3AEFC

Crystal structure of porcine heart mitochondrial complex ii with an empty quinone-binding pocket
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of porcine heart mitochondrial complex II with an empty quinone-binding pocket
rcsb
molecule tags Oxidoreductase
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
total genus 50
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3aefC01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3aefC02
2H89C 4YTMC 2WS3D 3P4RC 4YT0C 3VR8D 2WU5D 2FBWD 4YTND 3AE8D 4YTPD 3AE6C 1ZP0D 3AECD 2WP9C 2G3AA 3AE7D 2WU2C 3P4PC 3AEAC 3AE5C 3AE3C 1YQ3D 3AEFC 2H88D 2WDVD 3AE1C 3SFDD 3ABVD 3AE4D 2WQYD 4YXDD 2WDQC 3AE9D 3AEED 4YSZD 3AEGD 3VRBD 1NENC 4YSXC 1E7PC 2B76C 3AEDD 3AEBD 1NEKC 5C3JC 4KX6D 2WDRC 1K04A 3VR9D 1YQ4C 2ACZD 1KFYC 4YSYD 2WS3C 3P4RD 2BS3C 1KF6D 3P4SD 3VRAC 3CIRC 3P4QC 3AE2C 1OW8A 3B71A 3SFED 3VR8C 2WU5C 1OW6A 3AE8C 4YTNC 5C2TD 3S9OA 3AECC 2WP9D 3AE7C 3AEAD 3AE3D 3AEFD 2H88C 1PV3A 1L0VD 1ZOYD 2BS2C 2H89D 4YTMD 3SFDC 2WQYC 1QLBC 2BS4C 4YT0D 3AE9C 4YSXD 1OW7A 2FBWC 2B76D 3AEDC 4YTPC 3AEBC 1ZP0C 3AE6D 4KX6C 2WDRD 3VR9C 1YQ4D 2WU2D 2ACZC 1KFYD 3P4PD 4YSYC 3AE5D 1YQ3C 2WDVC 1KF6C 3P4SC 3VRAD 3AE1D 3CIRD 3ABVC 3AE4C 4YXDC 3SFEC 3AE2D 2WDQD 3P4QD 1KTMA 3AEEC 4YSZC 5C2TC 3AEGC 3VRBC 1NEND 1K05A 1NEKD 1L0VC 5C3JD 1ZOYC
chains in the Genus database with same CATH superfamily
1NU1D 1AQTA 2GM4A 2AEMA 3P4RC 3RL0B 1N7SD 5AVXB 3P7KA 4I6MC 1NTZK 2QRXA 3AE8D 1RH5B 2QM7A 3RK3C 3SWKA 3IN6A 3AEAC 2AEFA 2WDVD 4I1LA 2WSEJ 1EZVD 2PGDA 3AE9D 5CCHD 3RL0g 3D6YA 3LW5J 1E7PC 2B76C 3GLMA 4UB8H 3JC22 4OWFA 4H44D 4BRYB 3W68A 3CCJP 3VN0A 4RO0A 3KPEA 2BS3C 3JCUE 5C2TD 5GTHH 1GDTA 1S9KD 1RE3A 3G6EP 1KILA 1BSNA 4WY4B 5KLVJ 2NRGA 1SQQD 2I1KA 3OAKA 2FBWC 4I2LC 1NTMG 4OGQC 2HFED 3L75E 5KTBA 1OX3A 2D2CC 2B87A 3JCUH 1KFMA 2D2CB 4C7NB 1A02J 1FZCC 5AW3B 3AEGC 5CCGA 2BEQD 2R3CA 1LT1A 2WTYA 1NEKD 1VQLP 4RJTA 2BCCD 5KAFH 4ZKPA 2ZAEB 3CMEP 2FFDB 2FY8A 1GZLA 2JWAA 1IZNB 1RQVA 1NH4A 1URQC 4IL6H 3SWYA 4YPCA 4YXDD 1U57A 1DD4A 1PL5A 4Y99C 2B88A 1VQMP 1IO4A 3WU2E 1FDMA 2A06G 3PLNA 1YBKA 2PP6A 1NGMB 3B4SA 4NPDA 3L75D 3AEBD 4U3FG 3L73G 4KX6D 2KSJA 2WPSA 4ASVA 5AW6B 1N73A 2NPSD 1KFYC 1VDFA 1FAVA 3VRAC 3MTUE 1FZAA 4UB8E 4R4LA 5GTHE 2L91A 4O9BA 1OZHA 2FYUE 4PD4E 1VF5D 1J1EB 3AE6D 2M5AA 3AE5D 1YQ3C 2KS1A 2W83C 3VMZA 3P4SC 3AE1D 3P32A 1LWUC 3P4QD 3EFFK 2POHA 1LTJB 1Z56A 3PTZA 2XNXA 4H44B 1IFMA 1S5LH 4BWNA 4H44C 1GW3A 2P58A 3MIWA 4XE5B 3G71P 2QSIA 2ITAA 2CPSA 5KAFE 2ZT9B 1DH3A 1LTAC 4K35A 5APXA 2XNDH 1RF0C 1IC2A 1FDOA 1IFIA 1SQPE 3P8MC 2Q3EA 1NJIQ 2E76B 2GUVA 5AVRB 3FWLA 4PJ0E 1KYOH 5AVYB 5AW0B 4L73A 2N9BA 2ACZD 2D2CD 2WSEH 1CZQA 1IFNA 3SFED 1QEXA 1MUUA 1JY2P 2WU5C 3AE8C 4IFDK 4HYTB 3S9OA 1NAFA 1GL2D 3RK3D 1YJWP 1N73B 2H88C 2IFMA 1NTMJ 3L70D 3AE9C 2QJKC 1OW7A 2A45G 2QJKB 3A0HE 1YQ4D 5TISE 1GMJA 2CK3H 3OW2O 1SQPD 2WSCH 2KIKA 1SQBK 1PGJA 1KZUB 3BASA 2Y9YA 3HTKA 2M5AB 3RK2B 1RE4C 3H1ID 2KS1B 1L0NE 1OXZA 3N4XA 2FYUD 1QL2A 2YO2A 1P84I 1HH0A 1USEA 4IFFA 1H88A 4I7ZC 3IF4A 3AECD 4D6TE 1RE4A 1PPJE 4OGQB 2GA1A 1BGYE 3AE3C 3TGUJ 4M3LA 4ZMDA 4WBAA 3H25A 3L73J 1KYOI 4H0LB 3AEGD 1SQVG 2K1AA 1VF5C 3TGUE 3FGAD 3RBXA 3ITKA 3B5NB 3GG2A 2IZ1A 4N6JA 3P4SD 2KUBA 2C0XA 3KXDA 1SQXG 3H1JJ 3U1CA 4W7YA 3CX5I 1X79B 5KAIE 3D6ZA 1LTIC 4NPFX 1OIPA 1X8YA 2HODB 3F5HA 4YT0D 1OVRA 1Q2NA 1LGHB 4IFMA 5BU5A 2G8YA 1SQBD 3S4RA 3GHGB 4JYCA 4KX6C 1SQQG 2WU2D 4YSYC 2KP8A 2OYIC 2Q3IA 1FZGA 3VRAD 3CIRD 1NTMD 1YTZI 5KLVE 1BGYJ 4U7JA 1TU3F 2OARA 1JY3P 2ZYGA 2ZYAA 3CWBG 3VOPA 1KV4A 1VL2A 3AE6C 4CPGA 2BCCG 1MZ9A 3AE5C 1YQ3D 4PV1C 3BCCD 3V6IA 2B87B 3NTNA 4MN4C 2L5GB 1SQPK 3H6PA 2JKVA 3L74G 1NKZB 2QJPB 1ZXGA 3HUSA 3KZIE 2RMZA 1BDDA 3VR9D 