3AEAC

Crystal structure of porcine heart mitochondrial complex ii bound with n-(3-dimethylaminomethyl-phenyl)-2-trifluoromethyl-benzamide
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
138
structure length
138
Chain Sequence
b'TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 47
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3aeaC01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3aeaC02
2FBWD 4YTMC 3AE8D 2WDRD 2WP9C 5C3JC 3AEAC 3AEGD 1NEKC 3AE9C 2BS3C 2WDQD 1PV3A 2WDRC 3P4QC 4YSYD 4YSZD 2WS3C 1KF6D 4KX6C 3AEDD 1K05A 3VRAD 4YSXD 5C2TD 1K04A 2G3AA 4YT0D 1ZP0C 4YSXC 3SFDD 1YQ4D 3VR9D 2WU5D 2ACZD 4YT0C 3S9OA 2FBWC 3AEFD 1ZOYD 3P4SD 3AE8C 4YTPD 4YTND 2BS4C 3AE2D 1KFYD 2BS2C 3AEGC 3AE7D 2WDQC 1E7PC 3AEBD 4YSZC 4YSYC 2WQYD 1YQ3D 2WDVD 3AE3D 2H89D 1L0VD 1KF6C 3AE6D 4YXDD 3AEDC 1NEND 3SFED 3VRAC 5C2TC 3CIRD 3B71A 3AE4D 2B76D 2H88D 3AE5D 3AE6C 3P4RD 3AEED 3SFDC 4YTMD 1YQ4C 3VR9C 2WU5C 2ACZC 2WP9D 3AEFC 3P4PD 1ZOYC 3P4SC 5C3JD 3AEAD 1NEKD 3AE9D 4YTPC 4YTNC 3P4QD 3AE2C 2WU2D 1KFYC 1OW6A 3AE7C 3P4PC 2WS3D 3AE1D 3AEBC 4KX6D 3ABVD 2WQYC 1YQ3C 2WU2C 3AE3C 2WDVC 2H89C 1L0VC 4YXDC 3VR8D 3AE1C 3VRBD 1NENC 3AECD 3SFEC 1ZP0D 3CIRC 3AE4C 1OW7A 3ABVC 1KTMA 2B76C 1OW8A 2H88C 3AE5C 1QLBC 3VR8C 3P4RC 3AEEC 3VRBC 3AECC
chains in the Genus database with same CATH superfamily
3CX5H 3TGUG 4C7RA 3O6QA 2WP9C 3FXDA 1FZAA 2H8PD 1JTHA 1PV3A 4YSZD 1T2KC 2XKMA 1PIXA 2G3AA 1VQ9P 1NTZD 1SFCC 3N4XA 2IDBA 1PPJG 5KLIC 4Y99C 2O3JA 2BCCE 2K37A 2KK7A 1FZCA 2OQQA 1H8AA 2XZRA 4OGQD 2QRXA 5KLVE 1SQVJ 1Q90D 1CW5A 3GG2A 5CJ4A 1G1IA 2FYUD 5AVTB 1IFIA 2YMYA 1KF6C 3B4SA 2JJLA 3H32A 5GTHE 2C9NY 4PJ0E 3CCEP 1IK9A 2HLOA 4GDOA 4H44D 2N1TB 1IJDB 5K5GB 1KB9D 2YXQB 4LDTA 2RMZA 1IFMA 5APWA 1SQBD 1SS1A 2NPSB 1FC2C 3TGUE 1YQ3C 1KYOD 5CBOA 2E76D 4L74A 1IFPA 4XE5B 3AE4C 1JY2P 2GM4A 4DDIA 1W2BO 1A02F 3G6EP 2YKOA 2ZFCA 4Y28J 1PP9J 4OVNF 1PPJE 1S3JA 3E7KA 1P84I 4ZMDA 1AQTA 3WUUA 2P7JA 2YKPA 4N3YB 3AEDD 4AQRD 4I7ZB 4Y99B 2WSCJ 3VRAD 2WSCH 4NPEA 3L37A 3H1KJ 5TISE 2FYNB 1NU1J 4BRYA 1D7MA 2ACZD 4YT0C 3BVHA 2OYHC 1ZV8A 3GW6A 1GK4A 1YTZI 4HJGH 3GF3A 3AEBD 4ASVA 1N7SD 2D2CD 3AE3D 4EI2A 5CMZA 1NTMG 4WY4B 1IFNA 1SQQG 1JMMA 1GL2D 1VF5D 3RK3B 1VL2A 3RGUA 2KYVA 2ZVOB 4H0LC 4YTMD 1J1DC 2XV5A 3BRTB 3OA7A 5C3JD 1BCCJ 1NTMK 3RK2C 3VOPA 5DJUB 3CCLP 4DHJA 1KB9I 3AE7C 1KZUB 2KZJA 2WQYC 3F5HA 1M7LA 2WDVC 5APTA 5AVVB 3AE1C 3B5NB 3CXHE 4BXLA 3H1LD 3HE5A 1Q81Q 3M9QA 1J2JB 1WRGA 2WVRA 1GDTA 1L0NJ 1KYOI 4HH2A 2J58A 3D71A 5GTIE 3EQ2A 5GTHH 5AW1B 4C7NA 1LTBC 4KX6C 2IBZD 3S4RA 3PRJA 1R8EA 4W7YA 1SQXG 3TSIA 2OYHB 4R4LA 4GOFA 2W6AA 2IZ1A 1SQPK 1S9KD 3LW5J 4HKZH 2ZT9C 3LW5H 5CCHD 1NTME 1SVFA 3P7KA 1SQQE 1SQXK 1Q86Q 4IFFA 4DCKA 4YTPD 3H1HD 3VMXA 3AEGC 1JTHB 1VQ6P 2QJYB 4RKUJ 3VONA 1NEND 2E75C 3CIRD 2G8YA 4DHZA 5AW7B 1NAFA 1FDOA 3P4RD 3HE4A 3AEED 1T8ZA 5KJ7A 2PGDA 4JPZB 1NOHA 2UWJE 4YXWH 3A3YB 2WU5C 1NEKD 3IF4A 2WU2D 1KFYC 1IO4A 3L72G 1AVYA 1BGYJ 2H89C 2LR2A 3C1LA 5AVYB 2H43A 2P58A 3P8CE 1AFOA 2WSFJ 1L0LD 1SQXE 3AE8D 1URQB 2FXMA 5APXA 3V4WA 5E79E 3A0BE 5AVQB 3JSVC 3OJAB 2JWDA 3L75J 3L71D 4ZNCA 2K1AA 1NJIQ 1EDIA 2IYOA 1N8RQ 3KHUA 5DJTB 3CCUP 3B8EB 2ZAEB 2W8ZA 1H0TB 1OIPA 3S1KA 3CXHH 4U3FG 3CCRP 2WITA 4GOEA 1SQVG 2FYZA 1JB0J 2E75B 4D6TJ 5KKZB 2KNCB 1VQKP 1IZNB 4RO0A 2N1TA 3MZWB 4I6MC 1J1EC 3L72E 1KMIZ 2YO3A 3CCMP 1YJ9P 1NTKK 1EXIA 3ITKA 2YIUB 3VR9C 2Y0DA 1OX3A 1VPCA 4RESB 3P4PD 1ZOYC 3H1JD 4K35A 1Y9BA 2NPSA 5AW5B 2WPSA 3L74J 3Q3DA 3L36A 3CX5E 4N78D 3ABVD 3OW2O 2L91A 2O1JA 2VRSA 2PP6A 2N9YB 5L8RJ 3AECD 4DZOA 1GD2E 1KTMA 2M8RA 3AE5C 4RJTA 1IFJA 1OMIA 1JY2O 3BCCD 2L5GB 3RL0C 2Z4EA 1QLED 5KJ7C 2QJPC 4YSYD 1LNQA 1XTGB 3N7NA 4PV1D 5C2TD 4H13B 1SQVE 3L4FA 