3AEFC

Crystal structure of porcine heart mitochondrial complex ii with an empty quinone-binding pocket
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II with an empty quinone-binding pocket
rcsb
total genus 50
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3aefC01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3aefC02
2WS3C 4YTNC 3VRBC 2WDRD 3S9OA 2H88C 3VR9C 2B76D 2H89C 1OW8A 3AE5C 3AE4C 2BS3C 1OW7A 3P4RC 2ACZC 3VR8D 4YTPC 1ZP0D 3SFEC 5C3JD 3AEEC 3B71A 2WU2C 3P4QC 3AE7D 1KFYC 1L0VD 3AEFD 1E7PC 3P4SC 3AE6D 3AE8C 3P4PD 3SFDC 4YSXC 3P4PC 1KF6C 2WS3D 3VRBD 4YTND 2H88D 4YXDC 3VR9D 2H89D 5C2TC 1PV3A 3AE5D 1NENC 2G3AA 3AE4D 1K05A 1QLBC 3P4RD 2ACZD 2BS4C 4YTPD 1NEKC 3SFED 1ZOYC 2WP9D 3AE3C 3AEED 3P4QD 2WU2D 2WU5C 4KX6C 3ABVC 3AE9C 4YSYC 1KFYD 4YT0C 3AE2C 4YTMC 3VRAC 1YQ3C 3P4SD 4YSZC 2FBWC 3AE8D 3SFDD 4YSXD 3AEBC 3AE1C 1KF6D 3CIRC 3AECC 4YXDD 3AEDC 1YQ4C 2WDVC 5C2TD 2WDQC 1K04A 1NEND 2WQYC 1NEKD 3AEGC 1ZOYD 3AEAC 3AE3D 2WU5D 4KX6D 1KTMA 3ABVD 2WDRC 3AE9D 4YSYD 2B76C 4YT0D 3AE2D 4YTMD 3VRAD 1YQ3D 1OW6A 3VR8C 4YSZD 2FBWD 1ZP0C 3AEBD 5C3JC 3AE1D 3CIRD 2WP9C 3AE7C 3AECD 3AEDD 1YQ4D 2WDVD 2WDQD 2WQYD 1L0VC 3AEFC 2BS2C 3AE6C 3AEGD 3AEAD
chains in the Genus database with same CATH superfamily
2BCCG 4Y28J 1LTJB 3ZDMA 1SQBK 3KZIH 3SSUA 1IFJA 2KS1A 1LTSC 5BVZA 1NKZB 1KORA 4RO0A 4WBAA 3AEEC 4JPZB 1AFOA 2NPSC 2JWDA 1IZNB 2R3SA 1BDDA 4N6JA 4CPGA 2ZXEB 4H13D 2I1KA 1QLED 4IFDK 2FXOA 2RMZA 1K05A 2LR2A 4DHJA 3CWBD 3HE4A 3TGUD 4EI2A 2JP3A 4AUWA 1AQTA 3V5BA 2PGDA 3RK2D 3RL0D 2E42A 1PL5A 4ZKPA 3CCMP 1ZLLA 3OA7A 3USSA 3CX5D 4XA4A 5GTHH 2IYPA 1IK9A 1RE3A 3G3ZA 2ZVOB 1BCCE 3FXDA 3WU2H 2OARA 1KFNA 1RE3C 2KUBA 1FS0E 2A06G 4PD4H 3A0BH 3L71D 1VQ4P 3AE1D 5AW2B 4BWNA 5E79E 3IAOA 4I6LA 2HLOA 1SQBD 3L70E 2G8YA 4D6TG 4A7PA 1BSHA 1KZUB 2ZYAA 1BGYJ 1EZVE 2H89C 2Q1KA 1OW8A 3O6QB 3NTNA 5KJ7D 3VR8D 1MFTA 1NTMJ 3CMAP 3NFQA 3SFEC 1J2JB 3T97B 1PP9D 3D70A 1KILB 3GF3A 3CCUP 2ITAA 3D6YA 2Q3EA 3HD7D 2WPSA 4IFFA 4OVNF 4U7JA 2CPBA 4YXDC 3VR9D 3IR9A 1SQXD 1NTZJ 3V2RA 1NWQA 3L72D 3GG2A 1NYHA 2M5AB 1NTMK 4BXLA 3H6PA 3P4SD 1DIPA 3W68A 4YSXD 2YO2A 4EOTA 3LW5H 4U3FJ 1GD2E 3AEDC 2P10A 5APQA 4H13B 1G2CB 2MKVA 2AXTE 1T2KD 2QJYC 5M1BA 1SQVJ 3SWFA 3M9BA 1TU3F 3CX5I 1LTBC 2YIUC 1N73B 2HODA 3AE9D 1T8ZA 1NTZK 2M8RA 4HYTB 2KYVA 3R4YA 3AEBD 3P8CD 3RK2B 3RL0B 1EDJA 1JEKA 3L74E 1YTZI 2WQYD 3H1LG 5KLIC 2J5UA 1LWUB 2ZJSE 1J1EB 5KKZB 1JY3N 1OVUA 3WMM0 4TT3H 3BCCG 1SQVK 3TNUB 5B66E 4R4MA 1Y9BA 3HUSC 3B71A 1NTKG 3HE5A 2WVRA 2HYNA 2P1JA 4Z1MH 1L0LE 2E74B 2BCCJ 3N7NA 3V4QA 5AVTB 2GUVA 2W6AA 2ZAEB 1LTJA 1MUUA 5AVVB 4NPFX 2WS3D 1LNQA 2CPSA 1BGYD 3VMZA 3L75G 3L4FA 3G9RA 3FWLA 4W7ZA 1VQLP 1KB9E 2O3JA 1S72P 3MZWB 1QEXA 1VQ7P 2H7HA 2A45I 3RK3E 2RKLA 2OTJP 2Y0CA 1VQ5P 1N86A 1NTZD 1IFNA 4Y99C 3A2AA 3RBXA 4YSYD 3A0HE 3VN0A 3AE2D 4GKGA 1YQ3D 2E76D 1OIPA 4UB8H 1ZRTE 3CIRD 2XDJA 3AECD 1HGVA 1EQ7A 4U3FD 5APVA 2HPCB 1H8AA 2IX7C 2M3EA 1YTZT 1JUNA 2V4HA 1OXZA 3WUUA 3AEAD 2ZT9B 2BEZF 2JJLA 2W83C 3CL3D 1H0TB 1OW7A 4W7YA 1FZGA 3ITKA 1SFCA 4XFJA 1N7SC 5APWA 4LLHA 2K3RA 2XNXA 1L0VD 1PPJD 2I8DA 3L74G 1IC2A 3AE8C 4PJ0H 4IFMA 4H44B 3O6QA 1YYCA 3G4SP 2FXPA 4RJTA 2QM8A 3AE4D 3T97A 5CBNA 2FYUJ 2OTLP 1ZOYC 1NKNA 1SQVE 3B5NC 1KILA 1L0NG 3H32B 1QL1A 2BCCD 2Y9YA 1KILC 1TFFA 2E43A 2KI7B 1X79B 2FYNB 2FYUK 4I7ZC 4YTMD 4GOFA 3PP5A 3M9HA 5EFWB 1SQQD 3PJSK 1G2CA 3KQGA 5AVRB 1VPCA 2ZVNB 1CW5A 3H1KG 1SVFA 1KQSO 1FZBA 1NAFA 1N73A 4H13C 1HJBA 2Y0EA 3Q5RA 3IN6A 1N73C 3BRTB 3H1LJ 4EIJA 4IL6X 3RL0g 3VOPA 1BE3E 4OGQD 3RK2C 3RL0C 1LWUA 1MV8A 3RGUA 1NAYA 1QGKB 3TNUA 5H2FH 1LWUC 3MIWA 1J1EC 3EQ2A 5KKZC 1NTKJ 2IBZG 3P4RD 2ACZD 2KLVA 3WUTA 1WRGA 3MP7B 3LIEA 5KAIE 1H89A 