4GIFA 4KT0J 2O01N 3V5BA 1PGQA 2Z5IA 3V4WA 1N7SC 5KLVD 1KQGB 1N86A 5AVVB 2ZT9C 4HH2A 1NTKJ 3GMAA 1NOHA 4AQRD 2KI7B 3L74D 5B66E 1NWQA 3TSIA 5APTA 1NO4A 4EIJA 3P8CE 2YXRB 1BE3E 2IFNA 2W6JH 1JY2O 3LW5H 2N1TA 4LLHA 3PP5A 2W8ZA 4TT3H 1NTZE 4UB6H 2WDQD 2AXCA 2E42A 3CCMP 1PFIA 2HLOA 1BCCG 1M1JA 3MHVA 1FOSE 3EQ2A 1T6AA 1R5SA 1NYHA 3C9IA 3L37A 5H2FE 4KJMA 3H1KE 1Q81Q 1AJYA 3CD6P 2YMKA 4OH8B 3CCVP 3EFGA 2V7QH 3L71J 4N3YB 5CJ4A 4N78D 3MUDC 1EDIA 2YO3A 1VQ8P 5AW2B 3TGUD 2WT7B 2IBZG 1RY3A 1M90Q 1S5LE 4YSXC 2XV5A 1KQLA 1UIIA 1NEKC 3FX0A 1YJ9P 3CX5E 1KILB 2GUSA 2Q1KA 3H1HJ 1KQSO 1NU1E 3IFMA 3T97B 1OVVA 3PRJA 1SQVK 3L72E 4TLFA 2E5TA 1JCDA 4U3FE 1URQD 1WT6A 2XU6A 3AEFD 1L0VD 2H89D 3B5NA 1QLBC 3NXSA 5AVZB 2M3EA 3A7OA 3I5CA 1S2EA 2WSSH 1T3UA 4PD4H 3AEBC 3RBZA 2IBZD 2W6AA 1L4AB 2NPSC 1KFYD 1VQPP 1L4AC 4WY4D 3P8CD 3H1LG 1LTSC 4IL6E 1EZVE 1X9VA 3KHUA 1NEND 3L4FA 1K05A 3HD7B 3L71D 1JY2N 3CL3D 1SP4A 1GK6A 1VPCA 5C3JD 2N1TB 5B5EH 1PP9J 2WS3D 2YKPA 4FJVA 2KSEA 2ZT9D 2QM8A 3CCQP 2RKLA 2WU2C 3CCRP 2SPZA 3AE1C 1NHLA 2E76C 1JOCA 3EWKA 2K9JB 1N2DC 2MKVA 4HKZH 1LWUA 3CXHI 2E74D 1JMBA 3AE2C 3WUUA 2KOGA 1SQXJ 3L70G 1HUCA 3RK3B 3KYQA 3CWBJ 3CCLP 1ZOYD 3GF7A 2WT7A 5KAIH 1FBMA 3H1HG 2WPRA 2WMMA 1RHZB 1E5WA 2E75B 4H13B 4GOFA 1U7MA 1EDKA 4JBZA 3M0AA 3N7NA 3WU2H 2YNYA 1FZFA 2ACZC 3SFEC 1JM0A 5CMZA 3AEEC 1LJ2A 2OTLP 1PIXA 2JDIH 2M0BA 3CXHD 5KLIB 1S5LX 1FS0E 2FYUK 3H1KD 1GL2A 2O01J 1PPJD 3V2PA 1IFPA 4Z1MH 4IL6X 3QWOC 1L4AA 2XZRA 2M8RA 4GDOA 2I1JA 1MV8A 3VR8D 1W5CE 1S3JA 1JTHB 1CW5A 2A45I 1URQB 2WP9C 1G1IA 2FKWB 2WDQC 2OTJP 1KC8Q 3HD7A 2PFXA 3H1JD 3MD0A 3WUVA 1VQOP 3L75J 3LIEA 2J58A 3OA7A 2OYIB 2P2UA 3HE4B 1L0LE 1NTME 3HE5A 3H1LJ 1IK7A 1MFZA 3HD7D 2BEZF 1SQVE 3AECC 2IYPA 1EC5A 1HWTC 1R8EA 5GTIE 2WITA 3CLQA 1H8AA 2OQQA 4YTMD 2J59M 3SFDC 3M0DA 1ZRTE 5EFWB 1M56D 2CPBA 3C1LA 2OGUA 3VTPC 3M9HA 1GK4A 1L0NK 4PV1B 5KKZC 1LWUB 1PP9D 3E1RA 1OMIA 3AE4C 2FYZA 2R5DA 1KYOE 2V4HA 3PH0A 3RGUA 4W80A 2A06E 1L0VC 5APYA 3SSUA 2H89C 3H1IG 3L73E 4YT0C 3O6QA 3CCEP 5KJ7A 3TF5A 4GKGA 4AUWA 3BATA 2FYNB 4YTND 2WZ7A 1PZQA 3H32A 1W2EA 4WY4A 1YJNP 2WPQA 3B8EB 2O1KA 4YSZD 5KJ7D 2HPCA 1JTHA 1GD2E 4DHJA 2WSFJ 1SQBG 4OGQD 5C3JC 5AVWB 5CCGD 5L8RJ 3RL0D 1RF1C 1OWAA 3K5BA 3H1HD 1URQA 3P4RD 1LP1A 3L70J 1FZCB 3FXEA 4H0LD 1X22A 1DIPA 1OW6A 2C9LY 3FXDA 1XTCC 1Q82Q 3II6A 1GTWA 3AEAD 3GHGA 2OYIA 2JP3A 5AW4B 1LP1B 2RH0A 4C46A 1KB9E 1IJDB 2K9JA 2FFDC 5CCHC 3L35A 4DDIA 3VYIA 2IPPA 2V7QJ 2WPVB 1D7MA 3VR9C 3D71A 4DCKA 1R5LA 2W27A 3I56P 1ZMEC 1KN7A 1U7JA 4YXDC 1KORA 1BE3J 5AW5B 1GW4A 4EOTA 1VQ5P 3L75G 1LTGC 3Q3DA 1LNQA 3M9BA 1ZOYC 1SS1A 3MZWB 1PP9G 1NKNA 3M0DC 3L71G 4R4MA 2KZJA 3BCCE 3VMAA 2FBWD 4YTPD 5APUA 5E79E 3HUSB 4EDFA 3NFQA 5TJHA 4L76A 1CI6B 2P1JA 3U59A 3H1JE 5AVSB 5APWA 2Q6QA 4L74A 3CCSP 2YIUC 1YITP 2ZFCA 3MUDA 3AEDD 1FZEA 1KILC 1VF5B 1DEBA 3RK2C 2P7JA 1SQVD 1Q7YQ 4K3AA 3P4QC 2BASA 2KYVA 1JMMA 2K3RA 1EDLA 2FYUG 1M1JC 2HPCB 1QGKB 3U1AA 1KQFB 1BSHA 4DOJA 1JEKA 2H8PD 2OYHA 5GTIH 1QL1A 1T8ZA 3BVHA 1ZP0C 3B5NC 1Y47A 3VMXA 3CWBE 2ZYDA 1N7LA 2FYUJ 5AW7B 2ZVOB 3KZIH 3TNUA 1H89A 3VRBC 5CBOA 2HG5D 2NPSA 2Q5UA 1VQKP 1TFFA 3L74E 4YTMC 3RL0C 2PRRA 3LIDA 3A0BE 1A02F 2E43A 1VQ9P 2ZVNB 2FXMA 3FWNA 5AW9B 2BCCJ 1JY3O 1ZN5A 2R5BA 2LKMA 3V2RA 3L36A 2RN0A 1SFCC 1MFTA 1AQ5A 4DJGA 1NU1K 1NU1J 4WY4C 3H1LD 3AE4D 3BRVB 3L72J 3M91A 1SQQK 1S9KE 1CSBA 4U3FJ 1GU4A 3VMYA 4DHZA 3WUTA 1K9MQ 1YQ4C 3H32B 1QX8A 1ZW0A 2FXOA 3L73D 2LXCB 3B71A 2E74B 2PAJA 3W67A 1SVFA 1KB9D 2A45H 2W6BA 1PV3A 2W90A 3CPWO 2IBZI 1L0LJ 1JUNA 3TDKA 2E76D 2KLUA 3KQGA 4WWIA 1LT9B 2AXTE 4I7ZB 5B66H 4YTPC 4H13D 2E75D 3H1KJ 2JWDA 2WVRA 1P84H 2KNCA 5CCGC 3L74J 2B89A 4EI2A 1USDA 3C8VA 5APSA 2BCCE 4N78E 1YIJP 1KF6C 3H1HE 3AE2D 