2FKWB 1VQ7P 2W6BA 3H1KG 3H1IJ 4K3AA 4ZKUA 2QA4P 3PH0A 5KAFE 1NU1G 5M1BA 4PD4H 2FBWC 3RBXA 2N1TD 2QM7A 2GUVA 4A7PA 4W80A 1SQPJ 1LTTC 2ZYAA 4DT0A 2W6JH 4EOTA 1NU1K 4WY4A 3W68A 1J1EB 1KILD 5E79H 1E79H 5CCGD 3A0BH 1NTZK 1GU4A 1DH3A 1HVVA 3AE6C 3NMDA 3HUSC 1S72P 4UB6H 1HWTC 3V2QA 2WP9D 3TYYA 3H25A 4U3FD 2MJZA 1BCCG 1QEXA 3AE2C 1OW6A 3SWFA 1T2KD 2KXPB 3V2RA 3B5NA 3D6ZA 3RK3E 3VN0A 1PP9E 1Q7YQ 1SFCD 3USSA 2M3EA 1N2DC 2B76C 5BU8B 2WPVB 3D6YA 3VR8C 4DHIB 2AEFA 4B86A 1RE3A 1L0NG 4KJMA 3MHVA 2A06D 1S5LX 1HF9A 2JP3A 3H1KE 1PGPA 1YJNP 1NU1E 2WDRC 3SWYA 1KF6D 2NZ2A 1YBKA 1LWUB 2AEJA 3MUDA 1NHLA 3HRNA 3CMEP 1LTSC 4GT1A 2KI7B 5AVUB 1W5CE 2ZJSE 2RN0A 3SWKA 2W27A 1KC8Q 2FFDB 1FE6A 1DEBA 3MGNA 1X0TA 3CX5I 3V5BA 3CWBJ 2KS1B 1YQ3D 1BCCE 3V6IA 4I7ZC 2PAJA 3HUSB 1MFZA 3HD7B 3AE4D 2B9BA 3H1KD 4L73A 2B87B 2IFMA 1MUUA 2W83C 2ZYDA 2FYNC 4WVZA 4DJGA 4GIFA 4IL6X 3PP5A 1NTKJ 3L73J 1FZFA 2E74B 5KAFH 1JM0A 2PFXA 1L0NE 3IR9A 3BATA 1BGYG 2I1JA 4HB1A 2DW3A 1L4AC 5APYA 4YXDC 4WY4C 2QIWA 1DD4A 2H88C 1URQA 1BE3J 3V2NA 1JY2N 3VRBC 3RK3C 5CJ0A 5C39A 1PL5A 3W67A 1Q82Q 3AEAC 3R4YA 1EZVG 3L75G 2A45I 2AXCA 1S1CX 2BCCD 1MFTA 1KQGB 2Q5UA 4YSXD 5KLVD 3FX0A 2O1KA 3CC4P 2KLUA 3B5NC 1H0TA 3A5TA 3H6PA 1L2PA 3KPEA 4H0LD 2YMKA 1MV8A 3G3ZA 1JNMA 3V4QA 3RK2D 1U7MA 1KQSO 4MN4C 3T97A 1RE3C 3EFFK 1A02J 3AE7D 1YHQP 2KNCA 2WDQC 2WQYD 2WDVD 1VQ5P 2GUSA 1WT6A 2K9JB 4CPGA 1VQNP 1BGYE 3TGUD 5APQA 3SFDC 1NTZJ 1NGMB 1LGHB 3MUDC 4I6LA 3G71P 3RL0g 1FAVA 4L75A 3JCUE 1L4AB 3L74G 2QJYC 4KX6D 1PPJD 3CL3D 1FJPA 1YJWP 3TDKA 2FYUJ 1EZVE 1FZBA 2KZIA 3L75E 1DEEG 3IAOA 1OW7A 3VTPC 2C9LY 2ZT9D 3PLNA 2WT7B 3FXEA 1OVVA 1KB9H 1QX8A 3AEGD 1OWAA 4WBAA 2KSEA 1SP4A 2R32A 3WUTA 1LTIC 2E75D 3V2PA 1K04A 1SQBJ 2R3SA 1U7JA 1ZP0C 4D6TE 2M5AB 1Y8AA 1M56D 1RF1B 1JY3P 2WU5D 2E43A 2KB7P 1OVRA 1NO4A 2R44A 1URQC 4OGQB 1X22A 2QE7H 1SQPG 1PGJA 1KFYD 1JCCA 4LC1A 1X8YA 2KSJA 2E5YA 1VDFA 1AV1A 2H89D 1PGQA 1Q2NA 3KYQA 2KOGA 1KV4A 3CCSP 3KZIH 3L74E 2OYOA 4H44B 3EWKA 1FOSE 1MKMA 1YYCA 3TF5A 1H89A 3CXHD 3P4SC 5KAIH 3NTNA 1M1JB 4YTNC 3CCJP 1BSNA 1CZQA 5KKZC 2Y0EA 2AEMA 3GLMA 2E76B 1NH4A 1EC5A 1M90Q 2JEEA 2R3CA 3L70G 4WB4A 3KXDA 2B88A 2ZFYA 3UIAA 2WPRA 2YIUC 1X79B 1KFNA 2QG4A 1HTLC 3H1IE 3GMAA 3M0DA 1NTMD 4PD4E 1LWUA 1S5LH 1SQQD 1PZQA 1SQPE 3JCUH 2BASA 5APSA 1GU5A 2E42A 2WPQA 2WSFH 2WTYA 3I56P 2PRRA 2GA1A 3GHGB 2CPBA 3VR9D 3H1LJ 1GW3A 5AVXB 2FFDA 1ZOYD 1RE4A 3M9BA 2HR3A 2KS1A 2HG5D 2BEZF 4UB6E 1N7SB 2D2CB 2O01N 3HUSA 3HD7A 3CWBG 3MP7B 3U1CA 2B87A 1H88A 1JO5A 3CMAP 2Y9ZA 4XA4A 4H13C 1RH5B 1GL2B 3AE5D 1VF5B 4ASWA 1N7LA 3O8ZA 1YQ4C 2YO2A 1ZR2A 3AEFC 3RL0D 3A7OA 3T97B 1NTKG 3P8CD 5KJ7D 2OYIC 3L73G 3L70E 4WWIA 1OXZA 3VMZA 1RY3A 4IL6H 3H1HJ 1SQXD 2HODB 3CXHI 1K8AQ 2MKVA 2WU2C 3SFEC 2ZXEB 2WZ7A 1EDLA 1ZMEC 1JUNA 1BE3G 3E1IA 3OAKA 3CC7P 1ZW0A 2FBWD 1AQ5A 3M06A 2BEQD 1FJKA 3AE9C 1FOSF 4UB8E 4IOIH 2K3RA 3LIDA 3EFGA 1GW4A 5H2FH 3BRVB 4JYCA 3L70D 3WU2H 4U7JA 3CWBE 4IFDK 1PP9G 2Q1KA 3L35A 1JMBA 2ZVNB 2B89A 2RKLA 1T3UA 3L72D 1L0LJ 3AE2D 3R2PA 1VQ8P 2K9JA 3L71J 1VQPP 1NTKE 2KIKA 1PFIA 3L73E 1KN7A 1QVFO 3M0DC 2B76D 1LWUC 2Z5IA 1NVOA 3CX5D 3KQGA 1YITP 1AJYA 2HPCB 2OYIB 1NTZG 1FU1A 1TU3F 1L4AA 2Q6QA 2C0WA 1BE3E 3PTZA 2FFDC 4R4MA 3Q5SA 1M8OB 4PD4I 1RE4C 1YI2P 3P4PC 2KLVA 5CHXA 1LT9B 2NPSD 2R5DA 2JWAA 1IK7A 1YIJP 4L76A 2FYUG 3KDPB 3ABVC 2WT7A 3HD7C 1AVOA 2OTLP 4EDFA 1WMKA 2WSSH 3CI9A 1LTJC 3AECC 1UIIA 5AVSB 3CPWO 1SQVD 5AW9B 5B5EH 2FYUK 2V4HA 1K73Q 3H1JJ 2E74C 3I55P 1P84E 1K05A 2M5AA 1RF1A 2YNYA 3TNUB 3G4SP 2LXCB 2WSEJ 4KHXA 2WSEH 2E5TA 1IC2A 1BDDA 1U57A 2CK3H 4NPFX 2J5UA 4HYTB 1JY3O 1SQBK 2BS4C 4NPDA 3VP8A 1EXJA 3BCCJ 1SLQA 1NTZE 1RF0C 4I2LC 2OARA 3VP9A 3G9RA 3Q5RA 1HJ0A 3FGAD 5KLVK 4YXDD 5B66H 3K5BA 