1M8OB 5KLVG 2P7JA 3L75J 2ZXXA 5APTA 3AE1C 3H1JG 2FFDC 1D7MA 2AEMA 2WSEJ 1VQ8P 3OJAB 5C2TD 2VRSA 3H1IG 2FYUD 1NEKD 5KJ7A 1NTKK 2BEQD 1RE4A 2WU5D 1RQUA 3I5CA 1HJ0A 3JSVC 2A06E 2N9YB 4JF7A 2KK7A 4N78D 2FKWB 5APSA 1SQPG 1SFCD 1OW6A 5KJ7C 3VR8C 2E5TA 2SPZA 3SWKA 1YQ4D 2B89A 1FDOA 4D6TE 2R5BA 2KB7P 3HD7C 1RF1B 3VR9C 1MZ9A 5AW8B 4PD4D 1JY2P 1LT9C 1HVVA 3IFMA 2HPCA 1HBWA 4L75A 5CCGA 3D71A 1U7JA 1QX8A 1GL2D 5APXA 3R2PA 2QG4A 1Q2NA 3P4SC 3V2PA 4YSXC 2O01J 1H0TA 1NU1E 1LTGC 1T2KC 2WZ7A 1NO4A 2C0XA 1USEA 5K5GB 3P4QD 3SWYA 3L74J 2H8PD 1Y47A 5GTIH 3CMEP 3AE9C 1BCCD 1WMKA 1JNMA 1BE3G 1FOSF 3MHVA 5AW4B 1IFIA 3LIDA 4IL6E 4DJGA 3AEBC 4OGQB 3A3YB 3MGNA 1RHZB 1NEND 2WQYC 1L0NJ 4AQRD 3U1CA 3H32A 1L0LJ 1M56D 3L70D 4YT0D 3E1IA 2KNCB 3V2NA 3L73D 1EZVD 3D6ZA 2OGUA 1KYOE 1KMIZ 2WP9C 3H1LE 2WDVD 2WDQD 2D2CD 4DT0A 2BS2C 3BCCE 1QVGO 2FYZA 2WS3C 1L0NK 1S1CX 1IK7A 1R5SA 2FYNC 3Q1MA 2B76D 1L0LK 4L74A 1NTKE 2E5YA 2E74D 2HR3A 5AVWB 3G6EP 1SFCB 1FZEA 2N1TA 1OVRA 4PD4I 3EFGA 1Q82Q 3S1KA 1URQA 3L75E 3CCLP 2W27A 2K9JB 2WT7B 4NPDA 2Q7CA 4RESB 5B5EE 2WU2D 1KD1Q 1BSNA 2KSEA 3UIAA 4YSYC 3K5BA 1W2BO 3AE2C 1SP4A 1YQ3C 3HTKB 2E76C 3CX5E 1GL2B 3CIRC 1EXIA 3AECC 2ZFYA 4I1LA 1S9KE 3TK1A 1K04A 1M90Q 1NU1G 2YNYA 1VF5B 2ZFCA 3PTZA 2JO1A 5E79H 2K1AA 4MN4C 3AEAC 4C7RA 1GK6A 3L74D 5KLVJ 1L2PA 1W5CE 1GDTA 2NZ2A 1FZCB 1JCCA 5BU5A 1OMIA 5AVSB 3VRAD 5CCGD 1XTCC 1N8RQ 1KC8Q 3B8EB 2WSEH 1YBKA 2POHA 2QM7A 2ZT9D 3V4WA 3FX0A 3FWNA 4HKZH 1L0VC 1ZMEC 2DW3A 1EZVI 3KYQA 1GK4A 1PIXA 2IFNA 1L0LD 2IPPA 3P7KA 2FY8A 3AE4C 5KLVK 2ZYDA 1X0TA 4H0LB 1GU4A 3GLMA 3QH9A 4H44D 1LP1B 1Y8AA 3GHGB 1MKMA 1RF1A 3P4PD 1U7MA 3C9IA 2D2CB 1EXJA 4YTND 2KXPB 4ZNCA 3PLNA 2XKMA 1SQPK 1Z56A 1JO5A 3RK3D 1RF1C 1L0NE 2WP9D 3Q2YA 2AXTH 1P84E 1KFYD 1USDA 4YTMC 2R32A 4KJMA 1KF6D 1HH0A 1LTJC 1ZRTD 3CWBG 1NTMD 3TGUG 2L5GB 3A5TA 2Q9IA 1BE3J 2QVAA 2XU6A 2NRGA 2B87A 2M3BA 4IOIH 2N1TD 4UB6E 5B66H 4O9BA 3H1KE 2C9NY 3EWKA 4M3LA 4OGQC 5CCHA 2XV5A 1URQD 1JY3O 3N4XA 1A02F 2WDRD 3C8VA 1FC2C 2KNCA 1R5LA 3L71G 2PAJA 3P4RC 2ACZC 2Y0DA 2OYHB 2YXRB 1M57D 2V7QJ 2WSFJ 3CCRP 1VQPP 1SQVD 2C9LY 1FOSE 1E7PC 1KB9H 1ZV8A 3VYIA 1UIIA 3PHLA 5AW9B 3VMXA 2IBZE 2IZ0A 2P58A 3L37A 5TISE 2H88D 1Q81Q 5C2TC 3CCEP 4OH8B 3AE5D 1S5LX 2G3AA 3FXEA 1OVVA 5CJ4A 2YKQA 4AYCA 2Q6QA 1NEKC 2WSCJ 2WU5C 4D6TJ 2AEFA 4HJGH 1PP9G 1PGPA 4K3AA 5KLVE 1RY3A 1NHLA 2K88A 3H1JE 1SFCC 2NPSB 1CZQA 3SFDD 3A0HH 2QE7H 3M91A 3H1IE 1LTIC 2K9JA 1YQ4C 2WT7A 3V2QA 4YPCA 1SQXG 1Q7YQ 1AA0A 4ASVA 4BRYB 1EDIA 2QSIA 2B88A 2A45G 3AE3D 3L72G 2PFXA 1JY2O 4C7NA 3RK3B 1SQPE 4WVZA 1YJNP 1AJYA 3CXHE 3HTKA 2P2UA 3CI9A 1GL2A 1KFMA 4DCKA 4YSZD 2FBWD 3TF5A 1NU1J 5TISH 4NPEA 5KAFE 1GL2C 1SLQA 1FJKA 1GU5A 2O1KA 3E1RA 3AEGD 1FZCA 3CD6P 1EDKA 1FZCC 3P4QC 3NXSA 3TSIA 2W6BA 4I6MC 1NU1K 2N1TB 5L8RJ 3AEFD 1GZLA 4HH2A 3H1HE 5AVXB 5CHXA 3VRBD 2QJKB 1LTTC 1URQB 5AW0B 1NENC 1QLBC 2O01N 1RF0A 1IFMA 1LP1A 3U59A 4W80A 5KAFH 1HGZA 3GHGA 5AVQB 3BCCJ 3II6A 4YT0C 2A06D 1X22A 2JWAA 2CK3H 1GW3A 3NMDA 1BGYG 1JY3P 1JM0A 3KPEA 3GHGC 1LGHB 5CCHD 4DZOA 2WDVC 2WDQC 2D2CC 3VTPC 1YJ9P 1VQ6P 1DH3A 3P32A 2OQQA 1AVYA 3JCUE 4D6TD 1KTMA 1T3UA 4WWIA 2B76C 1AV1A 1JCDA 1FDMA 1CI6B 2E74C 1VQ9P 1LJ2A 1H88A 3CC7P 2J59M 2R5DA 2RH0A 3CC4P 2RN0A 2C0WA 3VP9A 5CBOA 3S9OA 3CCQP 3BASA 2QJYB 2IYOA 1RE4C 2XZRA 1NU1D 1ZP0D 5C3JD 4L76A 2WU2C 2QJPB 4U3FG 1JMBA 5AW3B 1YITP 1VQNP 3AE6D 5KAIH 3KZIE 3L71J 3KDPB 4DOJA 2YO3A 1JOCA 2AXCA 2OYHA 3L36A 2BS4C 1L4AD 2QRXA 1OFCX 2V7QH 2WSFH 4PV1D 3M0DA 1PPJG 1XTGB 3VRAC 3HUSB 5CCGC 2YXQB 1VF5D 3H1HG 2ZT9C 5DJUB 1BDCA 4JYCA 1YIJP 1KYOD 3GF7A 1R8EA 3H1LD 3VONA 1DD4A 5AVZB 2WSCH 2W6JH 1E5WA 4KX6D 3ABVD 1LTAC 1X9VA 4C46A 2NPSA 3BCCD 2L91A 1ZR4A 2B87B 1OZHA 1KQGB 5GTHE 