1SQXK 2XKMA 1GL2B 5AVQB 2ZJSE 2QEXP 1GL2C 4PJ0H 1NVOA 1RF1A 2ZXXA 2Y9ZA 4D6TG 1SQPJ 1IK9A 3A2AA 4XA4A 2Q7CA 1NTKE 4IOIH 1MKMA 5AVUB 2Z5HA 1DEEG 2A06D 5H2FH 2K37A 2N1TD 1ZRTD 1Q86Q 4EYYQ 1AFOA 1T3JA 3CXHE 3Q5SA 3AEED 4D6TD 3JSVC 4UB6E 1PPJG 1J1EC 1FOSF 2H7HA 1FC2C 5KKZB 2WDRC 1SQVJ 1L0LK 4YSYD 5APQA 3CIRC 3CC7P 4YXWH 5BVZA 3V2NA 4HB1A 3VR8C 3TGUG 1HTLC 2JO1A 2O1JA 2WP9D 3F89A 3H1LE 3AE3D 4KHXA 1G1JA 1EZVG 1J2JB 1L0LG 2C0WA 1BCCE 1W2BO 2WQYC 2Y0CA 3V4QA 1SQQJ 1EZVI 2DW3A 3AEDC 3G9RA 3P4PD 3CCUP 4PV1D 4WB4A 1Q90D 1WRGA 5APVA 1LT9A 2QJPC 1H0TA 4ASWA 5DJTB 3CC4P 2K9YA 1N7SB 1JCCA 1SLQA 1NU1G 1ZP0D 1EXIA 2QG4A 1N73C 2G3AA 5K5GB 1HJBA 1NTZD 1LTTC 1M57D 2ZXEB 2QA4P 3VRBD 2LXBA 3L72D 5TISH 1RF0A 3RK3E 1QLED 1RF1B 2KB7P 1K04A 2P67A 3HE5B 3O8ZA 1KF6D 3G4SP 1Y9BA 4BRYA 2LR2A 1OFCX 4YTNC 4RESB 1VQNP 1SFCD 2AXTH 1NAYA 1EDJA 2QJYC 3PHLA 1BE3G 2JEEA 1OVUA 1ZLLA 3R4YA 5CBNA 1NTMK 1XTGB 1FJKA 5KJ7C 1S4XA 4LDTA 1E79H 4LGDE 4ZNCA 1KYOD 2WSFH 5AW8B 2OYOA 2KK7A 1J1DB 2Y0DA 1L0LD 1J1DC 4GOEA 1SQXE 1KTMA 4H0LC 2Y0EA 2FXPA 2O01H 2YMYA 5KLIC 3VONA 3H1IJ 2IDBA 2I8DA 1CI6A 1BCCJ 2YKQA 3GF3A 3IAOA 1T2KD 4WVZA 1LT9C 1LTBC 3MP7B 2Q9IA 2IX7C 1YI2P 3AEFC 2JJLA 1N7SA 3L70E 4JPZB 3ABVD 1G2CB 2WQYD 1PP9E 3TYYA 3A0HH 1FE6A 3PJSK 1L0NG 3CC2P 3IR9A 1VQ6P 1K8AQ 2H43A 1S72P 3CWBD 2IZ0A 4XFJA 2NPSB 1AA0A 1YHQP 1L4AD 5AW1B 4D6TJ 1BGYG 2VRSA 1M1JB 2E5YA 3AE7C 1M8OB 1S1CX 1L0ND 3ZDMA 2N1TC 1L0NJ 2R44A 1RQUA 2C9NY 1AV1A 4Y99B 3CI9A 2N9YB 1PGPA 3MGNA 1JO5A 4YSXD 5CHXA 3CX5H 1KILD 1GU5A 3USSA 5AVTB 1FJPA 2KZIA 3UIAA 2YKOA 3RK2D 4BXLA 5M1BA 2WDVC 4DHIB 3A5TA 3CMAP 1ZR4A 1KFNA 1M1KQ 1IFJA 4PD4D 1HF9A 1SQBJ 1RE3C 4LC1A 3Q2YA 1X0TA 1HBWA 3E7KA 3A0BH 3T97A 3O6QB 1SQPG 5B5EE 5C39A 1BCCD 2E74C 1FU1A 1SQBE 1QVGO 1DX7A 1SFCB 4RKUJ 2WU5D 5E79H 1KB9H 1H0TB 3B5ND 4JQ0D 3D70A 3P4PC 1NTZG 2WWWA 2H88D 1JY3N 1WMKA 3V2QA 2J5UA 1NENC 1NTKD 1LTJC 2AEJA 1P84E 2HR3A 2OYHC 3Q5PA 2WS3C 3M06A 2OYHB 1YTZT 4I6LA 2QE7H 4HJGH 4C7NA 1G2CA 3NMDA 3BRTB 5CCHA 1M7LA 1HVVA 3OJAB 2Z4EA 2BS2C 4W7ZA 2NZ2A 5KLVK 3H1IE 3TNUB 3HRNA 2B76D 3CXHH 2K88A 3G3ZA 1SQXD 3BCCG 1ZV8A 1EXJA 3ABVC 1FZCA 2O3JA 1HGVA 1VQ7P 5C2TC 1L2PA 3M9QA 4Y28J 1VQ4P 3A3YB 4JF7A 3H1JG 1IFDA 3VP8A 4NPEA 2QJYB 3VP9A 3R2PA 2JR8A 1KMIZ 1KB9I 3HTKB 1JNMA 1YYCA 3HUSC 4GODA 1UIXA 2E75C 4H13C 2B9BA 4AYCA 1ZR2A 3E1IA 1AVOA 2IYOA 3CX5D 3AE7D 1NTZJ 2R32A 1EQ7A 3S1KA 3SFDD 1Y8AA 5DJUB 2YIUB 4A7PA 2UWJE 3Q5RA 4ZKUA 3QH9A 1NTKG 3KDPB 2MJZA 3H1KG 3SWFA 4U3FD 1SFCA 4DZOA 1QVFO 3BCCJ 2YXQB 2OTKE 1T2KC 1OW8A 1BDCA 1PGOA 1K73Q 3TK1A 1N8RQ 1DD3A 2IBZE 3Q1MA 1LTJA 2ZFYA 1SQQE 2KNCB 4DDGA 1KILE 2KLVA 3WMM0 2BS4C 5KLVG 2FYNC 1P84D 5CJ0A 2HODA 2P10A 2QVAA 4OVNF 1KD1Q 3L71E 4GT1A 5BU8B 4L75A 2WDRD 1JB0J 4QMAA 3GHGC 3L72G 1FZBA 1FDIA 3I55P 2WSCJ 2XDJA 3HE4A 2R3SA 1BE3D 1HJ0A 2KXPB 1NTKK 4YSZC 1HGZA 4PD4I 2FFDA 2QIWA 3HD7C 4C7RA 1AVYA 2HYNA 4DT0A 4JYBA 2M3BA 4B86A 3GW6A 1BGYD
chains in the Genus database with same CATH topology
2H89C 4H44C 4Z1MH 2IDBA 1NYHA 2K9YA 4YTMC 4IL6X 2WS3D 3P4RC 4YT0C 3O6QA 3GF3A 2QSIA 1KMIZ 2E74C 3IAOA 1AJYA 2ZT9B 2YMKA 4GDOA 4R4MA 3VR8D 4RKUJ 2WU5D 1VL2A 2ZT9D 2FBWD 4YTND 3AE8D 4YTPD 1UIXA 2E75C 4H13C 4I7ZC 3AE6C 1ZP0D 1EXIA 1MKMA 3AECD 2WP9C 4OGQB 2G3AA 3D70A 3AE7D 2WU2C 3IN6A 1RQVA 3P4PC 3AEAC 3AE5C 3AE3C 1YQ3D 3AEFC 2H88D 4PV1C 2WDVD 1WMKA 3AE1C 2WSEJ 1FDOA 3SFDD 3ABVD 3AE4D 2WQYD 1U57A 4YXDD 2WDQC 1DD4A 3H25A 2E76C 1PL5A 3AE9D 3Q5SA 2J5UA 3AEED 4YSZD 3EWKA 4H0LB 3AEGD 2E76B 2YIUC 3RL0g 3Q5RA 1NENC 3VRBD 3D6YA 3LW5J 4YSXC 1VF5C 1E7PC 3FGAD 3RK3E 1NGMB 2B76C 3GLMA 3AEDD 2WSFJ 3AEBD 2MKVA 1VF5B 4OGQD 1NEKC 5C3JC 4XFJA 4H44D 4KX6D 2WDRC 1K04A 3VR9D 5L8RJ 3Q2YA 1YQ4C 2ACZD 1KFYC 4YSYD 3Q5PA 4KT0J 