3AEAC

Crystal structure of porcine heart mitochondrial complex ii bound with n-(3-dimethylaminomethyl-phenyl)-2-trifluoromethyl-benzamide
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
total genus 47
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3aeaC01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3aeaC02
2G3AA 2ACZD 4YT0C 1ZP0D 1NEKD 1KTMA 1ZOYC 3ABVC 3P4SD 1K05A 5C2TD 3AEDD 3AE4D 2BS3C 3AEED 2WDVC 2WU2C 2WDRD 3P4QD 3AE5D 3AE9C 2H88C 3AE8C 1L0VD 2WU5C 3P4PC 3VR9C 4KX6D 2BS4C 4YTND 3CIRD 2H89D 2WP9C 3P4RC 4YXDD 1E7PC 3AE2C 1NEND 3AECC 2WDQD 3VRBC 3AEGD 1YQ4C 3S9OA 3SFDC 3SFEC 3VRAC 4YSZC 2FBWC 2FBWD 1PV3A 3SFDD 4KX6C 1KFYC 1QLBC 3P4PD 3AEBD 3AE7C 4YXDC 3VR8D 2WDRC 3P4QC 2WU2D 3VR8C 3AE4C 3AE7D 3AEBC 3P4SC 5C2TC 3VRAD 3SFED 1KFYD 1YQ4D 1OW7A 1NEKC 3B71A 4YT0D 2ACZC 2WDVD 3AECD 3AEEC 1NENC 3AE2D 4YSZD 3ABVD 1ZOYD 2H89C 2WP9D 3CIRC 4YTPD 1OW8A 4YSXC 2WDQC 3VRBD 3AE8D 2H88D 3AEFC 3P4RD 4YTNC 4YSYC 3VR9D 1L0VC 2WU5D 1KF6C 3AE9D 3AE5C 3AE3D 1YQ3D 1YQ3C 3AEDC 3AE3C 1KF6D 2B76C 2B76D 1K04A 1ZP0C 5C3JD 4YSYD 3AEGC 2WQYD 2WS3D 2WS3C 4YTMD 4YTMC 3AE6D 3AEFD 3AE1C 5C3JC 3AEAC 3AEAD 2BS2C 3AE1D 4YTPC 3AE6C 2WQYC 1OW6A 4YSXD
chains in the Genus database with same CATH superfamily
4YT0C 5APWA 4H44D 1UIXA 1HF9A 1DD3A 1ZXGA 1VQKP 2WPRA 1KB9I 2D2CB 1NYHA 1NU1J 5AVTB 5GTIE 1BDCA 1LTBC 2CPBA 5DJTB 1J1EC 3AE2C 4I6LA 3M0AA 3G9RA 3KHUA 1KV4A 1SQBD 4EYYQ 2OYIA 5AW0B 1GL2A 3U1AA 1VF5B 1IFPA 1HGZA 3P4QC 3AE4C 4XE5B 1GMJA 1T6AA 1KFYD 1NAFA 1BE3D 1OW7A 1BSHA 1OVVA 1AQTA 2E74B 4XFJA 1QL2A 1SQXJ 4DJGA 2K37A 3BCCJ 2O01N 1KC8Q 2BCCE 4JYCA 2HODA 2IPPA 2ZFYA 2C0WA 1R5LA 2OYHA 2B9BA 2JR8A 2ZAEB 4M3LA 1FZCB 3CX5H 1L4AC 1EC5A 1FS0E 1FE6A 1TFFA 3IAOA 3AE6C 3N7NA 4ASVA 1IFJA 1FOSE 2Z5IA 2V7QJ 1IJDB 3TNUA 1HGVA 3PJSK 4BRYA 2Y9ZA 3AEDD 3M06A 2WDRD 1N73C 1FJKA 3B5NB 3W67A 1BE3J 1KILD 3CXHI 1SQQK 2NZ2A 2ZYGA 1KB9H 4YSZC 3CC7P 2FBWD 1R5SA 3E7KA 4D6TG 1BGYG 4DT0A 1JY2N 2E76D 2KS1B 4WWIA 3JC22 1SQXE 3GF7A 1SQPG 3RBXA 1PPJD 3NTNA 3LIDA 2FYUG 4D6TE 1ZOYD 4PV1D 2E75D 2PFXA 3VTPC 2NPSA 2WVRA 4ZMDA 2R5BA 3CCQP 1JY2P 2N1TA 3AE8D 3C8VA 2Q3EA 3RBZA 3C1LA 3QWOC 2KOGA 1QGKB 3CCMP 4WVZA 3KDPB 4A7PA 2JO1A 4DOJA 1U7JA 1JY3P 4YSYD 2QVAA 3PLNA 1N8RQ 3BCCG 3CC2P 2BS2C 3AE1D 2M5AA 1S2EA 2YIUC 1YTZI 2BCCD 2P58A 2NPSB 3PH0A 5L8RJ 4PJ0H 3VP9A 1SS1A 1K05A 1YJ9P 3AE5D 4C7NB 3P4PC 2XNDH 4KX6D 4N3YB 3OAKA 1G1JA 4L76A 4HKZH 