1SQXJ 1FDIA 2B9BA 5AVUB 1NTKD 4H44C 2JDIH 4BRYA 3L72J 2WWWA 3WU2E 2Q3IA 4WB4A 3P4PC 2WSSH 3MTUE 1QL2A 1HUCA 4PD4E 4YTNC 3A0BE 1KQFB 4H0LD 1KILE 1IFDA 3RK3C 3L75D 3A7OA 4Y99B 5AW6B 1SQQG 5AW5B 1FZAA 3AE7D 3MD0A 1PGJA 1SQXK 1KFYC 2KZJA 2R3CA 2WITA 1JB0J 1T3JA 1KF6C 2WPQA 1RQVA 4IL6H 5TJHA 1FAVA 4YTPD 3H1KJ 1S9KD 2LKMA 3I56P 4ASWA 1NH4A 1K9MQ 1PGQA 3BVHA 2KSJA 1IJDB 1FJPA 1N7SB 1G1JA 2N1TC 3VMYA 3TYYA 3CWBE 3TGUE 1ZR2A 1J1DB 4RKUJ 2M0BA 2QJKC 1KYOH 4I2LC 5AW1B 1URQC 4LGDE 5APUA 2WDRC 4C7NB 1L4AB 3L73E 3B4SA 1KYOI 1FZFA 1YJWP 3G71P 3B5NB 2W8ZA 2YKOA 1AVOA 4PV1B 4DHZA 3F89A 1HF9A 2HFED 2O1JA 4KT0J 1NGMB 2FYUG 1ZW0A 3U1AA 3L71E 3H1JJ 2H88C 1CI6A 3AE5C 1M1KQ 3RBZA 1FE6A 3H1IJ 1G1IA 1EDLA 2E75D 4WY4D 1Q90D 2P67A 4I7ZB 1SQBE 1L0ND 1GTWA 5B5EH 1M1JB 3VP8A 1SQPJ 1P84D 3SFDC 3L35A 1ZXGA 3HRNA 3CX5H 4EYYQ 1PP9E 4JBZA 3AE3C 3AEED 5C39A 2NPSD 3TDKA 3S4RA 1MFZA 1UIXA 2QJPC 4JYBA 1KB9D 1Q86Q 2GUSA 4YSZC 2FBWC 5BU8B 2OYOA 1U57A 2QEXP 1SQXE 2KLUA 4QMAA 2YMYA 2QA4P 3L72E 5AVYB 1M7LA 3H1KD 3AEGC 2WTYA 1FBMA 1BCCG 2PRRA 3HUSA 3H1HJ 1EC5A 3CC2P 1K73Q 2OYIB 2O01H 2GM4A 3M06A 2KIKA 1DEEG 3CCVP 3AEFC 3OAKA 2FFDB 1VDFA 3VRBC 3GW6A 3L70G 3P8CE 4UB8E 2BS3C 3L73G 1E79H 1EZVG 2IBZD 1LT1A 2A45H 5CJ0A 2N9BA 3FGAD 1GMJA 4GIFA 1P84H 4EDFA 5KLVD 4XE5B 3CPWO 3H1JD 1SQQJ 5CCHC 2H89D 2BASA 3H25A 1OWAA 1PV3A 1WT6A 1AQ5A 1T6AA 3HD7B 1HWTC 2Z5HA 3H1ID 1P84I 3SFED 4FJVA 2JKVA 3EFFK 1LT9B 4PJ0E 1VQKP 1JY2N 2E75B 4WY4B 1IO4A 1SQBG 3I55P 1BGYE 1PFIA 1SQPD 3CXHD 2J58A 1PGOA 4GODA 1NTME 4KHXA 4YXDD 1JMMA 1JTHB 1KB9I 4UB6H 1SQQK 3C1LA 5CMZA 3Q5PA 1QVFO 3JC22 2I1JA 1N7SA 4K35A 3BATA 4ZMDA 1ZP0C 5C3JC 2KS1B 1NTZE 2UWJE 3AEDD 1CSBA 1DD3A 2HG5D 2WMMA 1J1DC 3AE6C 1KN7A 3CLQA 1L4AA 2XNDH 2IZ1A 1ZN5A 3H1HD 3B5NA 1PZQA 4LDTA 2MJZA 4LC1A 2YKPA 2KOGA 4U3FE 1L4AC 3HE4B 2LXCB 2Z5IA 4PV1C 2IFMA 2IBZI 1BE3D 3O8ZA 3M9QA 1L0LG 1A02J 1VF5C 4B86A 3M0AA 1GW4A 3MUDA 4GDOA 2JEEA 1HTLC 1VL2A 1PPJE 2M5AA 4KX6C 1M1JA 3ABVC 2FXMA 3MUDC 3BRVB 5H2FE 3KXDA 3CXHH 1M1JC 2Q5UA 3PRJA 2H43A 1S4XA 4GOEA 3CCSP 3CXHI 4R4LA 2BCCE 3OW2O 1S3JA 4N3YB 4H0LC 1W2EA 2YMKA 1RF0C 2WPRA 2W90A 1YHQP 4GT1A 5DJTB 3AE7C 3WUVA 1N2DC 1NTMG 2E76B 1BCCJ 2WPVB 1FU1A 3VMAA 3Q5SA 2ZYGA 4DDGA 3V6IA 2LXBA 2OYIA 1S5LE 3W67A 1SQQE 2Z4EA 3QWOC 3F5HA 3CWBJ 4YTPC 1K8AQ 3TGUJ 2GA1A 2PP6A 2OYIC 2AEJA 1VQMP 3CCJP 1DEBA 2FFDA 4HB1A 1NTZG 1YI2P 3L70J 2Y9ZA 1SS1A 4ZKUA 3L73J 4JQ0D 4OWFA 3LW5J 1NOHA 2JR8A 4YXWH 1VQOP 1X8YA 2YIUB 5KTBA 3P8MC 1N7SD 1RH5B 2K37A 1SQVG 3JCUH 2HODB 2KP8A 1N7LA 2R44A 3IF4A 1KV4A 3AE8D 1IFPA 1S5LH 2OTKE 4DDIA 4L73A 5KLIB 3HD7A 4TLFA 2K9YA 5GTIE 1DX7A 1ZOYD 1LT9A 1SQBJ 3PH0A 3B5ND 4WY4A 4DHIB 2IDBA 2OYHC 5APYA 2KZIA 3GMAA 3Q3DA 3E7KA 1KILD 2E75C 4WY4C 1OX3A 3M0DC 1KQLA 1JTHA 2QIWA 2FYUE 1S2EA 1PP9J 3HE5B 1NJIQ 1NVOA 5AW7B 3KHUA 4N78E
chains in the Genus database with same CATH topology
2G8YA 2ZT9B 4H13C 2BEZF 2WS3C 4YTNC 3VRBC 1KQFB 1S1CX 4Y28J 4TT3H 3S9OA 2WDRD 1IK7A 4H0LD 3C8VA 2H88C 2FYNC 1KILE 3Q1MA 2H89C 2B76D 3VR9C 1OW8A 3AE5C 3Q5RA 3AE4C 2BS3C 1OW7A 3IN6A 3P4RC 2ACZC 3VR8D 2E74D 4R4MA 4YTPC 1ZP0D 1Y9BA 2E75D 3SFEC 1KORA 5C3JD 4IL6X 4H0LB 3AEEC 3B71A 3GLMA 2WU2C 3T97B 4XFJA 3P4QC 3AE7D 1Q90D 2V7QJ 2WSFJ 3D71A 3RL0g 4H44D 4I7ZB 4PV1C 4Z1MH 3FGAD 3D70A 1KFYC 4OGQD 2E74B 3GF3A 5L8RJ 3D6YA 1L0VD 3AEFD 1JB0J 1GMJA 1E7PC 3P4SC 1MKMA 3AE6D 3AE8C 3P4PD 3SFDC 1VF5C 4H13D 4H44B 4YSXC 2D2CB 1EXJA 1KF6C 2WS3D 3P4PC 3VRBD 4U7JA 4YTND 2O01J 3O6QA 3LW5J 2H88D 4YXDC 3VR9D 5KKZC 2H89D 1RQVA 3H25A 1PV3A 2FXPA 5C2TC 4GDOA 3AE5D 1S5LX 1NENC 2G3AA 3AE4D 1K05A 1QLBC 3P4RD 2ACZD 2BS4C 3G9RA 4YTPD 1NEKC 3SFED 1ZOYC 2WSCJ 2WP9D 3AE3C 3Q2YA 3AEED 1VL2A 2WU2D 2WU5C 3P4QD 2JP3A 