2WS3C 3P4RD 2D2CD 2BS3C 1KF6D 3P4SD 1Y9BA 2E74D 3CIRC 3VRAC 1KQGB 3T97B 1IK7A 3P4QC 3AE2C 1OW8A 3B71A 2E74B 3SFED 3VR8C 2WU5C 4H0LD 2ZT9C 1DIPA 1OW6A 3AE8C 4YTNC 5C2TD 2BEZF 3S9OA 2JO1A 4R4LA 3AECC 3GMAA 1DD3A 3Q1MA 2WP9D 3AE7C 1KQFB 1S1CX 2QJYC 3AEAD 2JP3A 3AE3D 1R8EA 2H88C 1PV3A 3D6ZA 1L0VD 3AEFD 1ZOYD 2BS2C 3GF7A 2H89D 2OQQA 4YTMD 3SFDC 1KILE 1RQUA 2WQYC 1QLBC 2NZ2A 3R4YA 4YSYC 2BS4C 2E76D 4YT0D 3AE9C 1ZRTE 2FYNC 2QJKC 2E75B 4H13B 2P10A 1OW7A 1VF5D 4I7ZB 4YSXD 2FBWC 2B76D 3AEDC 4YTPC 2V7QJ 2G8YA 2E75D 2WPVB 3AEBC 4H13D 1ZP0C 3G9RA 3AE6D 4OGQC 4KX6C 2WDRD 3VR9C 1JB0J 3D71A 1YQ4D 2WU2D 4PV1B 5M1BA 5KKZC 1GMJA 1KFYD 2ACZC 3AE5D 3P4PD 2D2CC 5KLIC 3C8VA 1YQ3C 1FDIA 2WDVC 4PV1D 2WSCJ 1ZMEC 1KF6C 3P4SC 3VRAD 3AE1D 3CIRD 1OMIA 1EXJA 2D2CB 3ABVC 3AE4C 1Q90D 3SFEC 4TT3H 4YXDC 2WDQD 3AE2D 3P4QD 1HJ0A 1KTMA 1KORA 2QJPC 3AEEC 4H0LC 4YSZC 2QIWA 1PIXA 5C2TC 2FXPA 3AEGC 4Y28J 3VRBC 1NEND 1K05A 1S5LX 2BEQD 1HF9A 2O01J 4H44B 3Q3DA 4U7JA 1NEKD 1L0VC 1TU3F 5C3JD 1ZOYC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H89 C;  4YTM C;  2WS3 D;  3P4R C;  4YT0 C;  3VR8 D;  2WU5 D;  2FBW D;  4YTN D;  3AE8 D;  4YTP D;  3AE6 C;  1ZP0 D;  3AEC D;  2WP9 C;  2G3A A;  3AE7 D;  2WU2 C;  3P4P C;  3AEA C;  3AE5 C;  3AE3 C;  1YQ3 D;  3AEF C;  2H88 D;  2WDV D;  3AE1 C;  3SFD D;  3ABV D;  3AE4 D;  2WQY D;  4YXD D;  2WDQ C;  3AE9 D;  3AEE D;  4YSZ D;  3AEG D;  3VRB D;  1NEN C;  4YSX C;  1E7P C;  2B76 C;  3AED D;  3AEB D;  1NEK C;  5C3J C;  4KX6 D;  2WDR C;  1K04 A;  3VR9 D;  1YQ4 C;  2ACZ D;  1KFY C;  4YSY D;  2WS3 C;  3P4R D;  2BS3 C;  1KF6 D;  3P4S D;  3VRA C;  3CIR C;  3P4Q C;  3AE2 C;  1OW8 A;  3B71 A;  3SFE D;  3VR8 C;  2WU5 C;  1OW6 A;  3AE8 C;  4YTN C;  5C2T D;  3S9O A;  3AEC C;  2WP9 D;  3AE7 C;  3AEA D;  3AE3 D;  3AEF D;  2H88 C;  1PV3 A;  1L0V D;  1ZOY D;  2BS2 C;  2H89 D;  4YTM D;  3SFD C;  2WQY C;  1QLB C;  2BS4 C;  4YT0 D;  3AE9 C;  4YSX D;  1OW7 A;  2FBW C;  2B76 D;  3AED C;  4YTP C;  3AEB C;  1ZP0 C;  3AE6 D;  4KX6 C;  2WDR D;  3VR9 C;  1YQ4 D;  2WU2 D;  2ACZ C;  1KFY D;  3P4P D;  4YSY C;  3AE5 D;  1YQ3 C;  2WDV C;  1KF6 C;  3P4S C;  3VRA D;  3AE1 D;  3CIR D;  3ABV C;  3AE4 C;  4YXD C;  3SFE C;  3AE2 D;  2WDQ D;  3P4Q D;  1KTM A;  3AEE C;  4YSZ C;  5C2T C;  3AEG C;  3VRB C;  1NEN D;  1K05 A;  1NEK D;  1L0V C;  5C3J D;  1ZOY C; 
#chains in the Genus database with same CATH topology
 1NU1 D;  1AQT A;  2GM4 A;  2AEM A;  3P4R C;  3RL0 B;  1N7S D;  5AVX B;  3P7K A;  4I6M C;  1NTZ K;  2QRX A;  3AE8 D;  1RH5 B;  2QM7 A;  3RK3 C;  3SWK A;  3IN6 A;  3AEA C;  2AEF A;  2WDV D;  4I1L A;  2WSE J;  1EZV D;  2PGD A;  3AE9 D;  5CCH D;  3RL0 g;  3D6Y A;  3LW5 J;  1E7P C;  2B76 C;  3GLM A;  4UB8 H;  3JC2 2;  4OWF A;  4H44 D;  4BRY B;  3W68 A;  3CCJ P;  3VN0 A;  4RO0 A;  3KPE A;  2BS3 C;  3JCU E;  5C2T D;  5GTH H;  1GDT A;  1S9K D;  1RE3 A;  3G6E P;  1KIL A;  1BSN A;  4WY4 B;  5KLV J;  2NRG A;  1SQQ D;  2I1K A;  3OAK A;  2FBW C;  4I2L C;  1NTM G;  4OGQ C;  2HFE D;  3L75 E;  5KTB A;  1OX3 A;  2D2C C;  2B87 A;  3JCU H;  1KFM A;  2D2C B;  4C7N B;  1A02 J;  1FZC C;  5AW3 B;  3AEG C;  5CCG A;  2BEQ D;  2R3C A;  1LT1 A;  2WTY A;  1NEK D;  1VQL P;  4RJT A;  2BCC D;  5KAF H;  4ZKP A;  2ZAE B;  3CME P;  2FFD B;  2FY8 A;  1GZL A;  2JWA A;  1IZN B;  1RQV A;  1NH4 A;  1URQ C;  4IL6 H;  3SWY A;  4YPC A;  4YXD D;  1U57 A;  1DD4 A;  1PL5 A;  4Y99 C;  2B88 A;  1VQM P;  1IO4 A;  3WU2 E;  1FDM A;  2A06 G;  3PLN A;  1YBK A;  2PP6 A;  1NGM B;  3B4S A;  4NPD A;  3L75 D;  3AEB D;  4U3F G;  3L73 G;  4KX6 D;  2KSJ A;  2WPS A;  4ASV A;  5AW6 B;  1N73 A;  2NPS D;  1KFY C;  1VDF A;  1FAV A;  3VRA C;  3MTU E;  1FZA A;  4UB8 E;  4R4L A;  5GTH E;  