVRB 2K1AA 1OFCX 4I1LA 2QJPB 3TK1A 1OX3A 4D6TJ 2WT7B 2CK3H 2YKOA 2C9LY 3VR9C 4DCKA 1NAYA 2W6BA 3OA7A 3IR9A 5AVUB 2H89D 2XDJA 2HPCB 2WSEJ 1KYOE 2HODB 1AVOA 1BCCJ 4YT0C 4YTPC 5AVQB 4LC1A 5APUA 4RESB 1JY3P 1A02J 3P4QC 1N73C 3KDPB 1GTWA 3AE6D 2M5AA 2YMKA 3HD7D 5CHXA 4GIFA 2Y9YA 4U3FG 3CXHD 1JUNA 5C3JD 4PD4I 4YSYD 2BASA 2GUVA 5CCHD 4GODA 3O8ZA 1YBKA 2KOGA 3JC22 1HGZA 3CC2P 4Y99C 1SFCD 1W5CE 4IFFA 1IFPA 1U7JA 2Y0CA 1DD4A 1FZCC 3RL0g 3HE5B 4DHJA 3GMAA 3AE2D 1NJIQ 1KYOH 1M1KQ 1YTZT 1LTJB 2QM7A 2KNCB 3CD6P 5AW9B 1RF1A 2I8DA 1NTZD 1G2CA 1SQBD 1IK9A 2E42A 2POHA 1LT9B 2OYHC 2J5UA 3GF3A 1ZOYC 3WUUA 3RL0D 4U3FE 2OYIC 2CPSA 2W8ZA 1N7SB 1YIJP 2KIKA 4KHXA 3VONA 3M0DC 2FXOA 1HUCA 1EDLA 5B5EE 3D6ZA 1DIPA 2WT7A 2FFDB 2FBWC 2YIUC 1SQBK 1T6AA 5B66E 1NTZG 1NYHA 1JOCA 1R5LA 4ZNCA 2WDQD 1SQVJ 2WSCH 2HPCA 3L37A 3L35A 2HODA 1CI6B 3VMZA 3V5BA 2WQYC 2WS3D 4I2LC 3EQ2A 5CCGC 1Q90D 2OARA 3L71D 1WMKA 4JQ0D 1NVOA 1RE3C 4A7PA 2O1JA 3AEDC 2BEQD 5APTA 1VQ5P 1HTLC 5GTIE 3NMDA 3H1LD 1GK6A 1S2EA 3KQGA 5B5EH 3CCJP 3H6PA 5B66H 1M7LA 1NTZE 1H89A 3V2NA 2QJKB 1LTGC 2KXPB 3AE4D 4I7ZC 4YSZD 1GW4A 3HE5A 3S4RA 3WMM0 1JB0J 4YTNC 3SFDC 1LTJA 2KNCA 2B89A 3BCCG 3P4SC 4YSXD 1VQ9P 2P2UA 4RJTA 2P10A 3D70A 2AEMA 4H44B 1VQLP 1ZXGA 1SQXG 1L0LD 3AEFC 1LT9A 4NPFX 1FE6A 1JY2O 1IFDA 1KF6C 5GTIH 1DEEG 2P1JA 4PD4D 1KZUB 3VMYA 1N7SA 4EIJA 5KKZB 3CCVP 5TISE 3AE8D 1FZEA 3M0AA 1EC5A 1USEA 3S9OA 1KFYD 2KP8A 2N1TD 3L70G 2FFDA 1NTMG 3LIDA 1URQD 4IOIH 2IDBA 2H89C 2AXTE 4WB4A 5AW1B 3L71E 1L0LK 3BCCE 1BGYD 2GA1A 1HH0A 1NU1G 1NEND 2NPSD 2Y0EA 3IFMA 1SQXE 4PV1D 3GHGB 1CI6A 1JO5A 3GG2A 3P4RD 1YQ4D 4Y99B 1M56D 1FDMA 1OW7A 3AE6C 3HD7C 2W83C 1T8ZA 2RMZA 1M1JB 4AQRD 1H88A 1JY2N 3USSA 5TISH 5C3JC 3FXDA 4YSYC 5CCHC 3SSUA 2W6AA 3KZIE 2CPBA 1SQQJ 4R4LA 1L0NG 1SFCC 2OYHB 3L70E 4XFJA 1IJDB 2Z5IA 1NTME 3CI9A 5KAIE 2AXTH 3BATA 2OYIB 1YI2P 2H88D 2E74B 3L72G 1L0LE 2QSIA 3ABVD 3M9QA 4N78D 1NU1E 3W68A 4UB6E 2JEEA 2R3SA 2NZ2A 3RBZA 1RF0C 5AW3B 1YJWP 2QEXP 1M8OB 4DT0A 2PP6A 3G6EP 3RL0C 1NH4A 4XA4A 3MD0A 3ITKA 1ZMEC 1H0TB 2JWAA 1FC2C 3H1KD 3KZIH 3PLNA 3L73D 2E75D 1KILD 1S9KD 1Q7YQ 3HE4B 2R44A 1L0NE 1ZR4A 5AVXB 3H1HD 4HB1A 4XE5B 5KAIH 2FYUJ 5APQA 3SFED 2K9YA 1LGHB 1L2PA 2WDQC 3L72E 1PZQA 4L73A 3A5TA 1S3JA 4UB6H 3A0BE 3QWOC 3L4FA 5BU8B 3BRVB 2A06D 5KLVG 1KQSO 3MP7B 2Q1KA 2WS3C 1NTKD 3NXSA 1N7LA 5APWA 3CCUP 4JYBA 3N7NA 3GHGA 1QGKB 1HJBA 5CJ4A 1GU4A 1P84I 3CX5E 4QMAA 3AE3D 3G9RA 1VQPP 4OGQB 2WDVD 3G71P 4EDFA 2JWDA 2Q5UA 5BU5A 1M1JA 1GK4A 3RK3D 3FX0A 2K3RA 1Y9BA 1BDDA 2WPQA 2M8RA 1SQPD 1VQKP 5C2TD 2M0BA 2GUSA 1JCDA 2G8YA 2B87B 3PTZA 3TSIA 3TGUD 3Q5RA 3AE4C 2A06G 1NTKK 1HWTC 1KFMA 4YSZC 2H43A 3A0BH 2WU2D 3CWBJ 4K35A 2WPRA 4D6TD 2OYIA 3T97B 1WT6A 2ZXEB 5KLVE 4YSXC 3AEBD 1KORA 1NHLA 3IF4A 1D7MA 4I6LA 1L4AB 2UWJE 3CX5H 2ZT9D 4NPDA 3AECD 1OVUA 1BCCD 2ZVOB 1RE4C 4W7YA 2FYNB 1SQPK 1GU5A 1Q81Q 1H0TA 1AA0A 2BCCJ 1K05A 