4KX6C 3ABVC 1NYHA 3AE9C 4YSYC 4PV1D 1KFYD 2E75B 4YT0C 1UIXA 1WMKA 2QJPC 1PL5A 3AE2C 4YTMC 3VRAC 1YQ3C 3P4SD 1DIPA 4YSZC 2FBWC 3AE8D 3SFDD 2E76C 1VF5D 4YSXD 3AEBC 3AE1C 1U57A 4OGQB 1KF6D 3CIRC 3RK3E 1EXIA 3AECC 2WSEJ 2ZT9C 4YXDD 3AEDC 1YQ4C 4RKUJ 2P10A 2WDVC 5C2TD 2WDQC 2D2CC 1K04A 4H13B 2MKVA 2WQYC 2QJKC 1NEND 2K9YA 3GF7A 2QJYC 1VF5B 1R8EA 1DD4A 5M1BA 2JO1A 2OQQA 4R4LA 2QSIA 3AEGC 1NEKD 3AEAC 1ZOYD 2BEQD 3AE3D 2WU5D 1RQUA 1HJ0A 4KX6D 1TU3F 2IDBA 3Q5PA 1KTMA 2WDRC 3ABVD 2YIUC 1AJYA 2NZ2A 4H0LC 3AE9D 4YSYD 2B76C 2YMKA 4YT0D 3GMAA 3R4YA 1OMIA 4I7ZC 3AE2D 4YTMD 3VRAD 1YQ3D 1OW6A 3Q3DA 3VR8C 4YSZD 2FBWD 2E74C 1KQGB 2E76D 1ZP0C 4PV1B 1FDIA 2E75C 3D6ZA 3AEBD 5C3JC 3AE1D 1ZRTE 3CIRD 1KMIZ 2WP9C 3AE7C 3AECD 2QIWA 2ZT9D 1HF9A 4H44C 3AEDD 1YQ4D 2WDVD 2WDQD 1FDOA 2D2CD 3EWKA 3IAOA 4OGQC 4KT0J 1NGMB 2E76B 1DD3A 2WQYD 2WPVB 1L0VC 1ZMEC 3AEFC 5KLIC 2J5UA 2BS2C 3Q5SA 3AE6C 3AEGD 1PIXA 3AEAD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WS3 C;  4YTN C;  3VRB C;  2WDR D;  3S9O A;  2H88 C;  3VR9 C;  2B76 D;  2H89 C;  1OW8 A;  3AE5 C;  3AE4 C;  2BS3 C;  1OW7 A;  3P4R C;  2ACZ C;  3VR8 D;  4YTP C;  1ZP0 D;  3SFE C;  5C3J D;  3AEE C;  3B71 A;  2WU2 C;  3P4Q C;  3AE7 D;  1KFY C;  1L0V D;  3AEF D;  1E7P C;  3P4S C;  3AE6 D;  3AE8 C;  3P4P D;  3SFD C;  4YSX C;  3P4P C;  1KF6 C;  2WS3 D;  3VRB D;  4YTN D;  2H88 D;  4YXD C;  3VR9 D;  2H89 D;  5C2T C;  1PV3 A;  3AE5 D;  1NEN C;  2G3A A;  3AE4 D;  1K05 A;  1QLB C;  3P4R D;  2ACZ D;  2BS4 C;  4YTP D;  1NEK C;  3SFE D;  1ZOY C;  2WP9 D;  3AE3 C;  3AEE D;  3P4Q D;  2WU2 D;  2WU5 C;  4KX6 C;  3ABV C;  3AE9 C;  4YSY C;  1KFY D;  4YT0 C;  3AE2 C;  4YTM C;  3VRA C;  1YQ3 C;  3P4S D;  4YSZ C;  2FBW C;  3AE8 D;  3SFD D;  4YSX D;  3AEB C;  3AE1 C;  1KF6 D;  3CIR C;  3AEC C;  4YXD D;  3AED C;  1YQ4 C;  2WDV C;  5C2T D;  2WDQ C;  1K04 A;  1NEN D;  2WQY C;  1NEK D;  3AEG C;  1ZOY D;  3AEA C;  3AE3 D;  2WU5 D;  4KX6 D;  1KTM A;  3ABV D;  2WDR C;  3AE9 D;  4YSY D;  2B76 C;  4YT0 D;  3AE2 D;  4YTM D;  3VRA D;  1YQ3 D;  1OW6 A;  3VR8 C;  4YSZ D;  2FBW D;  1ZP0 C;  3AEB D;  5C3J C;  3AE1 D;  3CIR D;  2WP9 C;  3AE7 C;  3AEC D;  3AED D;  1YQ4 D;  2WDV D;  2WDQ D;  2WQY D;  1L0V C;  3AEF C;  2BS2 C;  3AE6 C;  3AEG D;  3AEA D; 
#chains in the Genus database with same CATH topology
 2BCC G;  4Y28 J;  1LTJ B;  3ZDM A;  1SQB K;  3KZI H;  3SSU A;  1IFJ A;  2KS1 A;  1LTS C;  5BVZ A;  1NKZ B;  1KOR A;  4RO0 A;  4WBA A;  3AEE C;  4JPZ B;  1AFO A;  2NPS C;  2JWD A;  1IZN B;  2R3S A;  1BDD A;  4N6J A;  4CPG A;  2ZXE B;  4H13 D;  2I1K A;  1QLE D;  4IFD K;  2FXO A;  2RMZ A;  1K05 A;  2LR2 A;  4DHJ A;  3CWB D;  3HE4 A;  3TGU D;  4EI2 A;  2JP3 A;  4AUW A;  1AQT A;  3V5B A;  2PGD A;  3RK2 D;  3RL0 D;  2E42 A;  1PL5 A;  4ZKP A;  3CCM P;  1ZLL A;  3OA7 A;  3USS A;  3CX5 D;  4XA4 A;  5GTH H;  2IYP A;  1IK9 A;  1RE3 A;  3G3Z A;  2ZVO B;  1BCC E;  3FXD A;  3WU2 H;  2OAR A;  1KFN A;  1RE3 C;  2KUB A;  1FS0 E;  2A06 G;  4PD4 H;  3A0B H;  3L71 D;  1VQ4 P;  3AE1 D;  5AW2 B;  4BWN A;  5E79 E;  3IAO A;  4I6L A;  2HLO A;  1SQB D;  3L70 E;  2G8Y A;  4D6T G;  4A7P A;  1BSH A;  1KZU B;  2ZYA A;  1BGY J;  1EZV E;  2H89 C;  2Q1K A;  1OW8 A;  3O6Q B;  3NTN A;  5KJ7 D;  3VR8 D;  1MFT A;  1NTM J;  3CMA P;  3NFQ A;  3SFE C;  1J2J B;  3T97 B;  1PP9 D;  3D70 A;  1KIL B;  3GF3 A;  3CCU P;  2ITA A;  3D6Y A;  2Q3E A;  3HD7 D;  2WPS A;  4IFF A;  4OVN F;  4U7J A;  2CPB A;  4YXD C;  3VR9 D;  3IR9 A;  1SQX D;  1NTZ J;  3V2R A;  1NWQ A;  3L72 D;  3GG2 A;  1NYH A;  2M5A B;  1NTM K;  4BXL A;  3H6P A;  3P4S D;  1DIP A;  3W68 A;  4YSX D;  2YO2 A;  4EOT A;  3LW5 H;  4U3F J;  1GD2 E;  3AED C;  2P10 A;  5APQ A;  4H13 B;  1G2C B;  2MKV A;  2AXT E;  1T2K D;  2QJY C;  5M1B A;  1SQV J;  3SWF A;  3M9B A;  1TU3 F;  3CX5 I;  1LTB C;  2YIU C;  1N73 B;  2HOD A;  3AE9 D;  1T8Z A;  1NTZ K;  2M8R A;  4HYT B;  2KYV A;  3R4Y A;  3AEB D;  3P8C D;  3RK2 B;  3RL0 B;  1EDJ A;  1JEK A;  3L74 E;  1YTZ I;  2WQY D;  3H1L G;  5KLI C;  2J5U A;  1LWU B;  2ZJS E;  1J1E B;  5KKZ B;  1JY3 N;  1OVU A;  3WMM 0;  4TT3 H;  3BCC G;  1SQV K;  3TNU B;  5B66 E;  4R4M A;  1Y9B A;  3HUS C;  3B71 A;  1NTK G;  3HE5 A;  2WVR A;  2HYN A;  2P1J A;  4Z1M H;  1L0L E;  2E74 B;  2BCC J;  3N7N A;  3V4Q A;  5AVT B;  2GUV A;  2W6A A;  2ZAE B;  1LTJ A;  1MUU A;  5AVV B;  4NPF X;  2WS3 D;  1LNQ A;  2CPS A;  1BGY D;  3VMZ A;  3L75 G;  3L4F A;  3G9R A;  3FWL A;  4W7Z A;  1VQL P;  1KB9 E;  2O3J A;  1S72 P;  3MZW B;  1QEX A;  1VQ7 P;  2H7H A;  2A45 I;  3RK3 E;  2RKL A;  2OTJ P;  2Y0C A;  1VQ5 P;  1N86 A;  1NTZ D;  1IFN A;  4Y99 C;  3A2A A;  3RBX A;  4YSY D;  3A0H E;  3VN0 A;  3AE2 D;  4GKG A;  1YQ3 D;  2E76 D;  1OIP A;  4UB8 H;  1ZRT E;  3CIR D;  2XDJ A;  3AEC D;  1HGV A;  1EQ7 A;  4U3F D;  5APV A;  2HPC B;  1H8A A;  2IX7 C;  2M3E A;  1YTZ T;  1JUN A;  2V4H A;  1OXZ A;  3WUU A;  3AEA D;  2ZT9 B;  2BEZ F;  2JJL A;  2W83 C;  3CL3 D;  1H0T B;  1OW7 A;  4W7Y A;  1FZG A;  3ITK A;  1SFC A;  4XFJ A;  1N7S C;  5APW A;  4LLH A;  2K3R A;  2XNX A;  1L0V D;  1PPJ D;  2I8D A;  3L74 G;  1IC2 A;  3AE8 C;  4PJ0 H;  4IFM A;  4H44 B;  3O6Q A;  1YYC A;  3G4S P;  2FXP A;  4RJT A;  2QM8 A;  3AE4 D;  3T97 A;  5CBN A;  2FYU J;  2OTL P;  1ZOY C;  1NKN A;  1SQV E;  3B5N C;  1KIL A;  1L0N G;  3H32 B;  1QL1 A;  2BCC D;  2Y9Y A;  1KIL C;  1TFF A;  2E43 A;  2KI7 B;  1X79 B;  2FYN B;  2FYU K;  4I7Z C;  4YTM D;  4GOF A;  3PP5 A;  3M9H A;  5EFW B;  1SQQ D;  3PJS K;  1G2C A;  3KQG A;  5AVR B;  1VPC A;  2ZVN B;  1CW5 A;  3H1K G;  1SVF A;  1KQS O;  1FZB A;  1NAF A;  1N73 A;  4H13 C;  1HJB A;  2Y0E A;  3Q5R A;  3IN6 A;  1N73 C;  3BRT B;  3H1L J;  4EIJ A;  4IL6 X;  3RL0 g;  3VOP A;  1BE3 E;  4OGQ D;  3RK2 C;  3RL0 C;  1LWU A;  1MV8 A;  3RGU A;  1NAY A;  1QGK B;  3TNU A;  5H2F H;  1LWU C;  3MIW A;  1J1E C;  3EQ2 A;  5KKZ C;  1NTK J;  2IBZ G;  3P4R D;  2ACZ D;  2KLV A;  3WUT A;  1WRG A;  3MP7 B;  3LIE A;  5KAI E;  1H89 A;  1M8O B;  5KLV G;  2P7J A;  3L75 J;  2ZXX A;  5APT A;  3AE1 C;  3H1J G;  2FFD C;  1D7M A;  2AEM A;  2WSE J;  1VQ8 P;  3OJA B;  5C2T D;  2VRS A;  3H1I G;  2FYU D;  1NEK D;  5KJ7 A;  1NTK K;  2BEQ D;  1RE4 A;  2WU5 D;  1RQU A;  3I5C A;  1HJ0 A;  3JSV C;  2A06 E;  2N9Y B;  4JF7 A;  2KK7 A;  4N78 D;  2FKW B;  5APS A;  1SQP G;  1SFC D;  1OW6 A;  5KJ7 C;  3VR8 C;  2E5T A;  2SPZ A;  3SWK A;  1YQ4 D;  2B89 A;  1FDO A;  4D6T E;  2R5B A;  2KB7 P;  3HD7 C;  1RF1 B;  3VR9 C;  1MZ9 A;  5AW8 B;  4PD4 D;  1JY2 P;  1LT9 C;  1HVV A;  3IFM A;  2HPC A;  1HBW A;  4L75 A;  5CCG A;  3D71 A;  1U7J A;  1QX8 A;  1GL2 D;  5APX A;  3R2P A;  2QG4 A;  1Q2N A;  3P4S C;  3V2P A;  4YSX C;  2O01 J;  1H0T A;  1NU1 E;  1LTG C;  1T2K C;  2WZ7 A;  1NO4 A;  2C0X A;  1USE A;  5K5G B;  3P4Q D;  3SWY A;  3L74 J;  2H8P D;  1Y47 A;  5GTI H;  3CME P;  3AE9 C;  1BCC D;  1WMK A;  1JNM A;  1BE3 G;  1FOS F;  3MHV A;  5AW4 B;  1IFI A;  3LID A;  4IL6 E;  4DJG A;  3AEB C;  4OGQ B;  3A3Y B;  3MGN A;  1RHZ B;  1NEN D;  2WQY C;  1L0N J;  4AQR D;  3U1C A;  3H32 A;  1L0L J;  1M56 D;  3L70 D;  4YT0 D;  3E1I A;  2KNC B;  3V2N A;  3L73 D;  1EZV D;  3D6Z A;  2OGU A;  1KYO E;  1KMI Z;  2WP9 C;  3H1L E;  2WDV D;  2WDQ D;  2D2C D;  4DT0 A;  2BS2 C;  3BCC E;  1QVG O;  2FYZ A;  2WS3 C;  1L0N K;  1S1C X;  1IK7 A;  1R5S A;  2FYN C;  3Q1M A;  2B76 D;  1L0L K;  4L74 A;  1NTK E;  2E5Y A;  2E74 D;  2HR3 A;  5AVW