2Q3IA 4UB8H 4WY4D 2H88D 5CCGC 2ITAA 3RK3D 1PP9D 1QGKB 3QH9A 1M1JA 2FYUE 1RQVA 1KQLA 3AEAD 2FY8A 1JEKA 1N73B 3GF7A 1GK6A 1NAYA 3SSUA 1KB9E 1L0VC 2HFED 3A0HH 1FDMA 1LTJB 1NU1D 3B5ND 1OW8A 1R5LA 4AYCA 1LP1B 5AVRB 3PHLA 2NRGA 1SQBE 3NFQA 2I8DA 1PGOA 1M1KQ 1KYOE 5AW3B 2WDQD 2YKQA 4U3FJ 3P4QC 2WS3C 1BSHA 4PV1B 2ZXXA 3IN6A 1FZEA 3GHGA 4YT0D 3SFDD 1BCCD 1NKNA 5AW8B 3H1LG 2QVAA 2XDJA 3KZIE 4YPCA 2V7QJ 2A45H 2V7QH 1N7SA 1E7PC 4YSZC 1OZHA 3I5CA 4N6JA 1Z56A 1KILB 2AXTH 1GL2A 5KAIE 4KT0J 3B71A 1L0ND 2IBZG 1VQMP 3M9HA 4I1LA 1NYHA 1P84H 1RF1C 2IYPA 1FS0E 3HTKB 1G2CB 4D6TG 2HODA 1GTWA 4OGQC 1XTCC 1GZLA 2LXBA 3AE1D 3H1HG 1LTAC 1USDA 5BVZA 2W90A 3ZDMA 1SFCB 2JKVA 1ZP0D 5KLIB 3FWNA 2XNDH 1FZGA 1S5LE 2SPZA 4H44C 4JF7A 3Q2YA 1QL2A 1URQD 3LIEA 1RHZB 5AW4B 4JQ0D 5AW2B 2IZ0A 1QVGO 1KORA 1M1JC 2R5BA 3H1LE 1TFFA 5APVA 3NXSA 3FWLA 4JYBA 2E76C 5CCHA 1NKZB 4YSXC 3M91A 2M3BA 2QEXP 1OFCX 1GMJA 4BWNA 1JY3N 3Q5PA 1HGZA 3P4SD 2K88A 1ZRTE 2IBZE 4YTND 1BGYD 1L0LG 3F89A 3QWOC 2ZYGA 3PJSK 1SQQK 2N9BA 2I1KA 3L71G 3AEDC 2BCCJ 3H1IG 1S9KE 1KYOH 1FZCC 3VRAC 3CCVP 1S2EA 2HPCA 2OYIA 1Y47A 2KUBA 1L0LK 4IL6E 5KLVJ 3H1HE 3VMAA 1HBWA 1HJBA 5AW0B 1RQUA 3GHGC 2OTKE 1EZVD 3P32A 2ACZC 2QSIA 3L75D 4AUWA 1EDKA 1CI6B 3P8MC 1LT9A 3IFMA 2P67A 2Q3EA 4PJ0H 4Z1MH 3AEBC 1NWQA 1N7SC 1LT1A 2D2CC 3AE3C 3TK1A 1ZRTD 3U1AA 1LJ2A 1FDIA 1GL2C 1JOCA 1VF5C 1AA0A 3M0AA 4TT3H 4ZKPA 4YTMC 4LGDE 5H2FE 3TGUJ 3D70A 4D6TD 5C3JC 2XU6A 3C9IA 2P1JA 3WU2E 1JCDA 1T6AA 2BS3C 1ZN5A 5CBNA 3CCQP 1BDCA 3O6QB 1E5WA 3H1JG 1K9MQ 3TNUA 3A2AA 3U59A 1YTZT 4JBZA 3C8VA 1HGVA 1KFMA 4H13D 1L0LE 1M57D 2IPPA 4O9BA 4H0LB 1ZLLA 1J1DB 3L71E 1YQ4D 3MD0A 1W2EA 3S9OA 1IFDA 3RK2B 3AEFD 1HH0A 3L74D 4EYYQ 3CLQA 1VQ4P 2FXPA 3BCCG 1FZCB 1ZR4A 5TISH 2P10A 1DD3A 3SFED 4GODA 2QM8A 1S4XA 3H32B 4OH8B 2IFNA 2POHA 4EIJA 1N73A 4DDGA 5CCHC 2JDIH 1DX7A 3AE9D 4YTPC 3II6A 3WUVA 2LKMA 1R5SA 3MTUE 1LTJA 1EZVI 1ZXGA 5B5EE 1USEA 3H1ID 2CPSA 1LP1A 1NENC 3CIRC 2JR8A 3CC2P 3H1JE 4PD4D 2YXRB 3WMM0 3P4RC 3AEEC 2ZT9B 1KQFB 2FXOA 1SQPD 4N78E 3JC22 2IBZI 1NEKC 3Q1MA 2XNXA 3VYIA 1UIXA 1LT9C 1CSBA 2C0XA 2H7HA 3BCCE 4IFMA 5GTIH 5AW6B 4TLFA 3VMYA 2HYNA 5TJHA 1RF0A 1DIPA 1SQVK 5B66E 4LLHA 3RBZA 5BU5A 3BASA 3AE8C 2A45G 4BRYB 1G1JA 1KILA 2BS2C 5CCGA 4GKGA 2A06G 2QJKC 3AE6D 1NTMJ 1LTGC 3HD7D 1SQQJ 4W7ZA 3HTKA 1G2CA 2Q7CA 3A0HE 2RH0A 1EQ7A 1KILE 1N86A 3E1RA 2E74D 1SFCA 3VR8D 2IX7C 2WMMA 4U3FE 4DOJA 3HE5B 5AVZB 1KD1Q 1QL1A 2WDRD 2Y0CA 2K9YA 5EFWB 1OVUA 4M3LA 3CWBD 1N73C 1VQLP 5AVWB 1SQXJ 4C7NB 2M0BA 1X9VA 2A06E 1T3JA 2AXTE 3CD6P 2O01J 1NTKD 2O01H 3MIWA 3L73D 2KP8A 4C46A 5KTBA 4QMAA 1EDJA 2QJKB 2WWWA 1HUCA 4YSYC 1SQBG 5APUA 4XFJA 2OTJP 1VQOP 1L0VD 2BCCG 4PV1C 5C2TC 1BE3D 4FJVA 5KLVG 2OGUA 1CI6A 2Z5HA 3L70J 3HE4B 3RL0B 1MZ9A 1FBMA 2QJPB 2N1TC 2Q9IA 2JO1A 3P4QD 1L4AD 2WS3D 3L72J 1KILC 3VRBD 2J59M 1L0NK 4OWFA 2NPSC 2OYHA 2Y9YA 1P84D 1QLBC 2P2UA
chains in the Genus database with same CATH topology
1KQFB 2FBWD 4TT3H 4YTMC 3Q2YA 3AE8D 2YIUC 4Y28J 3D71A 2WDRD 3D70A 3O6QA 2K9YA 1S5LX 2BEQD 1PL5A 2WP9C 1HF9A 2JP3A 5C3JC 3AEAC 3GMAA 3R4YA 3AEGD 1NEKC 3AE9C 2BS3C 2QJPC 1KORA 2WDQD 1PV3A 1S1CX 2WDRC 3P4QC 3Q1MA 4YSYD 2E74C 4YSZD 2WS3C 1KQGB 1UIXA 1KF6D 4KX6C 4PV1B 3AEDD 4I7ZB 1K05A 2E75D 2NZ2A 2WSCJ 4PV1D 3VRAD 3C8VA 4YSXD 3IN6A 4H13B 1K04A 1R8EA 5C2TD 4H13D 1PIXA 2G3AA 2E76C 4YT0D 1ZP0C 2IDBA 2WSEJ 5KLIC 4YSXC 3SFDD 4U7JA 4H0LB 1U57A 4R4LA 4H0LD 1DIPA 1YQ4D 5M1BA 2O01J 3VR9D 2YMKA 1GMJA 3LW5J 2WU5D 2J5UA 2ZT9C 2ACZD 4YT0C 3S9OA 3Q5PA 2FBWC 3AEFD 1ZOYD 3P4SD 3AE8C 1ZRTE 2V7QJ 4OGQB 2OQQA 4YTPD 4OGQD 4YTND 2BS4C 3AE2D 1KFYD 1EXJA 1Q90D 2BS2C 3AEGC 1JB0J 2E75B 2FXPA 3AE7D 3GF3A 2WDQC 2BEZF 1E7PC 3AEBD 4YSZC 4YSYC 2D2CB 2P10A 2D2CD 