2OGUA 2ZAEB 3WUTA 2A45G 3AE8C 1IO4A 3VMAA 1X0TA 4JYCA 3RGUA 3SWYA 3HE4A 2I1KA 2B76D 1KFYC 2D2CD 1SP4A 2A06E 2N1TC 3GLMA 1URQC 5KJ7A 1EXJA 1VF5D 5AW5B 3IN6A 2JJLA 2C0WA 2ZYAA 3F5HA 1N2DC 4GOEA 1NENC 1OIPA 4PJ0E 2NPSC 3H1IG 1X79B 2WDRD 4CPGA 1LNQA 4PV1C 4DDGA 2R32A 2XNXA 3CIRD 1BSNA 1YQ4C 3P4RC 3IAOA 3RK3E 3HUSB 5E79E 3E7KA 4JBZA 2DW3A 1YITP 3AE7D 3MUDC 1S72P 1YYCA 2W27A 2AEFA 3L75G 4JPZB 2JKVA 2E5YA 4UB8E 2C9NY 4D6TE 1NO4A 4OVNF 1OVVA 2R3CA 3G4SP 2B87A 5CBOA 2H88C 3ABVC 4PJ0H 1MFZA 1FDOA 3I5CA 3H1IE 3P8CD 3T97A 2KSEA 3V2QA 1YJ9P 5E79H 3HRNA 1CSBA 4U3FJ 3H1JD 1SQVD 1P84D 1L4AA 2AEJA 3L75E 2Q6QA 2JR8A 1U7MA 4ZKPA 2A45H 3O6QA 2L91A 4UB8H 1GL2B 1UIXA 4YXDD 2E75C 1KILC 4YXWH 4C7RA 2WWWA 4L76A 4AYCA 3SFEC 2HLOA 4H0LB 1T2KD 1TU3F 4N3YB 3F89A 1KB9D 2QJYC 3H1JG 4HKZH 1SQVK 1BE3J 2HFED 2WPVB 4LDTA 2OYOA 3FWLA 1XTCC 1SQBG
chains in the Genus database with same CATH topology
2O01J 4YTPD 4YTMC 3T97B 1WMKA 2B76C 1PIXA 4H44C 2D2CC 2H89C 2IDBA 3P4PD 4YSXC 1DD4A 3RL0g 3AE1D 3VR8C 3Q2YA 2WU5C 3GMAA 3AE2D 3AEFD 3AE5D 1VL2A 3Q3DA 3AEDC 3AEBD 1KORA 2BS2C 2FBWD 2BEQD 2E75D 3D71A 4OGQC 4H13C 4Z1MH 5KLIC 3Q5SA 2E76B 1NEND 3P4QD 1VF5C 3AE3C 2ACZC 3AEAD 1PV3A 1S1CX 3AEEC 4PV1D 1KF6D 1OMIA 1NEKD 2E74C 2E75B 2ZT9D 3H25A 2WDVC 3AECD 2MKVA 4Y28J 3AEGD 4YXDC 3P4RD 1YQ4D 4PV1B 2H88C 4KX6D 2ZT9B 3SFED 1OW7A 3ABVC 2WDRC 3AE6C 2D2CB 3EWKA 2K9YA 1RQVA 3R4YA 5KKZC 1HJ0A 2WDQC 1FDOA 3VRAC 3LW5J 1E7PC 2E76D 1K05A 4H0LC 1R8EA 2WQYD 2J5UA 1AJYA 3AE4D 5L8RJ 4I7ZC 3CIRC 3GF3A 3AE9C 1ZOYC 5C2TC 3AE2C 4YSZD 1L0VD 1YQ3D 1MKMA 4H13B 3VR9C 3VRBC 1QLBC 1ZP0C 1VF5B 2QIWA 3AE8C 2WP9C 3AE7C 5C3JC 1JB0J 4YTNC 1EXIA 4YSYC 3SFDC 4YTMD 2JO1A 2WS3C 1KILE 2WSCJ 4RKUJ 1KFYC 2B76D 2D2CD 2H89D 4IL6X 3P4SC 4YSXD 2WU2C 3VR8D 2WSEJ 1KQFB 2WU5D 2P10A 3D6YA 3D70A 3GLMA 3B71A 1NGMB 3AEDD 2WSFJ 4H44B 4YT0C 4R4LA 4YTPC 4OGQD 5M1BA 4XFJA 4H13D 3FGAD 2BS4C 3O6QA 1EXJA 1VF5D 3P4PC 3AE3D 3G9RA 2ACZD 3IN6A 3AEED 3AE1C 2E74D 1UIXA 4OGQB 3AEFC 3D6ZA 3AE5C 1DIPA 2WDVD 3AEBC 2FBWC 2YIUC 4YXDD 2E75C 4GDOA 4U7JA 1GMJA 2H88D 1K04A 2E74B 1NENC 3P4QC 1NYHA 4TT3H 2QSIA 3AEAC 3ABVD 2WDRD 2FYNC 3AE6D 4PV1C 1KF6C 1NEKC 2YMKA 4H44D 2ZT9C 2WDQD 3AECC 3VRAD 1Y9BA 1OW6A 2G3AA 3AEGC 2OQQA 2QJPC 4H0LD 3Q1MA 1KTMA 1YQ4C 1ZRTE 3CIRD 3P4RC 3IAOA 3AE9D 1KMIZ 1ZOYD 4KX6C 5C2TD 3RK3E 1OW8A 2QJKC 3SFEC 3VR9D 3VRBD 2NZ2A 1KQGB 1RQUA 3Q5PA 1ZP0D 4H0LB 1S5LX 2WP9D 1FDIA 1TU3F 3AE7D 3AE8D 2G8YA 4I7ZB 5C3JD 4YTND 1PL5A 4YSYD 2QJYC 3SFDD 2E76C 2WQYC 1IK7A 3S9OA 2BEZF 3AE4C 3Q5RA 1HF9A 2WS3D 1KFYD 2JP3A 4YSZC 2BS3C 1YQ3C 1L0VC 3P4SD 2WPVB 3C8VA 3GF7A 1U57A 2WU2D 2FXPA 4R4MA 1Q90D 1DD3A 2V7QJ 1ZMEC 4KT0J 4YT0D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YTP D;  4YTM C;  2B76 C;  2H89 C;  3P4P D;  4YSX C;  3AE1 D;  3VR8 C;  2WU5 C;  3AE2 D;  3AEF D;  3AE5 D;  3AED C;  3AEB D;  2BS2 C;  2FBW D;  1NEN D;  3P4Q