2L91 A;  4O9B A;  1OZH A;  2FYU E;  4PD4 E;  1VF5 D;  1J1E B;  3AE6 D;  2M5A A;  3AE5 D;  1YQ3 C;  2KS1 A;  2W83 C;  3VMZ A;  3P4S C;  3AE1 D;  3P32 A;  1LWU C;  3P4Q D;  3EFF K;  2POH A;  1LTJ B;  1Z56 A;  3PTZ A;  2XNX A;  4H44 B;  1IFM A;  1S5L H;  4BWN A;  4H44 C;  1GW3 A;  2P58 A;  3MIW A;  4XE5 B;  3G71 P;  2QSI A;  2ITA A;  2CPS A;  5KAF E;  2ZT9 B;  1DH3 A;  1LTA C;  4K35 A;  5APX A;  2XND H;  1RF0 C;  1IC2 A;  1FDO A;  1IFI A;  1SQP E;  3P8M C;  2Q3E A;  1NJI Q;  2E76 B;  2GUV A;  5AVR B;  3FWL A;  4PJ0 E;  1KYO H;  5AVY B;  5AW0 B;  4L73 A;  2N9B A;  2ACZ D;  2D2C D;  2WSE H;  1CZQ A;  1IFN A;  3SFE D;  1QEX A;  1MUU A;  1JY2 P;  2WU5 C;  3AE8 C;  4IFD K;  4HYT B;  3S9O A;  1NAF A;  1GL2 D;  3RK3 D;  1YJW P;  1N73 B;  2H88 C;  2IFM A;  1NTM J;  3L70 D;  3AE9 C;  2QJK C;  1OW7 A;  2A45 G;  2QJK B;  3A0H E;  1YQ4 D;  5TIS E;  1GMJ A;  2CK3 H;  3OW2 O;  1SQP D;  2WSC H;  2KIK A;  1SQB K;  1PGJ A;  1KZU B;  3BAS A;  2Y9Y A;  3HTK A;  2M5A B;  3RK2 B;  1RE4 C;  3H1I D;  2KS1 B;  1L0N E;  1OXZ A;  3N4X A;  2FYU D;  1QL2 A;  2YO2 A;  1P84 I;  1HH0 A;  1USE A;  4IFF A;  1H88 A;  4I7Z C;  3IF4 A;  3AEC D;  4D6T E;  1RE4 A;  1PPJ E;  4OGQ B;  2GA1 A;  1BGY E;  3AE3 C;  3TGU J;  4M3L A;  4ZMD A;  4WBA A;  3H25 A;  3L73 J;  1KYO I;  4H0L B;  3AEG D;  1SQV G;  2K1A A;  1VF5 C;  3TGU E;  3FGA D;  3RBX A;  3ITK A;  3B5N B;  3GG2 A;  2IZ1 A;  4N6J A;  3P4S D;  2KUB A;  2C0X A;  3KXD A;  1SQX G;  3H1J J;  3U1C A;  4W7Y A;  3CX5 I;  1X79 B;  5KAI E;  3D6Z A;  1LTI C;  4NPF X;  1OIP A;  1X8Y A;  2HOD B;  3F5H A;  4YT0 D;  1OVR A;  1Q2N A;  1LGH B;  4IFM A;  5BU5 A;  2G8Y A;  1SQB D;  3S4R A;  3GHG B;  4JYC A;  4KX6 C;  1SQQ G;  2WU2 D;  4YSY C;  2KP8 A;  2OYI C;  2Q3I A;  1FZG A;  3VRA D;  3CIR D;  1NTM D;  1YTZ I;  5KLV E;  1BGY J;  4U7J A;  1TU3 F;  2OAR A;  1JY3 P;  2ZYG A;  2ZYA A;  3CWB G;  3VOP A;  1KV4 A;  1VL2 A;  3AE6 C;  4CPG A;  2BCC G;  1MZ9 A;  3AE5 C;  1YQ3 D;  4PV1 C;  3BCC D;  3V6I A;  2B87 B;  3NTN A;  4MN4 C;  2L5G B;  1SQP K;  3H6P A;  2JKV A;  3L74 G;  1NKZ B;  2QJP B;  1ZXG A;  3HUS A;  3KZI E;  2RMZ A;  1BDD A;  3VR9 D;  4GIF A;  4KT0 J;  2O01 N;  3V5B A;  1PGQ A;  2Z5I A;  3V4W A;  1N7S C;  5KLV D;  1KQG B;  1N86 A;  5AVV B;  2ZT9 C;  4HH2 A;  1NTK J;  3GMA A;  1NOH A;  4AQR D;  2KI7 B;  3L74 D;  5B66 E;  1NWQ A;  3TSI A;  5APT A;  1NO4 A;  4EIJ A;  3P8C E;  2YXR B;  1BE3 E;  2IFN A;  2W6J H;  1JY2 O;  3LW5 H;  2N1T A;  4LLH A;  3PP5 A;  2W8Z A;  4TT3 H;  1NTZ E;  4UB6 H;  2WDQ D;  2AXC A;  2E42 A;  3CCM P;  1PFI A;  2HLO A;  1BCC G;  1M1J A;  3MHV A;  1FOS E;  3EQ2 A;  1T6A A;  1R5S A;  1NYH A;  3C9I A;  3L37 A;  5H2F E;  4KJM A;  3H1K E;  1Q81 Q;  1AJY A;  3CD6 P;  2YMK A;  4OH8 B;  3CCV P;  3EFG A;  2V7Q H;  3L71 J;  4N3Y B;  5CJ4 A;  4N78 D;  3MUD C;  1EDI A;  2YO3 A;  1VQ8 P;  5AW2 B;  3TGU D;  2WT7 B;  2IBZ G;  1RY3 A;  1M90 Q;  1S5L E;  4YSX C;  2XV5 A;  1KQL A;  1UII A;  1NEK C;  3FX0 A;  1YJ9 P;  3CX5 E;  1KIL B;  2GUS A;  2Q1K A;  3H1H J;  1KQS O;  1NU1 E;  3IFM A;  3T97 B;  1OVV A;  3PRJ A;  1SQV K;  3L72 E;  4TLF A;  2E5T A;  1JCD A;  4U3F E;  1URQ D;  1WT6 A;  2XU6 A;  3AEF D;  1L0V D;  2H89 D;  3B5N A;  1QLB C;  3NXS A;  5AVZ B;  2M3E A;  3A7O A;  3I5C A;  1S2E A;  2WSS H;  1T3U A;  4PD4 H;  3AEB C;  3RBZ A;  2IBZ D;  2W6A A;  1L4A B;  2NPS C;  1KFY D;  1VQP P;  1L4A C;  4WY4 D;  3P8C D;  3H1L G;  1LTS C;  4IL6 E;  1EZV E;  1X9V A;  3KHU A;  1NEN D;  3L4F A;  1K05 A;  3HD7 B;  3L71 D;  1JY2 N;  3CL3 D;  1SP4 A;  1GK6 A;  1VPC A;  5C3J D;  2N1T B;  5B5E H;  1PP9 J;  2WS3 D;  2YKP A;  4FJV A;  2KSE A;  2ZT9 D;  2QM8 A;  3CCQ P;  2RKL A;  2WU2 C;  3CCR