4RKUJ 4XFJA 2WQYD 1YQ3D 3G9RA 3Q5RA 2QJKC 2WDVD 1HJ0A 3FGAD 3AE3D 2H89D 4KT0J 1KF6C 1DD3A 1L0VD 3AE6D 4YXDD 3AEDC 1NEND 2E75C 4PV1C 3SFED 4I7ZC 3VRAC 5C2TC 3CIRD 2G8YA 3B71A 4H13C 3AE4D 2B76D 2H88D 3AE5D 3AE6C 1FDOA 1VF5B 1KMIZ 4H44B 3AEED 3P4RD 1VF5D 1NYHA 4GDOA 4H44D 3EWKA 1VL2A 1AJYA 1EXIA 3SFDC 1NGMB 1RQUA 1MKMA 4YTMD 2FYNC 4H0LC 1YQ4C 3VR9C 1TU3F 2WU5C 4IL6X 2ACZC 2WP9D 2QSIA 3H25A 1RQVA 3AEFC 3P4PD 1ZOYC 3RL0g 3P4SC 5C3JD 1KILE 3T97B 3AEAD 1Y9BA 1NEKD 3AE9D 4YTPC 2JO1A 4OGQC 4YTNC 2E74B 3P4QD 3AE2C 3GF7A 2E74D 1OW6A 1KFYC 2WU2D 3Q3DA 3AE7C 4R4MA 3Q5SA 2WS3D 3AE1D 3P4PC 4Z1MH 3AEBC 2QJYC 4KX6D 3ABVD 3D6ZA 2D2CC 2WQYC 3RK3E 5KKZC 1YQ3C 2MKVA 3AE3C 2WDVC 2WU2C 2H89C 1IK7A 2E76B 3GLMA 5L8RJ 4YXDC 1L0VC 3VR8D 2E76D 3AE1C 3VRBD 1NENC 3AECD 3SFEC 1ZP0D 3CIRC 3ABVC 1OW7A 3AE4C 3IAOA 1KTMA 2B76C 1ZMEC 2QIWA 1OW8A 1FDIA 1DD4A 1WMKA 2H88C 2WPVB 3AE5C 3D6YA 1QLBC 3P4RC 3VR8C 3AEEC 1VF5C 2ZT9B 4H44C 3AECC 3VRBC 2ZT9D 1OMIA 2WSFJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FBW D;  4YTM C;  3AE8 D;  2WDR D;  2WP9 C;  5C3J C;  3AEA C;  3AEG D;  1NEK C;  3AE9 C;  2BS3 C;  2WDQ D;  1PV3 A;  2WDR C;  3P4Q C;  4YSY D;  4YSZ D;  2WS3 C;  1KF6 D;  4KX6 C;  3AED D;  1K05 A;  3VRA D;  4YSX D;  5C2T D;  1K04 A;  2G3A A;  4YT0 D;  1ZP0 C;  4YSX C;  3SFD D;  1YQ4 D;  3VR9 D;  2WU5 D;  2ACZ D;  4YT0 C;  3S9O A;  2FBW C;  3AEF D;  1ZOY D;  3P4S D;  3AE8 C;  4YTP D;  4YTN D;  2BS4 C;  3AE2 D;  1KFY D;  2BS2 C;  3AEG C;  3AE7 D;  2WDQ C;  1E7P C;  3AEB D;  4YSZ C;  4YSY C;  2WQY D;  1YQ3 D;  2WDV D;  3AE3 D;  2H89 D;  1L0V D;  1KF6 C;  3AE6 D;  4YXD D;  3AED C;  1NEN D;  3SFE D;  3VRA C;  5C2T C;  3CIR D;  3B71 A;  3AE4 D;  2B76 D;  2H88 D;  3AE5 D;  3AE6 C;  3P4R D;  3AEE D;  3SFD C;  4YTM D;  1YQ4 C;  3VR9 C;  2WU5 C;  2ACZ C;  2WP9 D;  3AEF C;  3P4P D;  1ZOY C;  3P4S C;  5C3J D;  3AEA D;  1NEK D;  3AE9 D;  4YTP C;  4YTN C;  3P4Q D;  3AE2 C;  2WU2 D;  1KFY C;  1OW6 A;  3AE7 C;  3P4P C;  2WS3 D;  3AE1 D;  3AEB C;  4KX6 D;  3ABV D;  2WQY C;  1YQ3 C;  2WU2 C;  3AE3 C;  2WDV C;  2H89 C;  1L0V C;  4YXD C;  3VR8 D;  3AE1 C;  3VRB D;  1NEN C;  3AEC D;  3SFE C;  1ZP0 D;  3CIR C;  3AE4 C;  1OW7 A;  3ABV C;  1KTM A;  2B76 C;  1OW8 A;  2H88 C;  3AE5 C;  1QLB C;  3VR8 C;  3P4R C;  3AEE C;  3VRB C;  3AEC C; 
#chains in the Genus database with same CATH topology
 3CX5 H;  3TGU G;  4C7R A;  3O6Q A;  2WP9 C;  3FXD A;  1FZA A;  2H8P D;  1JTH A;  1PV3 A;  4YSZ D;  1T2K C;  2XKM A;  1PIX A;  2G3A A;  1VQ9 P;  1NTZ D;  1SFC C;  3N4X A;  2IDB A;  1PPJ G;  5KLI C;  4Y99 C;  2O3J A;  2BCC E;  2K37 A;  2KK7 A;  1FZC A;  2OQQ A;  1H8A A;  2XZR A;  4OGQ D;  2QRX A;  5KLV E;  1SQV J;  1Q90 D;  1CW5 A;  3GG2 A;  5CJ4 A;  1G1I A;  2FYU D;  5AVT B;  1IFI A;  2YMY A;  1KF6 C;  3B4S A;  2JJL A;  3H32 A;  5GTH E;  2C9N Y;  4PJ0 E;  3CCE P;  1IK9 A;  2HLO A;  4GDO A;  4H44 D;  2N1T B;  1IJD B;  5K5G B;  1KB9 D;  2YXQ B;  4LDT A;  2RMZ A;  1IFM A;  5APW A;  1SQB D;  1SS1 A;  2NPS B;  1FC2 C;  3TGU E;  1YQ3 C;  1KYO D;  5CBO A;  2E76 D;  4L74 A;  1IFP A;  4XE5 B;  3AE4 C;  1JY2 P;  2GM4 A;  4DDI A;  1W2B O;  1A02 F;  3G6E P;  2YKO A;  2ZFC A;  4Y28 J;  1PP9 J;  4OVN F;  1PPJ E;  1S3J A;  3E7K A;  1P84 I;  4ZMD A;  1AQT A;  3WUU A;  2P7J A;  2YKP A;  4N3Y B;  3AED D;  4AQR D;  4I7Z B;  4Y99 B;  2WSC J;  3VRA D;  2WSC H;  4NPE A;  3L37 A;  3H1K J;  5TIS E;  2FYN B;  1NU1 J;  4BRY A;  1D7M A;  2ACZ D;  4YT0 C;  3BVH A;  2OYH C;  1ZV8 A;  3GW6 A;  1GK4 A;  1YTZ I;  4HJG H;  3GF3 A;  3AEB D;  4ASV A;  1N7S D;  2D2C D;  3AE3 D;  4EI2 A;  5CMZ A;  1NTM G;  4WY4 B;  1IFN A;  1SQQ G;  1JMM A;  1GL2 D;  1VF5 D;  3RK3 B;  1VL2 A;  3RGU A;  2KYV A;  2ZVO B;  4H0L C;  4YTM D;  1J1D C;  2XV5 A;  3BRT B;  3OA7 A;  5C3J D;  1BCC J;  1NTM K;  3RK2 C;  3VOP A;  5DJU B;  3CCL P;  4DHJ A;  1KB9 I;  3AE7 C;  1KZU B;  2KZJ A;  2WQY C;  3F5H A;  1M7L A;  2WDV C;  5APT A;  5AVV B;  3AE1 C;  3B5N B;  3CXH E;  4BXL A;  3H1L D;  3HE5 A;  1Q81 Q;  3M9Q A;  1J2J B;  1WRG A;  2WVR A;  1GDT A;  1L0N J;  1KYO I;  4HH2 A;  2J58 A;  3D71 A;  5GTI E;  3EQ2 A;  5GTH H;  5AW1 B;  4C7N A;  1LTB C;  4KX6 C;  2IBZ D;  3S4R A;  3PRJ A;  1R8E A;  4W7Y A;  1SQX G;  3TSI A;  2OYH B;  4R4L A;  4GOF A;  2W6A A;  2IZ1 A;  1SQP K;  1S9K D;  3LW5 J;  4HKZ H;  2ZT9 C;  3LW5 H;  5CCH D;  1NTM E;  1SVF A;  3P7K A;  1SQQ E;  1SQX K;  1Q86 Q;  4IFF A;  4DCK A;  4YTP D;  3H1H D;  3VMX A;  3AEG C;  1JTH B;  1VQ6 P;  2QJY B;  4RKU J;  3VON A;  1NEN D;  2E75 C;  3CIR D;  2G8Y A;  4DHZ A;  5AW7 B;  1NAF A;  1FDO A;  3P4R D;  3HE4 A;  3AEE D;  1T8Z A;  5KJ7 A;  2PGD A;  4JPZ B;  1NOH A;  2UWJ E;  4YXW H;  3A3Y B;  2WU5 C;  1NEK D;  3IF4 A;  2WU2 D;  1KFY C;  1IO4 A;  3L72 G;  1AVY A;  1BGY J;  2H89 C;  2LR2 A;  3C1L A;  5AVY B;  2H43 A;  2P58 A;  3P8C E;  1AFO A;  2WSF J;  1L0L D;  1SQX E;  3AE8 D;  1URQ B;  2FXM A;  5APX A;  3V4W A;  5E79 E;  3A0B E;  5AVQ B;  3JSV C;  3OJA B;  2JWD A;  3L75 J;  3L71 D;  4ZNC A;  2K1A A;  1NJI Q;  1EDI A;  2IYO A;  1N8R Q;  3KHU A;  5DJT B;  3CCU P;  3B8E B;  2ZAE B;  2W8Z A;  1H0T B;  1OIP A;  3S1K A;  3CXH H;  4U3F G;  3CCR P;  2WIT A;  4GOE A;  1SQV G;  2FYZ A;  1JB0 J;  2E75 B;  4D6T J;  5KKZ B;  2KNC B;  1VQK P;  1IZN B;  4RO0 A;  2N1T A;  3MZW B;  4I6M C;  1J1E C;  3L72 E;  1KMI Z;  2YO3 A;  3CCM P;  1YJ9 P;  1NTK K;  1EXI A;  3ITK A;  2YIU B;  3VR9 C;  2Y0D A;  1OX3 A;  1VPC A;  4RES B;  3P4P D;  1ZOY C;  3H1J D;  4K35 A;  1Y9B A;  2NPS A;  5AW5 B;  2WPS A;  3L74 J;  3Q3D A;  3L36 A;  3CX5 E;  4N78 D;  3ABV D;  3OW2 O;  2L91 A;  2O1J A;  2VRS A;  2PP6 A;  2N9Y B;  5L8R J;  3AEC D;  4DZO A;  1GD2 E;  1KTM A;  2M8R A;  3AE5 C;  4RJT A;  1IFJ A;  1OMI A;  1JY2 O;  3BCC D;  2L5G B;  3RL0 C;  2Z4E A;  1QLE D;  5KJ7 C;  2QJP C;  4YSY D;  1LNQ A;  1XTG B;  3N7N A;  4PV1 D;  5C2T D;  4H13 B;  1SQV E;  3L4F A;  2FKW B;  1VQ7 P;  2W6B A;  3H1K G;  3H1I J;  4K3A A;  4ZKU A;  2QA4 P;  3PH0 A;  5KAF E;  1NU1 G;  5M1B A;  4PD4 H;  2FBW C;  3RBX A;  2N1T D;  2QM7 A;  2GUV A;  4A7P A;  4W80 A;  1SQP J;  1LTT C;  2ZYA A;  4DT0 A;  2W6J H;  4EOT A;  1NU1 K;  4WY4 A;  3W68 A;  1J1E B;  1KIL D;  5E79 H;  1E79 H;  5CCG D;  3A0B H;  1NTZ K;  1GU4 A;  1DH3 A;  1HVV A;  3AE6 C;  3NMD A;  3HUS C;  1S72 P;  4UB6 H;  1HWT C;  3V2Q A;  2WP9 D;  3TYY A;  3H25 A;  4U3F D;  2MJZ A;  1BCC G;  1QEX A;  3AE2 C;  1OW6 A;  3SWF A;  1T2K D;  2KXP B;  3V2R A;  3B5N A;  3D6Z A;  3RK3 E;  3VN0 A;  1PP9 E;  1Q7Y Q;  1SFC D;  3USS A;  2M3E A;  1N2D C;  2B76 C;  5BU8 B;  2WPV B;  3D6Y A;  3VR8 C;  4DHI B;  2AEF A;  4B86 A;  1RE3 A;  1L0N G;  4KJM A;  3MHV A;  2A06 D;  1S5L X;  1HF9 A;  2JP3 A;  3H1K E;  1PGP A;  1YJN P;  1NU1 E;  2WDR C;  3SWY A;  1KF6 D;  2NZ2 A;  1YBK A;  1LWU B;  2AEJ A;  3MUD A;  1NHL A;  3HRN A;  3CME P;  1LTS C;  4GT1 A;  2KI7 B;  5AVU B;  1W5C E;  2ZJS E;  2RN0 A;  3SWK A;  2W27 A;  1KC8 Q;  2FFD B;  1FE6 A;  1DEB A;  3MGN A;  1X0T A;  3CX5 I;  3V5B A;  3CWB J;  2KS1 B;  1YQ3 D;  1BCC E;  3V6I A;  4I7Z C;  2PAJ A;  3HUS B;  1MFZ A;  3HD7 B;  3AE4 D;  2B9B A;  3H1K D;  4L73 A;  2B87 B;  2IFM A;  1MUU A;  2W83 C;  2ZYD A;  2FYN C;  4WVZ A;  4DJG A;  4GIF A;  4IL6 X;  3PP5 A;  1NTK J;  3L73 J;  1FZF A;  2E74 B;  5KAF H;  1JM0 A;  2PFX A;  1L0N E;  3IR9 A;  3BAT A;  1BGY G;  2I1J A;  4HB1 A;  2DW3 A;  1L4A C;  5APY A;  4YXD C;  4WY4 