D;  3AE3 C;  2ACZ C;  3AEA D;  1PV3 A;  3AEE C;  1KF6 D;  1NEK D;  2WDV C;  3AEC D;  3AEG D;  4YXD C;  3P4R D;  1YQ4 D;  2H88 C;  4KX6 D;  3SFE D;  1OW7 A;  3ABV C;  2WDR C;  3AE6 C;  2WDQ C;  3VRA C;  1E7P C;  1K05 A;  3CIR C;  2WQY D;  3AE4 D;  3AE9 C;  1ZOY C;  5C2T C;  3AE2 C;  4YSZ D;  1L0V D;  1YQ3 D;  3VR9 C;  3VRB C;  1QLB C;  1ZP0 C;  3AE8 C;  2WP9 C;  3AE7 C;  5C3J C;  4YTN C;  4YSY C;  3SFD C;  4YTM D;  2WS3 C;  2B76 D;  1KFY C;  2H89 D;  3P4S C;  4YSX D;  2WU2 C;  3VR8 D;  2WU5 D;  3B71 A;  3AED D;  4YT0 C;  4YTP C;  3P4P C;  3AE3 D;  2ACZ D;  3AEE D;  3AE1 C;  3AEF C;  2WDV D;  3AE5 C;  3AEB C;  2FBW C;  4YXD D;  2H88 D;  1K04 A;  1NEN C;  3P4Q C;  3AEA C;  3ABV D;  2WDR D;  3AE6 D;  1KF6 C;  1NEK C;  2WDQ D;  3AEC C;  3VRA D;  1OW6 A;  2G3A A;  3AEG C;  3CIR D;  1KTM A;  1YQ4 C;  3P4R C;  3AE9 D;  1ZOY D;  4KX6 C;  5C2T D;  1OW8 A;  3SFE C;  3VR9 D;  3VRB D;  1ZP0 D;  3AE8 D;  2WP9 D;  3AE7 D;  5C3J D;  4YTN D;  4YSY D;  3SFD D;  2WQY C;  3S9O A;  3AE4 C;  2WS3 D;  1KFY D;  4YSZ C;  2BS3 C;  1YQ3 C;  1L0V C;  3P4S D;  2WU2 D;  2BS4 C;  4YT0 D; 
#chains in the Genus database with same CATH topology
 5TJH A;  1RY3 A;  4HJG H;  1PPJ D;  3KXD A;  3AE1 D;  4EYY Q;  1N86 A;  3Q3D A;  3HUS A;  3AE3 C;  2WDV C;  1USD A;  3CXH E;  1FZB A;  1GDT A;  1LTA C;  3CCQ P;  3RK3 C;  1IC2 A;  4GOF A;  3BRT B;  2R5B A;  1T3J A;  2QM8 A;  5AW0 B;  5C2T C;  1L0V D;  1VPC A;  2Q9I A;  3RK2 D;  1N7S D;  1J1E B;  3RBX A;  2NRG A;  2GM4 A;  5APY A;  5APS A;  4C46 A;  3TDK A;  3KPE A;  3P7K A;  3B5N B;  2E5T A;  4ZMD A;  1J1D B;  3M91 A;  4WY4 B;  2WU2 C;  3H1J E;  1R5S A;  1PPJ G;  3NTN A;  2V4H A;  1NKZ B;  1P84 E;  1W2E A;  1SQB E;  1LJ2 A;  2ACZ D;  1FJK A;  3V4W A;  2XND H;  2IZ1 A;  2C0X A;  3W67 A;  3AEB C;  5GTH E;  1QVG O;  4GDO A;  1GZL A;  4TT3 H;  3CPW O;  3L71 G;  2ZT9 C;  3AEC C;  4YPC A;  1QL1 A;  1KTM A;  3CXH H;  4HH2 A;  1URQ B;  3VRB D;  2IFM A;  2IBZ I;  1FDI A;  1EZV I;  2Q3I A;  1JEK A;  3H1L G;  2JP3 A;  3C1L A;  2BS3 C;  1GL2 A;  4R4M A;  1PGJ A;  2V7Q J;  2R5D A;  2Z4E A;  1JY3 O;  2B76 C;  2Q3E A;  2D2C C;  3P4P D;  1MZ9 A;  3BCC J;  3L74 J;  1PP9 J;  3AE5 D;  1LWU C;  1FS0 E;  4LGD E;  1PPJ E;  2YO2 A;  2L5G B;  1UII A;  1SQX J;  1P84 H;  1VF5 C;  5AVS B;  1SQQ D;  1N73 B;  3V4Q A;  3A3Y B;  5GTH H;  1KYO I;  3PRJ A;  2WDR C;  3PHL A;  2E76 D;  1JM0 A;  3CIR C;  1RF1 C;  5EFW B;  5DJT B;  5AVY B;  1VQ7 P;  1L0L G;  1MKM A;  1EDI A;  2ZVN B;  3AE7 C;  2N9B A;  3A0H E;  1FBM A;  3VR8 D;  1PGQ A;  3H1L E;  1NGM B;  4AUW A;  3L70 J;  1MUU A;  1FZC B;  4H13 D;  1NTM J;  1SVF A;  1SQQ K;  3A7O A;  4JF7 A;  4N6J A;  2QE7 H;  2W6J H;  1JY3 N;  4U7J A;  1NU1 J;  2QG4 A;  5KAF E;  2FXM A;  2YMY A;  1LTT C;  2QJP C;  3OJA B;  1RE4 A;  3B5N A;  3CC7 P;  4WY4 A;  1CZQ A;  1ZP0 D;  4DZO A;  2WP9 D;  1BGY G;  