B;  3G6E P;  1SFC B;  1FZE A;  2N1T A;  1OVR A;  4PD4 I;  3EFG A;  1Q82 Q;  3S1K A;  1URQ A;  3L75 E;  3CCL P;  2W27 A;  2K9J B;  2WT7 B;  4NPD A;  2Q7C A;  4RES B;  5B5E E;  2WU2 D;  1KD1 Q;  1BSN A;  2KSE A;  3UIA A;  4YSY C;  3K5B A;  1W2B O;  3AE2 C;  1SP4 A;  1YQ3 C;  3HTK B;  2E76 C;  3CX5 E;  1GL2 B;  3CIR C;  1EXI A;  3AEC C;  2ZFY A;  4I1L A;  1S9K E;  3TK1 A;  1K04 A;  1M90 Q;  1NU1 G;  2YNY A;  1VF5 B;  2ZFC A;  3PTZ A;  2JO1 A;  5E79 H;  2K1A A;  4MN4 C;  3AEA C;  4C7R A;  1GK6 A;  3L74 D;  5KLV J;  1L2P A;  1W5C E;  1GDT A;  2NZ2 A;  1FZC B;  1JCC A;  5BU5 A;  1OMI A;  5AVS B;  3VRA D;  5CCG D;  1XTC C;  1N8R Q;  1KC8 Q;  3B8E B;  2WSE H;  1YBK A;  2POH A;  2QM7 A;  2ZT9 D;  3V4W A;  3FX0 A;  3FWN A;  4HKZ H;  1L0V C;  1ZME C;  2DW3 A;  1EZV I;  3KYQ A;  1GK4 A;  1PIX A;  2IFN A;  1L0L D;  2IPP A;  3P7K A;  2FY8 A;  3AE4 C;  5KLV K;  2ZYD A;  1X0T A;  4H0L B;  1GU4 A;  3GLM A;  3QH9 A;  4H44 D;  1LP1 B;  1Y8A A;  3GHG B;  1MKM A;  1RF1 A;  3P4P D;  1U7M A;  3C9I A;  2D2C B;  1EXJ A;  4YTN D;  2KXP B;  4ZNC A;  3PLN A;  2XKM A;  1SQP K;  1Z56 A;  1JO5 A;  3RK3 D;  1RF1 C;  1L0N E;  2WP9 D;  3Q2Y A;  2AXT H;  1P84 E;  1KFY D;  1USD A;  4YTM C;  2R32 A;  4KJM A;  1KF6 D;  1HH0 A;  1LTJ C;  1ZRT D;  3CWB G;  1NTM D;  3TGU G;  2L5G B;  3A5T A;  2Q9I A;  1BE3 J;  2QVA A;  2XU6 A;  2NRG A;  2B87 A;  2M3B A;  4IOI H;  2N1T D;  4UB6 E;  5B66 H;  4O9B A;  3H1K E;  2C9N Y;  3EWK A;  4M3L A;  4OGQ C;  5CCH A;  2XV5 A;  1URQ D;  1JY3 O;  3N4X A;  1A02 F;  2WDR D;  3C8V A;  1FC2 C;  2KNC A;  1R5L A;  3L71 G;  2PAJ A;  3P4R C;  2ACZ C;  2Y0D A;  2OYH B;  2YXR B;  1M57 D;  2V7Q J;  2WSF J;  3CCR P;  1VQP P;  1SQV D;  2C9L Y;  1FOS E;  1E7P C;  1KB9 H;  1ZV8 A;  3VYI A;  1UII A;  3PHL A;  5AW9 B;  3VMX A;  2IBZ E;  2IZ0 A;  2P58 A;  3L37 A;  5TIS E;  2H88 D;  1Q81 Q;  5C2T C;  3CCE P;  4OH8 B;  3AE5 D;  1S5L X;  2G3A A;  3FXE A;  1OVV A;  5CJ4 A;  2YKQ A;  4AYC A;  2Q6Q A;  1NEK C;  2WSC J;  2WU5 C;  4D6T J;  2AEF A;  4HJG H;  1PP9 G;  1PGP A;  4K3A A;  5KLV E;  1RY3 A;  1NHL A;  2K88 A;  3H1J E;  1SFC C;  2NPS B;  1CZQ A;  3SFD D;  3A0H H;  2QE7 H;  3M91 A;  3H1I E;  1LTI C;  2K9J A;  1YQ4 C;  2WT7 A;  3V2Q A;  4YPC A;  1SQX G;  1Q7Y Q;  1AA0 A;  4ASV A;  4BRY B;  1EDI A;  2QSI A;  2B88 A;  2A45 G;  3AE3 D;  3L72 G;  2PFX A;  1JY2 O;  4C7N A;  3RK3 B;  1SQP E;  4WVZ A;  1YJN P;  1AJY A;  3CXH E;  3HTK A;  2P2U A;  3CI9 A;  1GL2 A;  1KFM A;  4DCK A;  4YSZ D;  2FBW D;  3TF5 A;  1NU1 J;  5TIS H;  4NPE A;  5KAF E;  1GL2 C;  1SLQ A;  1FJK A;  1GU5 A;  2O1K A;  3E1R A;  3AEG D;  1FZC A;  3CD6 P;  1EDK A;  1FZC C;  3P4Q C;  3NXS A;  3TSI A;  2W6B A;  4I6M C;  1NU1 K;  2N1T B;  5L8R J;  3AEF D;  1GZL A;  4HH2 A;  3H1H E;  5AVX B;  5CHX A;  3VRB D;  2QJK B;  1LTT C;  1URQ B;  5AW0 B;  1NEN C;  1QLB C;  2O01 N;  1RF0 A;  1IFM A;  1LP1 A;  3U59 A;  4W80 A;  5KAF H;  1HGZ A;  3GHG A;  5AVQ B;  3BCC J;  3II6 A;  4YT0 C;  2A06 D;  1X22 A;  2JWA A;  2CK3 H;  1GW3 A;  3NMD A;  1BGY G;  1JY3 P;  1JM0 A;  3KPE A;  3GHG C;  1LGH B;  5CCH D;  4DZO A;  2WDV C;  2WDQ C;  2D2C C;  3VTP C;  1YJ9 P;  1VQ6 P;  1DH3 A;  3P32 A;  2OQQ A;  1AVY A;  3JCU E;  4D6T D;  1KTM A;  1T3U A;  4WWI A;  2B76 C;  1AV1 A;  1JCD A;  1FDM A;  1CI6 B;  2E74 C;  1VQ9 P;  1LJ2 A;  1H88 A;  3CC7 P;  2J59 M;  2R5D A;  2RH0 A;  3CC4 P;  2RN0 A;  2C0W A;  3VP9 A;  5CBO A;  3S9O A;  3CCQ P;  3BAS A;  2QJY B;  2IYO A;  1RE4 C;  2XZR A;  1NU1 D;  1ZP0 D;  5C3J D;  4L76 A;  2WU2 C;  2QJP B;  4U3F G;  1JMB A;  5AW3 B;  1YIT P;  1VQN P;  3AE6 D;  5KAI H;  3KZI E;  3L71 J;  3KDP B;  4DOJ A;  2YO3 A;  1JOC A;  2AXC A;  2OYH A;  