C;  2QIW A;  1DD4 A;  2H88 C;  1URQ A;  1BE3 J;  3V2N A;  1JY2 N;  3VRB C;  3RK3 C;  5CJ0 A;  5C39 A;  1PL5 A;  3W67 A;  1Q82 Q;  3AEA C;  3R4Y A;  1EZV G;  3L75 G;  2A45 I;  2AXC A;  1S1C X;  2BCC D;  1MFT A;  1KQG B;  2Q5U A;  4YSX D;  5KLV D;  3FX0 A;  2O1K A;  3CC4 P;  2KLU A;  3B5N C;  1H0T A;  3A5T A;  3H6P A;  1L2P A;  3KPE A;  4H0L D;  2YMK A;  1MV8 A;  3G3Z A;  1JNM A;  3V4Q A;  3RK2 D;  1U7M A;  1KQS O;  4MN4 C;  3T97 A;  1RE3 C;  3EFF K;  1A02 J;  3AE7 D;  1YHQ P;  2KNC A;  2WDQ C;  2WQY D;  2WDV D;  1VQ5 P;  2GUS A;  1WT6 A;  2K9J B;  4CPG A;  1VQN P;  1BGY E;  3TGU D;  5APQ A;  3SFD C;  1NTZ J;  1NGM B;  1LGH B;  3MUD C;  4I6L A;  3G71 P;  3RL0 g;  1FAV A;  4L75 A;  3JCU E;  1L4A B;  3L74 G;  2QJY C;  4KX6 D;  1PPJ D;  3CL3 D;  1FJP A;  1YJW P;  3TDK A;  2FYU J;  1EZV E;  1FZB A;  2KZI A;  3L75 E;  1DEE G;  3IAO A;  1OW7 A;  3VTP C;  2C9L Y;  2ZT9 D;  3PLN A;  2WT7 B;  3FXE A;  1OVV A;  1KB9 H;  1QX8 A;  3AEG D;  1OWA A;  4WBA A;  2KSE A;  1SP4 A;  2R32 A;  3WUT A;  1LTI C;  2E75 D;  3V2P A;  1K04 A;  1SQB J;  2R3S A;  1U7J A;  1ZP0 C;  4D6T E;  2M5A B;  1Y8A A;  1M56 D;  1RF1 B;  1JY3 P;  2WU5 D;  2E43 A;  2KB7 P;  1OVR A;  1NO4 A;  2R44 A;  1URQ C;  4OGQ B;  1X22 A;  2QE7 H;  1SQP G;  1PGJ A;  1KFY D;  1JCC A;  4LC1 A;  1X8Y A;  2KSJ A;  2E5Y A;  1VDF A;  1AV1 A;  2H89 D;  1PGQ A;  1Q2N A;  3KYQ A;  2KOG A;  1KV4 A;  3CCS P;  3KZI H;  3L74 E;  2OYO A;  4H44 B;  3EWK A;  1FOS E;  1MKM A;  1YYC A;  3TF5 A;  1H89 A;  3CXH D;  3P4S C;  5KAI H;  3NTN A;  1M1J B;  4YTN C;  3CCJ P;  1BSN A;  1CZQ A;  5KKZ C;  2Y0E A;  2AEM A;  3GLM A;  2E76 B;  1NH4 A;  1EC5 A;  1M90 Q;  2JEE A;  2R3C A;  3L70 G;  4WB4 A;  3KXD A;  2B88 A;  2ZFY A;  3UIA A;  2WPR A;  2YIU C;  1X79 B;  1KFN A;  2QG4 A;  1HTL C;  3H1I E;  3GMA A;  3M0D A;  1NTM D;  4PD4 E;  1LWU A;  1S5L H;  1SQQ D;  1PZQ A;  1SQP E;  3JCU H;  2BAS A;  5APS A;  1GU5 A;  2E42 A;  2WPQ A;  2WSF H;  2WTY A;  3I56 P;  2PRR A;  2GA1 A;  3GHG B;  2CPB A;  3VR9 D;  3H1L J;  1GW3 A;  5AVX B;  2FFD A;  1ZOY D;  1RE4 A;  3M9B A;  2HR3 A;  2KS1 A;  2HG5 D;  2BEZ F;  4UB6 E;  1N7S B;  2D2C B;  2O01 N;  3HUS A;  3HD7 A;  3CWB G;  3MP7 B;  3U1C A;  2B87 A;  1H88 A;  1JO5 A;  3CMA P;  2Y9Z A;  4XA4 A;  4H13 C;  1RH5 B;  1GL2 B;  3AE5 D;  1VF5 B;  4ASW A;  1N7L A;  3O8Z A;  1YQ4 C;  2YO2 A;  1ZR2 A;  3AEF C;  3RL0 D;  3A7O A;  3T97 B;  1NTK G;  3P8C D;  5KJ7 D;  2OYI C;  3L73 G;  3L70 E;  4WWI A;  1OXZ A;  3VMZ A;  1RY3 A;  4IL6 H;  3H1H J;  1SQX D;  2HOD B;  3CXH I;  1K8A Q;  2MKV A;  2WU2 C;  3SFE C;  2ZXE B;  2WZ7 A;  1EDL A;  1ZME C;  1JUN A;  1BE3 G;  3E1I A;  3OAK A;  3CC7 P;  1ZW0 A;  2FBW D;  1AQ5 A;  3M06 A;  2BEQ D;  1FJK A;  3AE9 C;  1FOS F;  4UB8 E;  4IOI H;  2K3R A;  3LID A;  3EFG A;  1GW4 A;  5H2F H;  3BRV B;  4JYC A;  3L70 D;  3WU2 H;  4U7J A;  3CWB E;  4IFD K;  1PP9 G;  2Q1K A;  3L35 A;  1JMB A;  2ZVN B;  2B89 A;  2RKL A;  1T3U A;  3L72 D;  1L0L J;  3AE2 D;  3R2P A;  1VQ8 P;  2K9J A;  3L71 J;  1VQP P;  1NTK E;  2KIK A;  1PFI A;  3L73 E;  1KN7 A;  1QVF O;  3M0D C;  2B76 D;  1LWU C;  2Z5I A;  1NVO A;  3CX5 D;  3KQG A;  1YIT P;  1AJY A;  2HPC B;  2OYI B;  1NTZ G;  1FU1 A;  1TU3 F;  1L4A A;  2Q6Q A;  2C0W A;  1BE3 E;  3PTZ A;  2FFD C;  4R4M A;  3Q5S A;  1M8O B;  4PD4 I;  1RE4 C;  1YI2 P;  3P4P C;  2KLV A;  5CHX A;  1LT9 B;  2NPS D;  2R5D A;  2JWA A;  1IK7 A;  1YIJ P;  4L76 A;  2FYU G;  3KDP B;  3ABV C;  2WT7 A;  3HD7 C;  1AVO A;  2OTL P;  4EDF A;  1WMK A;  2WSS H;  3CI9 A;  1LTJ C;  3AEC C;  1UII A;  5AVS B;  3CPW O;  1SQV D;  5AW9 B;  5B5E H;  2FYU K;  2V4H A;  1K73 Q;  3H1J J;  2E74 C;  3I55 P;  1P84 E;  1K05 A;  2M5A