2KUB A;  3CLQ A;  3JCU E;  3CCE P;  2K88 A;  1KC8 Q;  4ASV A;  3P32 A;  1Y8A A;  4DJG A;  3A0H H;  1VQO P;  1TFF A;  1PFI A;  2O01 N;  4PD4 E;  2QJY B;  3Q5S A;  1L0N J;  1URQ A;  3MGN A;  2YIU B;  5H2F E;  3P8M C;  4YXD C;  1IFN A;  5AVV B;  4KX6 D;  2OTK E;  2QA4 P;  5APX A;  2FY8 A;  1SQQ E;  2WSS H;  3L72 J;  1HJ0 A;  2KS1 B;  3LW5 J;  5KAF H;  1E7P C;  2FYU K;  5L8R J;  1T2K C;  2WZ7 A;  4L75 A;  2H7H A;  4GKG A;  3U59 A;  1BGY E;  4IL6 X;  3JCU H;  4OH8 B;  1G1J A;  2WU5 D;  1HBW A;  3RK3 B;  2WSF J;  1N73 A;  2IYP A;  1YTZ I;  1T3U A;  1SLQ A;  3AE1 C;  3CWB D;  2E74 D;  1HGV A;  2M3E A;  1QL2 A;  4PD4 H;  2IBZ D;  4WVZ A;  3M9B A;  2G3A A;  2YXQ B;  5H2F H;  1EZV D;  1LT9 C;  3H1K G;  2LR2 A;  3L73 G;  2Y0D A;  2IPP A;  4I7Z B;  2IZ0 A;  3JSV C;  1FZC A;  1IK7 A;  3V2P A;  3H1H G;  1L0V C;  3RK2 C;  1N7S C;  2LKM A;  2BCC D;  2O3J A;  5KLV J;  1PIX A;  4N78 E;  1NOH A;  1EDK A;  1QEX A;  1LTB C;  3D71 A;  2FFD C;  2OYH A;  5DJU B;  2ACZ C;  1KYO D;  1PV3 A;  1NEK D;  5KJ7 D;  1RH5 B;  2MKV A;  1NTK G;  2HG5 D;  1X8Y A;  2P67 A;  1KB9 I;  2HR3 A;  2D2C B;  2YXR B;  3EFF K;  2XKM A;  1LWU B;  1NWQ A;  1GW3 A;  1NKN A;  2HYN A;  1ZW0 A;  1OWA A;  3M0D A;  3VRB C;  2YNY A;  1VF5 B;  3H1K E;  3L73 E;  4YTM D;  1KIL E;  3HTK B;  1JCC A;  1S9K E;  2BCC G;  1EDJ A;  1W2B O;  2QRX A;  3H1H E;  1SQP G;  4OGQ D;  3CCM P;  5M1B A;  3KYQ A;  3P4P C;  2J58 A;  2KS1 A;  1JMB A;  3AE5 C;  3TGU G;  3VN0 A;  1MFT A;  1FU1 A;  2KB7 P;  1KFN A;  1ZLL A;  4D6T G;  5CCG A;  3VOP A;  3AE9 D;  1NTK E;  2QJK C;  2IBZ E;  3HD7 B;  1Q86 Q;  3UIA A;  1S5L X;  3E1I A;  3VYI A;  1QVF O;  2E76 C;  2IX7 C;  1RE3 A;  1U57 A;  1BCC G;  2KZJ A;  2FXP A;  2XU6 A;  4KT0 J;  1Q82 Q;  2K9J B;  4H44 C;  1KQL A;  3VR8 C;  1N8R Q;  1SFC B;  4U3F D;  2BCC E;  1XTG B;  1L4A D;  4H13 C;  4Z1M H;  1SQP E;  3AEA D;  2FYZ A;  2OTL P;  2ZXX A;  1OMI A;  3N4X A;  5AVW B;  4WWI A;  3TGU E;  3MTU E;  1KN7 A;  3H1I J;  5KKZ C;  5C39 A;  1S4X A;  1HVV A;  1JY2 P;  1YQ3 D;  3B4S A;  1ZP0 C;  3KHU A;  2WP9 C;  2E43 A;  2K37 A;  2Q7C A;  1EXI A;  1A02 F;  3RL0 B;  2WSC J;  1FOS F;  3L75 J;  4DHI B;  4BRY B;  1BCC E;  4KJM A;  3R2P A;  3ZDM A;  3TF5 A;  3QH9 A;  2O01 H;  1BE3 D;  1X22 A;  1M57 D;  5KTB A;  4IL6 E;  1LWU A;  2RN0 A;  3GHG C;  2AXC A;  3VRA D;  3SWK A;  1FOS E;  3H32 B;  4TLF A;  3HTK A;  4KX6 C;  1VQ4 P;  3PJS K;  1M1J C;  4FJV A;  2OTJ P;  3CC4 P;  3C8V A;  1K9M Q;  2ITA A;  3U1C A;  2BS4 C;  3VP9 A;  2IFN A;  2KI7 B;  3Q2Y A;  1IFM A;  1H8A A;  2WU5 C;  1NAF A;  1BE3 G;  1IFI A;  2KLV A;  1FAV A;  2PFX A;  2WSE H;  1AFO A;  2ZFY A;  5KLI C;  3HD7 A;  3EFG A;  2O1K A;  1S1C X;  2E74 C;  1AQ5 A;  2YO3 A;  3RK2 B;  1SQV G;  4IL6 H;  5CCH A;  3EWK A;  1DX7 A;  3V6I A;  3CX5 I;  2K9J A;  3K5B A;  3I56 P;  5AW2 B;  1SFC A;  1NTZ K;  2YKQ A;  