3L36 A;  2BS4 C;  1L4A D;  2QRX A;  1OFC X;  2V7Q H;  2WSF H;  4PV1 D;  3M0D A;  1PPJ G;  1XTG B;  3VRA C;  3HUS B;  5CCG C;  2YXQ B;  1VF5 D;  3H1H G;  2ZT9 C;  5DJU B;  1BDC A;  4JYC A;  1YIJ P;  1KYO D;  3GF7 A;  1R8E A;  3H1L D;  3VON A;  1DD4 A;  5AVZ B;  2WSC H;  2W6J H;  1E5W A;  4KX6 D;  3ABV D;  1LTA C;  1X9V A;  4C46 A;  2NPS A;  3BCC D;  2L91 A;  1ZR4 A;  2B87 B;  1OZH A;  1KQG B;  5GTH E;  1SQX J;  1FDI A;  2B9B A;  5AVU B;  1NTK D;  4H44 C;  2JDI H;  4BRY A;  3L72 J;  2WWW A;  3WU2 E;  2Q3I A;  4WB4 A;  3P4P C;  2WSS H;  3MTU E;  1QL2 A;  1HUC A;  4PD4 E;  4YTN C;  3A0B E;  1KQF B;  4H0L D;  1KIL E;  1IFD A;  3RK3 C;  3L75 D;  3A7O A;  4Y99 B;  5AW6 B;  1SQQ G;  5AW5 B;  1FZA A;  3AE7 D;  3MD0 A;  1PGJ A;  1SQX K;  1KFY C;  2KZJ A;  2R3C A;  2WIT A;  1JB0 J;  1T3J A;  1KF6 C;  2WPQ A;  1RQV A;  4IL6 H;  5TJH A;  1FAV A;  4YTP D;  3H1K J;  1S9K D;  2LKM A;  3I56 P;  4ASW A;  1NH4 A;  1K9M Q;  1PGQ A;  3BVH A;  2KSJ A;  1IJD B;  1FJP A;  1N7S B;  1G1J A;  2N1T C;  3VMY A;  3TYY A;  3CWB E;  3TGU E;  1ZR2 A;  1J1D B;  4RKU J;  2M0B A;  2QJK C;  1KYO H;  4I2L C;  5AW1 B;  1URQ C;  4LGD E;  5APU A;  2WDR C;  4C7N B;  1L4A B;  3L73 E;  3B4S A;  1KYO I;  1FZF A;  1YJW P;  3G71 P;  3B5N B;  2W8Z A;  2YKO A;  1AVO A;  4PV1 B;  4DHZ A;  3F89 A;  1HF9 A;  2HFE D;  2O1J A;  4KT0 J;  1NGM B;  2FYU G;  1ZW0 A;  3U1A A;  3L71 E;  3H1J J;  2H88 C;  1CI6 A;  3AE5 C;  1M1K Q;  3RBZ A;  1FE6 A;  3H1I J;  1G1I A;  1EDL A;  2E75 D;  4WY4 D;  1Q90 D;  2P67 A;  4I7Z B;  1SQB E;  1L0N D;  1GTW A;  5B5E H;  1M1J B;  3VP8 A;  1SQP J;  1P84 D;  3SFD C;  3L35 A;  1ZXG A;  3HRN A;  3CX5 H;  4EYY Q;  1PP9 E;  4JBZ A;  3AE3 C;  3AEE D;  5C39 A;  2NPS D;  3TDK A;  3S4R A;  1MFZ A;  1UIX A;  2QJP C;  4JYB A;  1KB9 D;  1Q86 Q;  2GUS A;  4YSZ C;  2FBW C;  5BU8 B;  2OYO A;  1U57 A;  2QEX P;  1SQX E;  2KLU A;  4QMA A;  2YMY A;  2QA4 P;  3L72 E;  5AVY B;  1M7L A;  3H1K D;  3AEG C;  2WTY A;  1FBM A;  1BCC G;  2PRR A;  3HUS A;  3H1H J;  1EC5 A;  3CC2 P;  1K73 Q;  2OYI B;  2O01 H;  2GM4 A;  3M06 A;  2KIK A;  1DEE G;  3CCV P;  3AEF C;  3OAK A;  2FFD B;  1VDF A;  3VRB C;  3GW6 A;  3L70 G;  3P8C E;  4UB8 E;  2BS3 C;  3L73 G;  1E79 H;  1EZV G;  2IBZ D;  1LT1 A;  2A45 H;  5CJ0 A;  2N9B A;  3FGA D;  1GMJ A;  4GIF A;  1P84 H;  4EDF A;  5KLV D;  4XE5 B;  3CPW O;  3H1J D;  1SQQ J;  5CCH C;  2H89 D;  2BAS A;  3H25 A;  1OWA A;  1PV3 A;  1WT6 A;  1AQ5 A;  1T6A A;  3HD7 B;  1HWT C;  2Z5H A;  3H1I D;  1P84 I;  3SFE D;  4FJV A;  2JKV A;  3EFF K;  1LT9 B;  4PJ0 E;  1VQK P;  1JY2 N;  2E75 B;  4WY4 B;  1IO4 A;  1SQB G;  3I55 P;  1BGY E;  1PFI A;  1SQP D;  3CXH D;  2J58 A;  1PGO A;  4GOD A;  1NTM E;  4KHX A;  4YXD D;  1JMM A;  1JTH B;  1KB9 I;  4UB6 H;  1SQQ K;  3C1L A;  5CMZ A;  3Q5P A;  1QVF O;  3JC2 2;  2I1J A;  1N7S A;  4K35 A;  3BAT A;  4ZMD A;  1ZP0 C;  5C3J C;  2KS1 B;  1NTZ E;  2UWJ E;  3AED D;  1CSB A;  1DD3 A;  2HG5 D;  2WMM A;  1J1D C;  3AE6 C;  1KN7 A;  3CLQ A;  1L4A A;  2XND H;  2IZ1 A;  1ZN5 A;  3H1H D;  3B5N A;  1PZQ A;  4LDT A;  2MJZ A;  4LC1 A;  2YKP A;  2KOG A;  4U3F E;  1L4A C;  3HE4 B;  2LXC B;  2Z5I A;  4PV1 C;  2IFM A;  2IBZ I;  1BE3 D;  3O8Z A;  3M9Q A;  1L0L G;  1A02 J;  1VF5 C;  4B86 A;  3M0A A;  1GW4 A;  3MUD A;  4GDO A;  2JEE A;  1HTL C;  1VL2 A;  1PPJ E;  2M5A A;  4KX6 C;  1M1J A;  3ABV C;  2FXM A;  3MUD C;  3BRV B;  5H2F E;  3KXD A;  3CXH H;  1M1J C;  2Q5U A;  3PRJ A;  2H43 A;  1S4X A;  4GOE A;  3CCS P;  3CXH I;  4R4L A;  2BCC E;  3OW2 O;  1S3J A;  4N3Y B;  4H0L C;  1W2E A;  2YMK A;  1RF0 C;  2WPR A;  2W90 A;  1YHQ P;  4GT1 A;  5DJT B;  3AE7 C;  3WUV A;  1N2D C;  1NTM G;  2E76 B;  