P;  2SPZ A;  3AE1 C;  1NHL A;  2E76 C;  1JOC A;  3EWK A;  2K9J B;  1N2D C;  2MKV A;  4HKZ H;  1LWU A;  3CXH I;  2E74 D;  1JMB A;  3AE2 C;  3WUU A;  2KOG A;  1SQX J;  3L70 G;  1HUC A;  3RK3 B;  3KYQ A;  3CWB J;  3CCL P;  1ZOY D;  3GF7 A;  2WT7 A;  5KAI H;  1FBM A;  3H1H G;  2WPR A;  2WMM A;  1RHZ B;  1E5W A;  2E75 B;  4H13 B;  4GOF A;  1U7M A;  1EDK A;  4JBZ A;  3M0A A;  3N7N A;  3WU2 H;  2YNY A;  1FZF A;  2ACZ C;  3SFE C;  1JM0 A;  5CMZ A;  3AEE C;  1LJ2 A;  2OTL P;  1PIX A;  2JDI H;  2M0B A;  3CXH D;  5KLI B;  1S5L X;  1FS0 E;  2FYU K;  3H1K D;  1GL2 A;  2O01 J;  1PPJ D;  3V2P A;  1IFP A;  4Z1M H;  4IL6 X;  3QWO C;  1L4A A;  2XZR A;  2M8R A;  4GDO A;  2I1J A;  1MV8 A;  3VR8 D;  1W5C E;  1S3J A;  1JTH B;  1CW5 A;  2A45 I;  1URQ B;  2WP9 C;  1G1I A;  2FKW B;  2WDQ C;  2OTJ P;  1KC8 Q;  3HD7 A;  2PFX A;  3H1J D;  3MD0 A;  3WUV A;  1VQO P;  3L75 J;  3LIE A;  2J58 A;  3OA7 A;  2OYI B;  2P2U A;  3HE4 B;  1L0L E;  1NTM E;  3HE5 A;  3H1L J;  1IK7 A;  1MFZ A;  3HD7 D;  2BEZ F;  1SQV E;  3AEC C;  2IYP A;  1EC5 A;  1HWT C;  1R8E A;  5GTI E;  2WIT A;  3CLQ A;  1H8A A;  2OQQ A;  4YTM D;  2J59 M;  3SFD C;  3M0D A;  1ZRT E;  5EFW B;  1M56 D;  2CPB A;  3C1L A;  2OGU A;  3VTP C;  3M9H A;  1GK4 A;  1L0N K;  4PV1 B;  5KKZ C;  1LWU B;  1PP9 D;  3E1R A;  1OMI A;  3AE4 C;  2FYZ A;  2R5D A;  1KYO E;  2V4H A;  3PH0 A;  3RGU A;  4W80 A;  2A06 E;  1L0V C;  5APY A;  3SSU A;  2H89 C;  3H1I G;  3L73 E;  4YT0 C;  3O6Q A;  3CCE P;  5KJ7 A;  3TF5 A;  4GKG A;  4AUW A;  3BAT A;  2FYN B;  4YTN D;  2WZ7 A;  1PZQ A;  3H32 A;  1W2E A;  4WY4 A;  1YJN P;  2WPQ A;  3B8E B;  2O1K A;  4YSZ D;  5KJ7 D;  2HPC A;  1JTH A;  1GD2 E;  4DHJ A;  2WSF J;  1SQB G;  4OGQ D;  5C3J C;  5AVW B;  5CCG D;  5L8R J;  3RL0 D;  1RF1 C;  1OWA A;  3K5B A;  3H1H D;  1URQ A;  3P4R D;  1LP1 A;  3L70 J;  1FZC B;  3FXE A;  4H0L D;  1X22 A;  1DIP A;  1OW6 A;  2C9L Y;  3FXD A;  1XTC C;  1Q82 Q;  3II6 A;  1GTW A;  3AEA D;  3GHG A;  2OYI A;  2JP3 A;  5AW4 B;  1LP1 B;  2RH0 A;  4C46 A;  1KB9 E;  1IJD B;  2K9J A;  2FFD C;  5CCH C;  3L35 A;  4DDI A;  3VYI A;  2IPP A;  2V7Q J;  2WPV B;  1D7M A;  3VR9 C;  3D71 A;  4DCK A;  1R5L A;  2W27 A;  3I56 P;  1ZME C;  1KN7 A;  1U7J A;  4YXD C;  1KOR A;  1BE3 J;  5AW5 B;  1GW4 A;  4EOT A;  1VQ5 P;  3L75 G;  1LTG C;  3Q3D A;  1LNQ A;  3M9B A;  1ZOY C;  1SS1 A;  3MZW B;  1PP9 G;  1NKN A;  3M0D C;  3L71 G;  4R4M A;  2KZJ A;  3BCC E;  3VMA A;  2FBW D;  4YTP D;  5APU A;  5E79 E;  3HUS B;  4EDF A;  3NFQ A;  5TJH A;  4L76 A;  1CI6 B;  2P1J A;  3U59 A;  3H1J E;  5AVS B;  5APW A;  2Q6Q A;  4L74 A;  3CCS P;  2YIU C;  1YIT P;  2ZFC A;  3MUD A;  3AED D;  1FZE A;  1KIL C;  1VF5 B;  1DEB A;  3RK2 C;  2P7J A;  1SQV D;  1Q7Y Q;  4K3A A;  3P4Q C;  2BAS A;  2KYV A;  1JMM A;  2K3R A;  1EDL A;  2FYU G;  1M1J C;  2HPC B;  1QGK B;  3U1A A;  1KQF B;  1BSH A;  4DOJ A;  1JEK A;  2H8P D;  2OYH A;  5GTI H;  1QL1 A;  1T8Z A;  3BVH A;  1ZP0 C;  3B5N C;  1Y47 A;  3VMX A;  3CWB E;  2ZYD A;  1N7L A;  2FYU J;  5AW7 B;  2ZVO B;  3KZI H;  3TNU A;  1H89 A;  3VRB C;  5CBO A;  2HG5 D;  2NPS A;  2Q5U A;  1VQK P;  1TFF A;  3L74 E;  4YTM C;  3RL0 C;  2PRR A;  3LID A;  3A0B E;  1A02 F;  2E43 A;  1VQ9 P;  2ZVN B;  2FXM A;  3FWN A;  5AW9 B;  2BCC J;  1JY3 O;  1ZN5 A;  2R5B A;  2LKM A;  3V2R A;  3L36 A;  2RN0 A;  1SFC C;  1MFT A;  1AQ5 A;  4DJG A;  1NU1 K;  1NU1 J;  4WY4 C;  3H1L D;  3AE4 D;  3BRV B;  3L72 J;  3M91 A;  1SQQ K;  1S9K E;  1CSB A;  4U3F J;  1GU4 A;  3VMY A;  4DHZ A;  3WUT A;  1K9M Q;  1YQ4 C;  3H32 B;  1QX8 A;  1ZW0 A;  2FXO A;  3L73 D;  2LXC B;  3B71 A;  2E74 B;  2PAJ A;  3W67 A;  1SVF A;  1KB9 D;  2A45 H;  2W6B A;  1PV3 A;  2W90 A;  3CPW O;  2IBZ I;  1L0L J;  1JUN A;  3TDK A;  2E76 D;  2KLU A;  3KQG A;  4WWI A;  1LT9 B;  2AXT E;  4I7Z B;  5B66 H;  4YTP C;  4H13 D;  2E75 D;  3H1K J;  2JWD A;  2WVR A;  1P84 H;  2KNC A;  5CCG C;  3L74 J;  2B89 A;  4EI2 A;  1USD A;  3C8V A;  5APS A;  2BCC E;  4N78 E;  1YIJ P;  1KF6 C;  3H1H E;  3AE2 D;  1SQX K;  2XKM A;  1GL2 B;  5AVQ B;  2ZJS E;  2QEX P;  1GL2 C;  4PJ0 H;  1NVO A;  1RF1 A;  2ZXX A;  2Y9Z A;  4D6T G;  1SQP J;  1IK9 A;  3A2A A;  4XA4 A;  2Q7C A;  1NTK E;  4IOI H;  1MKM A;  5AVU B;  2Z5H A;  1DEE G;  2A06 D;  5H2F H;  2K37 A;  2N1T D;  1ZRT D;  1Q86 Q;  4EYY Q;  1AFO A;  1T3J A;  3CXH E;  3Q5S A;  3AEE D;  4D6T D;  3JSV C;  4UB6 E;  1PPJ G;  1J1E C;  1FOS F;  2H7H A;  1FC2 C;  5KKZ B;  2WDR C;  1SQV J;  1L0L K;  4YSY D;  5APQ A;  3CIR C;  3CC7 P;  4YXW H;  5BVZ A;  3V2N A;  4HB1 A;  3VR8 C;  3TGU G;  1HTL C;  2JO1 A;  2O1J A;  2WP9 D;  3F89 A;  3H1L E;  3AE3 D;  4KHX A;  1G1J A;  1EZV G;  1J2J B;  1L0L G;  2C0W A;  1BCC E;  1W2B O;  2WQY C;  2Y0C A;  3V4Q A;  1SQQ J;  1EZV I;  2DW3 A;  3AED C;  3G9R A;  3P4P D;  3CCU P;  4PV1 D;  4WB4 A;  1Q90 D;  1WRG A;  5APV A;  1LT9 A;  2QJP C;  1H0T A;  4ASW A;  5DJT B;  3CC4 P;  2K9Y A;  1N7S B;  1JCC A;  1SLQ A;  1NU1 G;  1ZP0 D;  1EXI A;  2QG4 A;  1N73 C;  2G3A A;  5K5G B;  1HJB A;  1NTZ D;  1LTT C;  1M57 D;  2ZXE B;  2QA4 P;  3VRB D;  2LXB A;  3L72 D;  5TIS H;  1RF0 A;  3RK3 E;  1QLE D;  1RF1 B;  2KB7 P;  1K04 A;  2P67 A;  3HE5 B;  3O8Z A;  1KF6 D;  3G4S P;  1Y9B A;  4BRY A;  2LR2 A;  1OFC X;  4YTN C;  4RES B;  1VQN P;  1SFC D;  2AXT H;  1NAY A;  1EDJ A;  2QJY C;  3PHL A;  1BE3 G;  2JEE A;  1OVU A;  1ZLL A;  3R4Y A;  5CBN A;  1NTM K;  1XTG B;  1FJK A;  5KJ7 C;  1S4X A;  4LDT A;  1E79 H;  4LGD E;  4ZNC A;  1KYO D;  2WSF H;  5AW8 B;  2OYO A;  2KK7 A;  1J1D B;  2Y0D A;  1L0L D;  1J1D C;  4GOE A;  1SQX E;  1KTM A;  4H0L C;  2Y0E A;  2FXP A;  2O01 H;  2YMY A;  5KLI C;  3VON A;  3H1I J;  2IDB A;  2I8D A;  1CI6 A;  1BCC J;  2YKQ A;  3GF3 A;  3IAO A;  1T2K D;  4WVZ A;  1LT9 C;  1LTB C;  3MP7 B;  2Q9I A;  2IX7 C;  1YI2 P;  3AEF C;  2JJL A;  1N7S A;  3L70 E;  4JPZ B;  3ABV D;  1G2C B;  2WQY D;  1PP9 E;  3TYY A;  3A0H H;  1FE6 A;  3PJS K;  1L0N G;  3CC2 P;  3IR9 A;  1VQ6 P;  1K8A Q;  2H43 A;  1S72 P;  3CWB D;  2IZ0 A;  4XFJ A;  2NPS B;  1AA0 A;  1YHQ P;  1L4A D;  5AW1 B;  4D6T J;  1BGY G;  2VRS A;  1M1J B;  2E5Y A;  3AE7 C;  1M8O B;  1S1C X;  1L0N D;  3ZDM A;  2N1T C;  1L0N J;  2R44 A;  1RQU A;  2C9N Y;  1AV1 A;  4Y99 B;  3CI9 A;  2N9Y B;  1PGP A;  3MGN A;  1JO5 A;  4YSX D;  5CHX A;  3CX5 H;  1KIL D;  1GU5 A;  3USS A;  5AVT B;  1FJP A;  2KZI A;  3UIA A;  2YKO A;  3RK2 D;  4BXL A;  5M1B A;  2WDV C;  4DHI B;  3A5T A;  3CMA P;  1ZR4 A;  1KFN A;  1M1K Q;  1IFJ A;  4PD4 D;  1HF9 A;  1SQB J;  1RE3 C;  4LC1 A;  3Q2Y A;  1X0T A;  1HBW A;  3E7K A;  3A0B H;  3T97 A;  3O6Q B;  1SQP G;  5B5E E;  5C39 A;  1BCC D;  2E74 C;  1FU1 A;  1SQB E;  1QVG O;  1DX7 A;  1SFC B;  4RKU J;  2WU5 D;  5E79 H;  1KB9 H;  1H0T B;  3B5N D;  4JQ0 D;  3D70 A;  3P4P C;  1NTZ G;  2WWW A;  2H88 D;  1JY3 N;  1WMK A;  3V2Q A;  2J5U A;  1NEN C;  1NTK D;  1LTJ C;  2AEJ A;  1P84 E;  2HR3 A;  2OYH C;  3Q5P A;  2WS3 C;  3M06 A;  2OYH B;  1YTZ T;  4I6L A;  2QE7 H;  4HJG H;  4C7N A;  1G2C A;  3NMD A;  3BRT B;  5CCH A;  1M7L A;  1HVV A;  3OJA B;  2Z4E A;  2BS2 C;  4W7Z A;  2NZ2 A;  5KLV K;  3H1I E;  3TNU B;  3HRN A;  2B76 D;  3CXH H;  2K88 A;  3G3Z A;  1SQX D;  3BCC G;  1ZV8 A;  1EXJ A;  3ABV C;  1FZC A;  2O3J A;  1HGV A;  1VQ7 P;  5C2T C;  1L2P A;  3M9Q A;  4Y28 J;  1VQ4 P;  3A3Y B;  4JF7 A;  3H1J G;  1IFD A;  3VP8 A;  4NPE A;  2QJY B;  3VP9 A;  3R2P A;  2JR8 A;  1KMI Z;  1KB9 I;  3HTK B;  