1WRG A;  1AVY A;  4NPE A;  4W80 A;  3CMA P;  3H1J J;  2KLU A;  1ZV8 A;  3D6Y A;  1GL2 D;  1NTZ J;  5K5G B;  1SQB J;  3AEE D;  1LP1 B;  3P8C E;  1KV4 A;  4IFM A;  1GMJ A;  1BE3 E;  1RF0 A;  1K04 A;  1ZRT D;  2Y9Z A;  3LIE A;  3BCC D;  3L74 D;  1PP9 D;  1NEK C;  5KJ7 C;  3CL3 D;  4H0L D;  1JTH B;  1SQX D;  1SQV E;  1KQG B;  1EQ7 A;  1PL5 A;  2WMM A;  4BRY A;  1VDF A;  1AV1 A;  4DOJ A;  2P58 A;  2XZR A;  4RO0 A;  1Q2N A;  4YTM C;  3I55 P;  1S5L E;  2N1T B;  3H32 A;  1BDC A;  4OGQ C;  2E76 B;  3WUV A;  3H25 A;  1E79 H;  3L74 G;  1PP9 G;  3L70 D;  3AEG D;  2NPS B;  1KB9 E;  4PV1 B;  1NTM D;  1SQX K;  2YKP A;  2ZYD A;  1Z56 A;  3L71 J;  4C7N B;  3AE9 C;  4H13 B;  1NU1 D;  1QLB C;  2QIW A;  3B5N D;  4WY4 D;  1MV8 A;  4M3L A;  2JO1 A;  2WVR A;  3H1L J;  1LTI C;  2B9B A;  3B71 A;  1PGO A;  1CW5 A;  3FGA D;  1VQ6 P;  1S5L H;  2I1J A;  1L4A C;  1NTM K;  3AEA C;  2FYN C;  3BAS A;  4H44 D;  2A45 I;  1OW6 A;  1ZR2 A;  1OXZ A;  2ZFC A;  4BXL A;  1DH3 A;  1ZRT E;  1KMI Z;  1L0N D;  3OAK A;  1KB9 H;  3L74 E;  3CCR P;  4ZKU A;  1PP9 E;  3VR9 D;  1NU1 K;  1RQU A;  3VTP C;  4O9B A;  1FJP A;  5AW7 B;  4B86 A;  3FWN A;  1HF9 A;  2BEZ F;  1YQ3 C;  1SQQ G;  1LP1 A;  2PRR A;  1L0L J;  3L72 D;  2KYV A;  4YT0 D;  1YJN P;  4YTP D;  2MJZ A;  1VQN P;  1G1I A;  2WIT A;  4WBA A;  1VL2 A;  3G3Z A;  1JTH A;  3P4Q D;  1DEB A;  2FYU D;  3GW6 A;  2VRS A;  2QVA A;  1K8A Q;  2E75 B;  1KIL B;  1Y47 A;  4Y28 J;  4HYT B;  3CX5 D;  2KK7 A;  3MIW A;  1L0N K;  3L36 A;  1M90 Q;  3CME P;  1RQV A;  3R4Y A;  3HUS C;  4LLH A;  3VRA C;  2V7Q H;  1R8E A;  5AVZ B;  1AJY A;  2N1T A;  2P7J A;  3AE2 C;  2WTY A;  5KLI B;  4BWN A;  1JNM A;  3CCL P;  2KZI A;  2J59 M;  1BGY J;  1X9V A;  3OW2 O;  3FXE A;  2NPS A;  2JDI H;  2RH0 A;  3A2A A;  3TNU B;  1VQM P;  1BSH A;  2FYU G;  1QX8 A;  4C7N A;  1ZN5 A;  3MHV A;  5KLV D;  1LT1 A;  1SS1 A;  3CCS P;  4IFD K;  3MUD A;  4MN4 C;  2OQQ A;  1ZOY D;  1OW8 A;  3BVH A;  1E5W A;  2ZJS E;  1LTJ C;  3PH0 A;  5AW4 B;  5CBN A;  1IFJ A;  3CXH I;  2XV5 A;  5CJ0 A;  2LXC B;  1OZH A;  1JMM A;  2W90 A;  1GL2 C;  2FBW D;  1PGP A;  5KLV K;  3AEE C;  1KD1 Q;  1IZN B;  3PP5 A;  2FYU E;  3S1K A;  2ZT9 B;  3E1R A;  4K3A A;  2N9Y B;  3B8E B;  1FZA A;  3U1A A;  3VMX A;  4H0L C;  3C9I A;  2WQY D;  5CCG D;  3CWB G;  2IYO A;  3H1K J;  3VP8 A;  3SWF A;  2M5A B;  3L73 J;  4GT1 A;  2PAJ A;  4RKU J;  2IBZ G;  1KQF B;  1KIL A;  3H1H J;  1AQT A;  1EZV G;  3AED D;  5AVT B;  4W7Z A;  3WU2 E;  1J2J B;  4I6M C;  3LW5 H;  2Z5H A;  3M9H A;  2FKW B;  1FZF A;  5CMZ A;  4DDI A;  3V2R A;  2LXB A;  2WPS A;  1FZG A;  2ZYG A;  3AEG C;  3Q1M A;  3TYY A;  4DHZ A;  4ASW A;  5AW6 B;  1NTK J;  5BVZ A;  3Q5P A;  1RHZ B;  4L74 A;  1RF1 B;  2PGD A;  4YTN D;  3SFD D;  2WSF H;  1G2C B;  1J1E C;  3TNU A;  3P4S D;  3GF7 A;  4OWF A;  1YHQ P;  1LTS C;  3B5N C;  3H1I D;  1DD3 A;  3CWB