1BCC J;  2WPV B;  1FU1 A;  3VMA A;  3Q5S A;  2ZYG A;  4DDG A;  3V6I A;  2LXB A;  2OYI A;  1S5L E;  3W67 A;  1SQQ E;  2Z4E A;  3QWO C;  3F5H A;  3CWB J;  4YTP C;  1K8A Q;  3TGU J;  2GA1 A;  2PP6 A;  2OYI C;  2AEJ A;  1VQM P;  3CCJ P;  1DEB A;  2FFD A;  4HB1 A;  1NTZ G;  1YI2 P;  3L70 J;  2Y9Z A;  1SS1 A;  4ZKU A;  3L73 J;  4JQ0 D;  4OWF A;  3LW5 J;  1NOH A;  2JR8 A;  4YXW H;  1VQO P;  1X8Y A;  2YIU B;  5KTB A;  3P8M C;  1N7S D;  1RH5 B;  2K37 A;  1SQV G;  3JCU H;  2HOD B;  2KP8 A;  1N7L A;  2R44 A;  3IF4 A;  1KV4 A;  3AE8 D;  1IFP A;  1S5L H;  2OTK E;  4DDI A;  4L73 A;  5KLI B;  3HD7 A;  4TLF A;  2K9Y A;  5GTI E;  1DX7 A;  1ZOY D;  1LT9 A;  1SQB J;  3PH0 A;  3B5N D;  4WY4 A;  4DHI B;  2IDB A;  2OYH C;  5APY A;  2KZI A;  3GMA A;  3Q3D A;  3E7K A;  1KIL D;  2E75 C;  4WY4 C;  1OX3 A;  3M0D C;  1KQL A;  1JTH A;  2QIW A;  2FYU E;  1S2E A;  1PP9 J;  3HE5 B;  1NJI Q;  1NVO A;  5AW7 B;  3KHU A;  4N78 E; 
#chains in the Genus database with same CATH homology
 2G8Y A;  2ZT9 B;  4H13 C;  2BEZ F;  2WS3 C;  4YTN C;  3VRB C;  1KQF B;  1S1C X;  4Y28 J;  4TT3 H;  3S9O A;  2WDR D;  1IK7 A;  4H0L D;  3C8V A;  2H88 C;  2FYN C;  1KIL E;  3Q1M A;  2H89 C;  2B76 D;  3VR9 C;  1OW8 A;  3AE5 C;  3Q5R A;  3AE4 C;  2BS3 C;  1OW7 A;  3IN6 A;  3P4R C;  2ACZ C;  3VR8 D;  2E74 D;  4R4M A;  4YTP C;  1ZP0 D;  1Y9B A;  2E75 D;  3SFE C;  1KOR A;  5C3J D;  4IL6 X;  4H0L B;  3AEE C;  3B71 A;  3GLM A;  2WU2 C;  3T97 B;  4XFJ A;  3P4Q C;  3AE7 D;  1Q90 D;  2V7Q J;  2WSF J;  3D71 A;  3RL0 g;  4H44 D;  4I7Z B;  4PV1 C;  4Z1M H;  3FGA D;  3D70 A;  1KFY C;  4OGQ D;  2E74 B;  3GF3 A;  5L8R J;  3D6Y A;  1L0V D;  3AEF D;  1JB0 J;  1GMJ A;  1E7P C;  3P4S C;  1MKM A;  3AE6 D;  3AE8 C;  3P4P D;  3SFD C;  1VF5 C;  4H13 D;  4H44 B;  4YSX C;  2D2C B;  1EXJ A;  1KF6 C;  2WS3 D;  3P4P C;  3VRB D;  4U7J A;  4YTN D;  2O01 J;  3O6Q A;  3LW5 J;  2H88 D;  4YXD C;  3VR9 D;  5KKZ C;  2H89 D;  1RQV A;  3H25 A;  1PV3 A;  2FXP A;  5C2T C;  4GDO A;  3AE5 D;  1S5L X;  1NEN C;  2G3A A;  3AE4 D;  1K05 A;  1QLB C;  3P4R D;  2ACZ D;  2BS4 C;  3G9R A;  4YTP D;  1NEK C;  3SFE D;  1ZOY C;  2WSC J;  2WP9 D;  3AE3 C;  3Q2Y A;  3AEE D;  1VL2 A;  2WU2 D;  2WU5 C;  3P4Q D;  2JP3 A;  4KX6 C;  3ABV C;  1NYH A;  3AE9 C;  4YSY C;  4PV1 D;  1KFY D;  2E75 B;  4YT0 C;  1UIX A;  1WMK A;  2QJP C;  1PL5 A;  3AE2 C;  4YTM C;  3VRA C;  1YQ3 C;  3P4S D;  1DIP A;  4YSZ C;  2FBW C;  3AE8 D;  3SFD D;  2E76 C;  1VF5 D;  4YSX D;  3AEB C;  3AE1 C;  1U57 A;  4OGQ B;  1KF6 D;  3CIR C;  3RK3 E;  1EXI A;  3AEC C;  2WSE J;  2ZT9 C;  4YXD D;  3AED C;  1YQ4 C;  4RKU J;  2P10 A;  2WDV C;  5C2T D;  2WDQ C;  2D2C C;  1K04 A;  4H13 B;  2MKV A;  2WQY C;  2QJK C;  1NEN D;  2K9Y A;  3GF7 A;  2QJY C;  1VF5 B;  1R8E A;  1DD4 A;  5M1B A;  2JO1 A;  2OQQ A;  4R4L A;  2QSI A;  3AEG C;  1NEK D;  3AEA C;  1ZOY D;  2BEQ D;  3AE3 D;  2WU5 D;  1RQU A;  1HJ0 A;  4KX6 D;  1TU3 F;  2IDB A;  3Q5P A;  1KTM A;  2WDR C;  3ABV D;  2YIU C;  1AJY A;  2NZ2 A;  4H0L C;  3AE9 D;  4YSY D;  2B76 C;  2YMK A;  4YT0 D;  3GMA A;  3R4Y A;  1OMI A;  4I7Z C;  3AE2 D;  4YTM D;  3VRA D;  1YQ3 D;  1OW6 A;  3Q3D A;  3VR8 C;  4YSZ D;  2FBW D;  2E74 C;  1KQG B;  2E76 D;  1ZP0 C;  4PV1 B;  1FDI A;  2E75 C;  3D6Z A;  3AEB D;  5C3J C;  3AE1 D;  1ZRT E;  3CIR D;  1KMI Z;  2WP9 C;  3AE7 C;  3AEC D;  2QIW A;  2ZT9 D;  1HF9 A;  4H44 C;  3AED D;  1YQ4 D;  2WDV D;  2WDQ D;  1FDO A;  2D2C D;  3EWK A;  3IAO A;  4OGQ C;  4KT0 J;  1NGM B;  2E76 B;  1DD3 A;  2WQY D;  2WPV B;  1L0V C;  1ZME C;  3AEF C;  5KLI C;  2J5U A;  2BS2 C;  3Q5S A;  3AE6 C;  3AEG D;  1PIX A;  3AEA D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...