A;  1RF1 A;  2YNY A;  3TNU B;  3G4S P;  2LXC B;  2WSE J;  4KHX A;  2WSE H;  2E5T A;  1IC2 A;  1BDD A;  1U57 A;  2CK3 H;  4NPF X;  2J5U A;  4HYT B;  1JY3 O;  1SQB K;  2BS4 C;  4NPD A;  3VP8 A;  1EXJ A;  3BCC J;  1SLQ A;  1NTZ E;  1RF0 C;  4I2L C;  2OAR A;  3VP9 A;  3G9R A;  3Q5R A;  1HJ0 A;  3FGA D;  5KLV K;  4YXD D;  5B66 H;  3K5B A;  2Q3I A;  4UB8 H;  4WY4 D;  2H88 D;  5CCG C;  2ITA A;  3RK3 D;  1PP9 D;  1QGK B;  3QH9 A;  1M1J A;  2FYU E;  1RQV A;  1KQL A;  3AEA D;  2FY8 A;  1JEK A;  1N73 B;  3GF7 A;  1GK6 A;  1NAY A;  3SSU A;  1KB9 E;  1L0V C;  2HFE D;  3A0H H;  1FDM A;  1LTJ B;  1NU1 D;  3B5N D;  1OW8 A;  1R5L A;  4AYC A;  1LP1 B;  5AVR B;  3PHL A;  2NRG A;  1SQB E;  3NFQ A;  2I8D A;  1PGO A;  1M1K Q;  1KYO E;  5AW3 B;  2WDQ D;  2YKQ A;  4U3F J;  3P4Q C;  2WS3 C;  1BSH A;  4PV1 B;  2ZXX A;  3IN6 A;  1FZE A;  3GHG A;  4YT0 D;  3SFD D;  1BCC D;  1NKN A;  5AW8 B;  3H1L G;  2QVA A;  2XDJ A;  3KZI E;  4YPC A;  2V7Q J;  2A45 H;  2V7Q H;  1N7S A;  1E7P C;  4YSZ C;  1OZH A;  3I5C A;  4N6J A;  1Z56 A;  1KIL B;  2AXT H;  1GL2 A;  5KAI E;  4KT0 J;  3B71 A;  1L0N D;  2IBZ G;  1VQM P;  3M9H A;  4I1L A;  1NYH A;  1P84 H;  1RF1 C;  2IYP A;  1FS0 E;  3HTK B;  1G2C B;  4D6T G;  2HOD A;  1GTW A;  4OGQ C;  1XTC C;  1GZL A;  2LXB A;  3AE1 D;  3H1H G;  1LTA C;  1USD A;  5BVZ A;  2W90 A;  3ZDM A;  1SFC B;  2JKV A;  1ZP0 D;  5KLI B;  3FWN A;  2XND H;  1FZG A;  1S5L E;  2SPZ A;  4H44 C;  4JF7 A;  3Q2Y A;  1QL2 A;  1URQ D;  3LIE A;  1RHZ B;  5AW4 B;  4JQ0 D;  5AW2 B;  2IZ0 A;  1QVG O;  1KOR A;  1M1J C;  2R5B A;  3H1L E;  1TFF A;  5APV A;  3NXS A;  3FWL A;  4JYB A;  2E76 C;  5CCH A;  1NKZ B;  4YSX C;  3M91 A;  2M3B A;  2QEX P;  1OFC X;  1GMJ A;  4BWN A;  1JY3 N;  3Q5P A;  1HGZ A;  3P4S D;  2K88 A;  1ZRT E;  2IBZ E;  4YTN D;  1BGY D;  1L0L G;  3F89 A;  3QWO C;  2ZYG A;  3PJS K;  1SQQ K;  2N9B A;  2I1K A;  3L71 G;  3AED C;  2BCC J;  3H1I G;  1S9K E;  1KYO H;  1FZC C;  3VRA C;  3CCV P;  1S2E A;  2HPC A;  2OYI A;  1Y47 A;  2KUB A;  1L0L K;  4IL6 E;  5KLV J;  3H1H E;  3VMA A;  1HBW A;  1HJB A;  5AW0 B;  1RQU A;  3GHG C;  2OTK E;  1EZV D;  3P32 A;  2ACZ C;  2QSI A;  3L75 D;  4AUW A;  1EDK A;  1CI6 B;  3P8M C;  1LT9 A;  3IFM A;  2P67 A;  2Q3E A;  4PJ0 H;  4Z1M H;  3AEB C;  1NWQ A;  1N7S C;  1LT1 A;  2D2C C;  3AE3 C;  3TK1 A;  1ZRT D;  3U1A A;  1LJ2 A;  1FDI A;  1GL2 C;  1JOC A;  1VF5 C;  1AA0 A;  3M0A A;  4TT3 H;  4ZKP A;  4YTM C;  4LGD E;  5H2F E;  3TGU J;  3D70 A;  4D6T D;  5C3J C;  2XU6 A;  3C9I A;  2P1J A;  3WU2 E;  1JCD A;  1T6A A;  2BS3 C;  1ZN5 A;  5CBN A;  3CCQ P;  1BDC A;  3O6Q B;  1E5W A;  3H1J G;  1K9M Q;  3TNU A;  3A2A A;  3U59 A;  1YTZ T;  4JBZ A;  3C8V A;  1HGV A;  1KFM A;  4H13 D;  1L0L E;  1M57 D;  2IPP A;  4O9B A;  4H0L B;  1ZLL A;  1J1D B;  3L71 E;  1YQ4 D;  3MD0 A;  1W2E A;  3S9O A;  1IFD A;  3RK2 B;  3AEF D;  1HH0 A;  3L74 D;  4EYY Q;  3CLQ A;  1VQ4 P;  2FXP A;  3BCC G;  1FZC B;  1ZR4 A;  5TIS H;  2P10 A;  1DD3 A;  3SFE D;  4GOD A;  2QM8 A;  1S4X A;  3H32 B;  4OH8 B;  2IFN A;  2POH A;  4EIJ A;  1N73 A;  4DDG A;  5CCH C;  2JDI H;  1DX7 A;  3AE9 D;  4YTP C;  3II6 A;  3WUV A;  2LKM A;  1R5S A;  3MTU E;  1LTJ A;  1EZV I;  1ZXG A;  5B5E E;  1USE A;  3H1I D;  2CPS A;  1LP1 A;  1NEN C;  3CIR C;  2JR8 A;  3CC2 P;  3H1J E;  4PD4 D;  2YXR B;  3WMM 0;  3P4R C;  3AEE C;  2ZT9 B;  1KQF B;  2FXO A;  1SQP D;  4N78 E;  3JC2 2;  2IBZ I;  1NEK C;  3Q1M A;  2XNX A;  3VYI A;  1UIX A;  1LT9 C;  1CSB A;  2C0X A;  2H7H A;  3BCC E;  4IFM A;  5GTI H;  5AW6 B;  4TLF A;  3VMY A;  2HYN A;  5TJH A;  1RF0 A;  1DIP A;  1SQV K;  5B66 E;  4LLH A;  3RBZ A;  5BU5 A;  3BAS A;  3AE8 C;  2A45 G;  4BRY B;  1G1J A;  1KIL A;  