E;  1GD2 E;  1J1D C;  4WY4 C;  3NFQ A;  1VQ8 P;  2O01 J;  3O6Q B;  2M3B A;  2SPZ A;  1OVR A;  5APV A;  2B88 A;  3AEF D;  2BS2 C;  4EOT A;  5AW8 B;  2KSJ A;  1SQP J;  1EZV E;  1QLE D;  3II6 A;  2RKL A;  1KF6 D;  3L75 D;  4EI2 A;  3M06 A;  2H8P D;  3WU2 H;  1K73 Q;  3TGU J;  3MZW B;  5AVR B;  2K1A A;  1OFC X;  4I1L A;  2QJP B;  3TK1 A;  1OX3 A;  4D6T J;  2WT7 B;  2CK3 H;  2YKO A;  2C9L Y;  3VR9 C;  4DCK A;  1NAY A;  2W6B A;  3OA7 A;  3IR9 A;  5AVU B;  2H89 D;  2XDJ A;  2HPC B;  2WSE J;  1KYO E;  2HOD B;  1AVO A;  1BCC J;  4YT0 C;  4YTP C;  5AVQ B;  4LC1 A;  5APU A;  4RES B;  1JY3 P;  1A02 J;  3P4Q C;  1N73 C;  3KDP B;  1GTW A;  3AE6 D;  2M5A A;  2YMK A;  3HD7 D;  5CHX A;  4GIF A;  2Y9Y A;  4U3F G;  3CXH D;  1JUN A;  5C3J D;  4PD4 I;  4YSY D;  2BAS A;  2GUV A;  5CCH D;  4GOD A;  3O8Z A;  1YBK A;  2KOG A;  3JC2 2;  1HGZ A;  3CC2 P;  4Y99 C;  1SFC D;  1W5C E;  4IFF A;  1IFP A;  1U7J A;  2Y0C A;  1DD4 A;  1FZC C;  3RL0 g;  3HE5 B;  4DHJ A;  3GMA A;  3AE2 D;  1NJI Q;  1KYO H;  1M1K Q;  1YTZ T;  1LTJ B;  2QM7 A;  2KNC B;  3CD6 P;  5AW9 B;  1RF1 A;  2I8D A;  1NTZ D;  1G2C A;  1SQB D;  1IK9 A;  2E42 A;  2POH A;  1LT9 B;  2OYH C;  2J5U A;  3GF3 A;  1ZOY C;  3WUU A;  3RL0 D;  4U3F E;  2OYI C;  2CPS A;  2W8Z A;  1N7S B;  1YIJ P;  2KIK A;  4KHX A;  3VON A;  3M0D C;  2FXO A;  1HUC A;  1EDL A;  5B5E E;  3D6Z A;  1DIP A;  2WT7 A;  2FFD B;  2FBW C;  2YIU C;  1SQB K;  1T6A A;  5B66 E;  1NTZ G;  1NYH A;  1JOC A;  1R5L A;  4ZNC A;  2WDQ D;  1SQV J;  2WSC H;  2HPC A;  3L37 A;  3L35 A;  2HOD A;  1CI6 B;  3VMZ A;  3V5B A;  2WQY C;  2WS3 D;  4I2L C;  3EQ2 A;  5CCG C;  1Q90 D;  2OAR A;  3L71 D;  1WMK A;  4JQ0 D;  1NVO A;  1RE3 C;  4A7P A;  2O1J A;  3AED C;  2BEQ D;  5APT A;  1VQ5 P;  1HTL C;  5GTI E;  3NMD A;  3H1L D;  1GK6 A;  1S2E A;  3KQG A;  5B5E H;  3CCJ P;  3H6P A;  5B66 H;  1M7L A;  1NTZ E;  1H89 A;  3V2N A;  2QJK B;  1LTG C;  2KXP B;  3AE4 D;  4I7Z C;  4YSZ D;  1GW4 A;  3HE5 A;  3S4R A;  3WMM 0;  1JB0 J;  4YTN C;  3SFD C;  1LTJ A;  2KNC A;  2B89 A;  3BCC G;  3P4S C;  4YSX D;  1VQ9 P;  2P2U A;  4RJT A;  2P10 A;  3D70 A;  2AEM A;  4H44 B;  1VQL P;  1ZXG A;  1SQX G;  1L0L D;  3AEF C;  1LT9 A;  4NPF X;  1FE6 A;  1JY2 O;  1IFD A;  1KF6 C;  5GTI H;  1DEE G;  2P1J A;  4PD4 D;  1KZU B;  3VMY A;  1N7S A;  4EIJ A;  5KKZ B;  3CCV P;  5TIS E;  3AE8 D;  1FZE A;  3M0A A;  1EC5 A;  1USE A;  3S9O A;  1KFY D;  2KP8 A;  2N1T D;  3L70 G;  2FFD A;  1NTM G;  3LID A;  1URQ D;  4IOI H;  2IDB A;  2H89 C;  2AXT E;  4WB4 A;  5AW1 B;  3L71 E;  1L0L K;  3BCC E;  1BGY D;  2GA1 A;  1HH0 A;  1NU1 G;  1NEN D;  2NPS D;  2Y0E A;  3IFM A;  1SQX E;  4PV1 D;  3GHG B;  1CI6 A;  1JO5 A;  3GG2 A;  3P4R D;  1YQ4 D;  4Y99 B;  1M56 D;  1FDM A;  1OW7 A;  3AE6 C;  3HD7 C;  2W83 C;  1T8Z A;  2RMZ A;  1M1J B;  4AQR D;  1H88 A;  1JY2 N;  3USS A;  5TIS H;  5C3J C;  3FXD A;  4YSY C;  5CCH C;  3SSU A;  2W6A A;  3KZI E;  2CPB A;  1SQQ J;  4R4L A;  1L0N G;  1SFC C;  2OYH B;  3L70 E;  4XFJ A;  1IJD B;  2Z5I A;  1NTM E;  3CI9 A;  5KAI E;  2AXT H;  3BAT A;  2OYI B;  1YI2 P;  2H88 D;  2E74 B;  3L72 G;  1L0L E;  2QSI A;  3ABV D;  3M9Q A;  4N78 D;  1NU1 E;  3W68 A;  4UB6 E;  2JEE A;  2R3S A;  2NZ2 A;  3RBZ A;  1RF0 C;  5AW3 B;  1YJW P;  2QEX P;  1M8O B;  4DT0 A;  2PP6 A;  3G6E P;  3RL0 C;  1NH4 A;  4XA4 A;  3MD0 A;  3ITK A;  1ZME C;  1H0T B;  2JWA A;  1FC2 C;  3H1K D;  3KZI H;  3PLN A;  3L73 D;  2E75 D;  1KIL D;  1S9K D;  1Q7Y Q;  3HE4 B;  2R44 A;  1L0N E;  1ZR4 A;  5AVX B;  3H1H D;  4HB1 A;  4XE5 B;  5KAI H;  2FYU J;  5APQ A;  3SFE D;  2K9Y A;  1LGH B;  1L2P A;  2WDQ C;  3L72 E;  1PZQ A;  4L73 A;  3A5T A;  1S3J A;  4UB6 H;  3A0B E;  3QWO C;  3L4F A;  5BU8 B;  3BRV B;  2A06 D;  5KLV G;  1KQS O;  3MP7 B;  2Q1K A;  2WS3 C;  1NTK D;  3NXS A;  1N7L A;  5APW A;  3CCU P;  4JYB A;  3N7N A;  3GHG A;  1QGK B;  1HJB A;  5CJ4 A;  1GU4 A;  1P84 I;  3CX5 E;  4QMA A;  3AE3 D;  3G9R A;  1VQP P;  4OGQ B;  2WDV D;  3G71 P;  4EDF A;  2JWD A;  2Q5U A;  5BU5 A;  1M1J A;  1GK4 A;  3RK3 D;  3FX0 A;  2K3R A;  1Y9B A;  1BDD A;  2WPQ A;  2M8R A;  1SQP D;  1VQK P;  5C2T D;  2M0B A;  2GUS A;  1JCD A;  2G8Y A;  2B87 B;  3PTZ A;  3TSI A;  3TGU D;  3Q5R A;  3AE4 C;  2A06 G;  1NTK K;  1HWT C;  1KFM A;  4YSZ C;  2H43 A;  3A0B H;  2WU2 D;  3CWB J;  4K35 A;  2WPR A;  4D6T D;  2OYI A;  3T97 B;  1WT6 A;  2ZXE B;  5KLV E;  4YSX C;  3AEB D;  1KOR A;  1NHL A;  3IF4 A;  1D7M A;  4I6L A;  1L4A B;  2UWJ E;  3CX5 H;  2ZT9 D;  4NPD A;  3AEC D;  1OVU A;  1BCC D;  2ZVO B;  1RE4 C;  4W7Y A;  2FYN B;  1SQP K;  1GU5 A;  1Q81 Q;  1H0T A;  1AA0 A;  2BCC J;  1K05 A;  2OGU A;  2ZAE B;  3WUT A;  2A45 G;  3AE8 C;  1IO4 A;  3VMA A;  1X0T A;  4JYC A;  3RGU A;  3SWY A;  3HE4 A;  2I1K A;  2B76 D;  1KFY C;  2D2C D;  1SP4 A;  2A06 E;  2N1T C;  3GLM A;  1URQ C;  5KJ7 A;  1EXJ A;  1VF5 D;  5AW5 B;  3IN6 A;  2JJL A;  2C0W A;  2ZYA A;  3F5H A;  1N2D C;  4GOE A;  1NEN C;  1OIP A;  4PJ0 E;  2NPS C;  3H1I G;  1X79 B;  2WDR D;  4CPG A;  1LNQ A;  4PV1 C;  4DDG A;  2R32 A;  2XNX A;  3CIR D;  1BSN A;  1YQ4 C;  3P4R C;  3IAO A;  3RK3 E;  3HUS B;  5E79 E;  3E7K A;  4JBZ A;  2DW3 A;  1YIT P;  3AE7 D;  3MUD C;  1S72 P;  1YYC A;  2W27 A;  2AEF A;  3L75 G;  4JPZ B;  2JKV A;  2E5Y A;  4UB8 E;  2C9N Y;  4D6T E;  1NO4 A;  4OVN F;  1OVV A;  2R3C A;  3G4S P;  2B87 A;  5CBO A;  2H88 C;  3ABV C;  4PJ0 H;  1MFZ A;  1FDO A;  3I5C A;  3H1I E;  3P8C D;  3T97 A;  2KSE A;  3V2Q A;  1YJ9 P;  5E79 H;  3HRN A;  1CSB A;  4U3F J;  3H1J D;  1SQV D;  1P84 D;  1L4A A;  2AEJ A;  3L75 E;  2Q6Q A;  2JR8 A;  1U7M A;  4ZKP A;  2A45 H;  3O6Q A;  2L91 A;  4UB8 H;  1GL2 B;  1UIX A;  4YXD D;  2E75 C;  1KIL C;  4YXW H;  4C7R A;  2WWW A;  4L76 A;  4AYC A;  3SFE C;  2HLO A;  4H0L B;  1T2K D;  1TU3 F;  4N3Y B;  3F89 A;  1KB9 D;  2QJY C;  3H1J G;  4HKZ H;  1SQV K;  1BE3 J;  2HFE D;  2WPV B;  4LDT A;  2OYO A;  3FWL A;  1XTC C;  1SQB G; 