1JNM A;  1YYC A;  3HUS C;  4GOD A;  1UIX A;  2E75 C;  4H13 C;  2B9B A;  4AYC A;  1ZR2 A;  3E1I A;  1AVO A;  2IYO A;  3CX5 D;  3AE7 D;  1NTZ J;  2R32 A;  1EQ7 A;  3S1K A;  3SFD D;  1Y8A A;  5DJU B;  2YIU B;  4A7P A;  2UWJ E;  3Q5R A;  4ZKU A;  3QH9 A;  1NTK G;  3KDP B;  2MJZ A;  3H1K G;  3SWF A;  4U3F D;  1SFC A;  4DZO A;  1QVF O;  3BCC J;  2YXQ B;  2OTK E;  1T2K C;  1OW8 A;  1BDC A;  1PGO A;  1K73 Q;  3TK1 A;  1N8R Q;  1DD3 A;  2IBZ E;  3Q1M A;  1LTJ A;  2ZFY A;  1SQQ E;  2KNC B;  4DDG A;  1KIL E;  2KLV A;  3WMM 0;  2BS4 C;  5KLV G;  2FYN C;  1P84 D;  5CJ0 A;  2HOD A;  2P10 A;  2QVA A;  4OVN F;  1KD1 Q;  3L71 E;  4GT1 A;  5BU8 B;  4L75 A;  2WDR D;  1JB0 J;  4QMA A;  3GHG C;  3L72 G;  1FZB A;  1FDI A;  3I55 P;  2WSC J;  2XDJ A;  3HE4 A;  2R3S A;  1BE3 D;  1HJ0 A;  2KXP B;  1NTK K;  4YSZ C;  1HGZ A;  4PD4 I;  2FFD A;  2QIW A;  3HD7 C;  4C7R A;  1AVY A;  2HYN A;  4DT0 A;  4JYB A;  2M3B A;  4B86 A;  3GW6 A;  1BGY D; 
#chains in the Genus database with same CATH homology
 2H89 C;  4H44 C;  4Z1M H;  2IDB A;  1NYH A;  2K9Y A;  4YTM C;  4IL6 X;  2WS3 D;  3P4R C;  4YT0 C;  3O6Q A;  3GF3 A;  2QSI A;  1KMI Z;  2E74 C;  3IAO A;  1AJY A;  2ZT9 B;  2YMK A;  4GDO A;  4R4M A;  3VR8 D;  4RKU J;  2WU5 D;  1VL2 A;  2ZT9 D;  2FBW D;  4YTN D;  3AE8 D;  4YTP D;  1UIX A;  2E75 C;  4H13 C;  4I7Z C;  3AE6 C;  1ZP0 D;  1EXI A;  1MKM A;  3AEC D;  2WP9 C;  4OGQ B;  2G3A A;  3D70 A;  3AE7 D;  2WU2 C;  3IN6 A;  1RQV A;  3P4P C;  3AEA C;  3AE5 C;  3AE3 C;  1YQ3 D;  3AEF C;  2H88 D;  4PV1 C;  2WDV D;  1WMK A;  3AE1 C;  2WSE J;  1FDO A;  3SFD D;  3ABV D;  3AE4 D;  2WQY D;  1U57 A;  4YXD D;  2WDQ C;  1DD4 A;  3H25 A;  2E76 C;  1PL5 A;  3AE9 D;  3Q5S A;  2J5U A;  3AEE D;  4YSZ D;  3EWK A;  4H0L B;  3AEG D;  2E76 B;  2YIU C;  3RL0 g;  3Q5R A;  1NEN C;  3VRB D;  3D6Y A;  3LW5 J;  4YSX C;  1VF5 C;  1E7P C;  3FGA D;  3RK3 E;  1NGM B;  2B76 C;  3GLM A;  3AED D;  2WSF J;  3AEB D;  2MKV A;  1VF5 B;  4OGQ D;  1NEK C;  5C3J C;  4XFJ A;  4H44 D;  4KX6 D;  2WDR C;  1K04 A;  3VR9 D;  5L8R J;  3Q2Y A;  1YQ4 C;  2ACZ D;  1KFY C;  4YSY D;  3Q5P A;  4KT0 J;  2WS3 C;  3P4R D;  2D2C D;  2BS3 C;  1KF6 D;  3P4S D;  1Y9B A;  2E74 D;  3CIR C;  3VRA C;  1KQG B;  3T97 B;  1IK7 A;  3P4Q C;  3AE2 C;  1OW8 A;  3B71 A;  2E74 B;  3SFE D;  3VR8 C;  2WU5 C;  4H0L D;  2ZT9 C;  1DIP A;  1OW6 A;  3AE8 C;  4YTN C;  5C2T D;  2BEZ F;  3S9O A;  2JO1 A;  4R4L A;  3AEC C;  3GMA A;  1DD3 A;  3Q1M A;  2WP9 D;  3AE7 C;  1KQF B;  1S1C X;  2QJY C;  3AEA D;  2JP3 A;  3AE3 D;  1R8E A;  2H88 C;  1PV3 A;  3D6Z A;  1L0V D;  3AEF D;  1ZOY D;  2BS2 C;  3GF7 A;  2H89 D;  2OQQ A;  4YTM D;  3SFD C;  1KIL E;  1RQU A;  2WQY C;  1QLB C;  2NZ2 A;  3R4Y A;  4YSY C;  2BS4 C;  2E76 D;  4YT0 D;  3AE9 C;  1ZRT E;  2FYN C;  2QJK C;  2E75 B;  4H13 B;  2P10 A;  1OW7 A;  1VF5 D;  4I7Z B;  4YSX D;  2FBW C;  2B76 D;  3AED C;  4YTP C;  2V7Q J;  2G8Y A;  2E75 D;  2WPV B;  3AEB C;  4H13 D;  1ZP0 C;  3G9R A;  3AE6 D;  4OGQ C;  4KX6 C;  2WDR D;  3VR9 C;  1JB0 J;  3D71 A;  1YQ4 D;  2WU2 D;  4PV1 B;  5M1B A;  5KKZ C;  1GMJ A;  1KFY D;  2ACZ C;  3AE5 D;  3P4P D;  2D2C C;  5KLI C;  3C8V A;  1YQ3 C;  1FDI A;  2WDV C;  4PV1 D;  2WSC J;  1ZME C;  1KF6 C;  3P4S C;  3VRA D;  3AE1 D;  3CIR D;  1OMI A;  1EXJ A;  2D2C B;  3ABV C;  3AE4 C;  1Q90 D;  3SFE C;  4TT3 H;  4YXD C;  2WDQ D;  3AE2 D;  3P4Q D;  1HJ0 A;  1KTM A;  1KOR A;  2QJP C;  3AEE C;  4H0L C;  4YSZ C;  2QIW A;  1PIX A;  5C2T C;  2FXP A;  3AEG C;  4Y28 J;  3VRB C;  1NEN D;  1K05 A;  1S5L X;  2BEQ D;  1HF9 A;  2O01 J;  4H44 B;  3Q3D A;  4U7J A;  1NEK D;  1L0V C;  1TU3 F;  5C3J D;  1ZOY C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...