2BS2 C;  5CCG A;  4GKG A;  2A06 G;  2QJK C;  3AE6 D;  1NTM J;  1LTG C;  3HD7 D;  1SQQ J;  4W7Z A;  3HTK A;  1G2C A;  2Q7C A;  3A0H E;  2RH0 A;  1EQ7 A;  1KIL E;  1N86 A;  3E1R A;  2E74 D;  1SFC A;  3VR8 D;  2IX7 C;  2WMM A;  4U3F E;  4DOJ A;  3HE5 B;  5AVZ B;  1KD1 Q;  1QL1 A;  2WDR D;  2Y0C A;  2K9Y A;  5EFW B;  1OVU A;  4M3L A;  3CWB D;  1N73 C;  1VQL P;  5AVW B;  1SQX J;  4C7N B;  2M0B A;  1X9V A;  2A06 E;  1T3J A;  2AXT E;  3CD6 P;  2O01 J;  1NTK D;  2O01 H;  3MIW A;  3L73 D;  2KP8 A;  4C46 A;  5KTB A;  4QMA A;  1EDJ A;  2QJK B;  2WWW A;  1HUC A;  4YSY C;  1SQB G;  5APU A;  4XFJ A;  2OTJ P;  1VQO P;  1L0V D;  2BCC G;  4PV1 C;  5C2T C;  1BE3 D;  4FJV A;  5KLV G;  2OGU A;  1CI6 A;  2Z5H A;  3L70 J;  3HE4 B;  3RL0 B;  1MZ9 A;  1FBM A;  2QJP B;  2N1T C;  2Q9I A;  2JO1 A;  3P4Q D;  1L4A D;  2WS3 D;  3L72 J;  1KIL C;  3VRB D;  2J59 M;  1L0N K;  4OWF A;  2NPS C;  2OYH A;  2Y9Y A;  1P84 D;  1QLB C;  2P2U A; 
#chains in the Genus database with same CATH homology
 1KQF B;  2FBW D;  4TT3 H;  4YTM C;  3Q2Y A;  3AE8 D;  2YIU C;  4Y28 J;  3D71 A;  2WDR D;  3D70 A;  3O6Q A;  2K9Y A;  1S5L X;  2BEQ D;  1PL5 A;  2WP9 C;  1HF9 A;  2JP3 A;  5C3J C;  3AEA C;  3GMA A;  3R4Y A;  3AEG D;  1NEK C;  3AE9 C;  2BS3 C;  2QJP C;  1KOR A;  2WDQ D;  1PV3 A;  1S1C X;  2WDR C;  3P4Q C;  3Q1M A;  4YSY D;  2E74 C;  4YSZ D;  2WS3 C;  1KQG B;  1UIX A;  1KF6 D;  4KX6 C;  4PV1 B;  3AED D;  4I7Z B;  1K05 A;  2E75 D;  2NZ2 A;  2WSC J;  4PV1 D;  3VRA D;  3C8V A;  4YSX D;  3IN6 A;  4H13 B;  1K04 A;  1R8E A;  5C2T D;  4H13 D;  1PIX A;  2G3A A;  2E76 C;  4YT0 D;  1ZP0 C;  2IDB A;  2WSE J;  5KLI C;  4YSX C;  3SFD D;  4U7J A;  4H0L B;  1U57 A;  4R4L A;  4H0L D;  1DIP A;  1YQ4 D;  5M1B A;  2O01 J;  3VR9 D;  2YMK A;  1GMJ A;  3LW5 J;  2WU5 D;  2J5U A;  2ZT9 C;  2ACZ D;  4YT0 C;  3S9O A;  3Q5P A;  2FBW C;  3AEF D;  1ZOY D;  3P4S D;  3AE8 C;  1ZRT E;  2V7Q J;  4OGQ B;  2OQQ A;  4YTP D;  4OGQ D;  4YTN D;  2BS4 C;  3AE2 D;  1KFY D;  1EXJ A;  1Q90 D;  2BS2 C;  3AEG C;  1JB0 J;  2E75 B;  2FXP A;  3AE7 D;  3GF3 A;  2WDQ C;  2BEZ F;  1E7P C;  3AEB D;  4YSZ C;  4YSY C;  2D2C B;  2P10 A;  2D2C D;  4RKU J;  4XFJ A;  2WQY D;  1YQ3 D;  3G9R A;  3Q5R A;  2QJK C;  2WDV D;  1HJ0 A;  3FGA D;  3AE3 D;  2H89 D;  4KT0 J;  1KF6 C;  1DD3 A;  1L0V D;  3AE6 D;  4YXD D;  3AED C;  1NEN D;  2E75 C;  4PV1 C;  3SFE D;  4I7Z C;  3VRA C;  5C2T C;  3CIR D;  2G8Y A;  3B71 A;  4H13 C;  3AE4 D;  2B76 D;  2H88 D;  3AE5 D;  3AE6 C;  1FDO A;  1VF5 B;  1KMI Z;  4H44 B;  3AEE D;  3P4R D;  1VF5 D;  1NYH A;  4GDO A;  4H44 D;  3EWK A;  1VL2 A;  1AJY A;  1EXI A;  3SFD C;  1NGM B;  1RQU A;  1MKM A;  4YTM D;  2FYN C;  4H0L C;  1YQ4 C;  3VR9 C;  1TU3 F;  2WU5 C;  4IL6 X;  2ACZ C;  2WP9 D;  2QSI A;  3H25 A;  1RQV A;  3AEF C;  3P4P D;  1ZOY C;  3RL0 g;  3P4S C;  5C3J D;  1KIL E;  3T97 B;  3AEA D;  1Y9B A;  1NEK D;  3AE9 D;  4YTP C;  2JO1 A;  4OGQ C;  4YTN C;  2E74 B;  3P4Q D;  3AE2 C;  3GF7 A;  2E74 D;  1OW6 A;  1KFY C;  2WU2 D;  3Q3D A;  3AE7 C;  4R4M A;  3Q5S A;  2WS3 D;  3AE1 D;  3P4P C;  4Z1M H;  3AEB C;  2QJY C;  4KX6 D;  3ABV D;  3D6Z A;  2D2C C;  2WQY C;  3RK3 E;  5KKZ C;  1YQ3 C;  2MKV A;  3AE3 C;  2WDV C;  2WU2 C;  2H89 C;  1IK7 A;  2E76 B;  3GLM A;  5L8R J;  4YXD C;  1L0V C;  3VR8 D;  2E76 D;  3AE1 C;  3VRB D;  1NEN C;  3AEC D;  3SFE C;  1ZP0 D;  3CIR C;  3ABV C;  1OW7 A;  3AE4 C;  3IAO A;  1KTM A;  2B76 C;  1ZME C;  2QIW A;  1OW8 A;  1FDI A;  1DD4 A;  1WMK A;  2H88 C;  2WPV B;  3AE5 C;  3D6Y A;  1QLB C;  3P4R C;  3VR8 C;  3AEE C;  1VF5 C;  2ZT9 B;  4H44 C;  3AEC C;  3VRB C;  2ZT9 D;  1OMI A;  2WSF J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...