#chains in the Genus database with same CATH homology
 2O01 J;  4YTP D;  4YTM C;  3T97 B;  1WMK A;  2B76 C;  1PIX A;  4H44 C;  2D2C C;  2H89 C;  2IDB A;  3P4P D;  4YSX C;  1DD4 A;  3RL0 g;  3AE1 D;  3VR8 C;  3Q2Y A;  2WU5 C;  3GMA A;  3AE2 D;  3AEF D;  3AE5 D;  1VL2 A;  3Q3D A;  3AED C;  3AEB D;  1KOR A;  2BS2 C;  2FBW D;  2BEQ D;  2E75 D;  3D71 A;  4OGQ C;  4H13 C;  4Z1M H;  5KLI C;  3Q5S A;  2E76 B;  1NEN D;  3P4Q D;  1VF5 C;  3AE3 C;  2ACZ C;  3AEA D;  1PV3 A;  1S1C X;  3AEE C;  4PV1 D;  1KF6 D;  1OMI A;  1NEK D;  2E74 C;  2E75 B;  2ZT9 D;  3H25 A;  2WDV C;  3AEC D;  2MKV A;  4Y28 J;  3AEG D;  4YXD C;  3P4R D;  1YQ4 D;  4PV1 B;  2H88 C;  4KX6 D;  2ZT9 B;  3SFE D;  1OW7 A;  3ABV C;  2WDR C;  3AE6 C;  2D2C B;  3EWK A;  2K9Y A;  1RQV A;  3R4Y A;  5KKZ C;  1HJ0 A;  2WDQ C;  1FDO A;  3VRA C;  3LW5 J;  1E7P C;  2E76 D;  1K05 A;  4H0L C;  1R8E A;  2WQY D;  2J5U A;  1AJY A;  3AE4 D;  5L8R J;  4I7Z C;  3CIR C;  3GF3 A;  3AE9 C;  1ZOY C;  5C2T C;  3AE2 C;  4YSZ D;  1L0V D;  1YQ3 D;  1MKM A;  4H13 B;  3VR9 C;  3VRB C;  1QLB C;  1ZP0 C;  1VF5 B;  2QIW A;  3AE8 C;  2WP9 C;  3AE7 C;  5C3J C;  1JB0 J;  4YTN C;  1EXI A;  4YSY C;  3SFD C;  4YTM D;  2JO1 A;  2WS3 C;  1KIL E;  2WSC J;  4RKU J;  1KFY C;  2B76 D;  2D2C D;  2H89 D;  4IL6 X;  3P4S C;  4YSX D;  2WU2 C;  3VR8 D;  2WSE J;  1KQF B;  2WU5 D;  2P10 A;  3D6Y A;  3D70 A;  3GLM A;  3B71 A;  1NGM B;  3AED D;  2WSF J;  4H44 B;  4YT0 C;  4R4L A;  4YTP C;  4OGQ D;  5M1B A;  4XFJ A;  4H13 D;  3FGA D;  2BS4 C;  3O6Q A;  1EXJ A;  1VF5 D;  3P4P C;  3AE3 D;  3G9R A;  2ACZ D;  3IN6 A;  3AEE D;  3AE1 C;  2E74 D;  1UIX A;  4OGQ B;  3AEF C;  3D6Z A;  3AE5 C;  1DIP A;  2WDV D;  3AEB C;  2FBW C;  2YIU C;  4YXD D;  2E75 C;  4GDO A;  4U7J A;  1GMJ A;  2H88 D;  1K04 A;  2E74 B;  1NEN C;  3P4Q C;  1NYH A;  4TT3 H;  2QSI A;  3AEA C;  3ABV D;  2WDR D;  2FYN C;  3AE6 D;  4PV1 C;  1KF6 C;  1NEK C;  2YMK A;  4H44 D;  2ZT9 C;  2WDQ D;  3AEC C;  3VRA D;  1Y9B A;  1OW6 A;  2G3A A;  3AEG C;  2OQQ A;  2QJP C;  4H0L D;  3Q1M A;  1KTM A;  1YQ4 C;  1ZRT E;  3CIR D;  3P4R C;  3IAO A;  3AE9 D;  1KMI Z;  1ZOY D;  4KX6 C;  5C2T D;  3RK3 E;  1OW8 A;  2QJK C;  3SFE C;  3VR9 D;  3VRB D;  2NZ2 A;  1KQG B;  1RQU A;  3Q5P A;  1ZP0 D;  4H0L B;  1S5L X;  2WP9 D;  1FDI A;  1TU3 F;  3AE7 D;  3AE8 D;  2G8Y A;  4I7Z B;  5C3J D;  4YTN D;  1PL5 A;  4YSY D;  2QJY C;  3SFD D;  2E76 C;  2WQY C;  1IK7 A;  3S9O A;  2BEZ F;  3AE4 C;  3Q5R A;  1HF9 A;  2WS3 D;  1KFY D;  2JP3 A;  4YSZ C;  2BS3 C;  1YQ3 C;  1L0V C;  3P4S D;  2WPV B;  3C8V A;  3GF7 A;  1U57 A;  2WU2 D;  2FXP A;  4R4M A;  1Q90 D;  1DD3 A;  2V7Q J;  1ZME C;  4KT0 J;  4YT0 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...