2M5AB 2J58A 1A02F 2QM8A 3RL0C 2QSIA 3SFEC 2P7JA 1RF1B 1PP9J 4L75A 2B89A 2E76B 3H1JG 2QE7H 3M9HA 3CXHH 3OJAB 3MUDA 2JJLA 1EDIA 1S9KE 4YPCA 4UB8E 1M8OB 2KYVA 1OVRA 3Q5SA 1BSNA 1W2EA 2LXCB 1LT9C 1PGPA 1GW4A 3L70G 2W6AA 3KPEA 4JQ0D 1K73Q 1OX3A 3P4RD 1JUNA 2KLUA 3L71E 2OTJP 1N7SB 2YMKA 1UIIA 3Q5RA 3AE3D 2JKVA 1FZGA 1RHZB 3AEDC 1Y8AA 5B5EE 1NTMK 1LWUA 3EFFK 1NHLA 1Q81Q 2PAJA 1NTMD 3W68A 5BU5A 1QVFO 1EXJA 1MUUA 4HB1A 3BCCD 1ZW0A 5KLVJ 1ZMEC 1LTJC 1NTMG 2K9JA 2M0BA 3T97A 3IFMA 3H1LJ 1RF0A 2MKVA 4ASWA 3CWBD 5AW9B 3V4WA 1RY3A 4U3FD 3B5ND 1M90Q 1BCCD 1S5LX 1NAYA 5APUA 3CLQA 4EI2A 1KILC 1SQQJ 2Q9IA 2N1TB 1OZHA 1M7LA 2A45H 4ZNCA 2BEZF 3CCUP 1LT9B 1IO4A 3V5BA 5KJ7C 2ZYDA 5APQA 1USEA 3VOPA 4RESB 2YO2A 2WMMA 5KLVG 1YBKA 2E43A 1JTHB 2WS3D 1KQGB 3RK2B 2FYUD 3HE4A 5C3JC 3L74J 1K9MQ 1SQXG 2R44A 1VQ7P 3KXDA 1T2KC 1FZBA 4H0LC 2WSEH 1M57D 3L72D 3FXEA 1BGYD 3SWFA 3CC4P 2ZT9D 3ABVC 2W90A 3ITKA 3TNUB 1L0VD 1K8AQ 4H13C 1RE3C 4L74A 3CCRP 2WP9C 3L72G 5CCHD 4YXDD 1JM0A 3BCCE 1YQ4C 3ZDMA 2R3CA 2RN0A 4OGQD 2WSCH 2WT7B 3I56P 3HTKA 1VQ8P 1M1JA 1PP9E 2I1JA 1KFNA 1IFMA 1YJNP 3KYQA 1N2DC 2HPCA 3CWBE 2OYHC 1USDA 1QLED 2ACZC 3GLMA 1URQC 3MP7B 3CL3D 4YSZD 2IYOA 3G4SP 1NU1E 1EDJA 3VRBD 5CHXA 2KNCA 2H7HA 1LTTC 4YTNC 3PRJA 2A45I 2BCCG 2ZT9C 1SQQG 1JEKA 1KQFB 1VQNP 1DEBA 1SFCD 2O01H 3RL0g 3CXHE 1VF5D 3H1ID 5H2FE 1CI6A 4PD4I 2WQYD 3EWKA 2XKMA 3AE6D 1RF1C 1SQXK 4YTPC 4GOFA 2WPVB 2ZT9B 5B66E 1AA0A 4YSXD 5AW4B 2A06E 5CJ4A 1N73B 2Y0CA 2CPSA 3FWNA 1DX7A 4D6TJ 4GDOA 3P32A 2W6BA 3CD6P 3JCUE 4WY4D 2H89D 1J1EB 2FYUE 3V2PA 1IK9A 3SFDC 3H1HE 3USSA 1VQMP 3SFDD 1U7MA 1BGYE 4KX6C 2N9YB 3HUSA 1SQBG 3G6EP 1L0LK 2W83C 2O3JA 3L71D 2P2UA 3WUTA 4C7NA 1SQPJ 1KZUB 2WDVD 3D70A 2V7QH 3V6IA 2Q1KA 3E1IA 1YHQP 3NFQA 3FWLA 3M0DC 3H1JJ 1T8ZA 3LW5H 4HH2A 1L0NG 5DJUB 2QIWA 3CCEP 1LP1B 3H1KJ 4QMAA 3WU2H 2FYNC 4IL6E 1G1IA 1HJ0A 2JP3A 1ZP0C 2L5GB 3SSUA 1W5CE 1JY3N 3R4YA 1L0LE 2YNYA 3WUVA 3GHGA 1ZV8A 1S1CX 2PRRA 1DIPA 2XNXA 2FYZA 2R32A 1ZP0D 3CCJP 3CXHD 4K35A 5TJHA 5C2TD 1NWQA 2WU2C 1FZAA 2KS1A 2BS4C 3P7KA 2ZYAA 1SQPD 3GW6A 3CCLP 1Q82Q 1J1DC 1NEND 2QJYC 4RKUJ 1FC2C 2KK7A 3L73G 2JDIH 1SFCB 1TU3F 3VMXA 1LTSC 2G8YA 1N7LA 2ZFCA 4YXDC 1LGHB 2WDRC 2QG4A 3C9IA 4NPFX 3AE7D 2QJKC 3VRAD 3B4SA 3HE5B 1LJ2A 1N7SC 3H1LD 2PP6A 1L2PA 1FZEA 4KT0J 3ABVD 2GUSA 2WP9D 2MJZA 1SLQA 4Z1MH 1H8AA 3KQGA 2YXQB 1HTLC 3H25A 1KILA 2P67A 1AJYA 2H88D 1P84I 1Y47A 1S9KD 4WY4C 1NKZB 3VR9D 1G2CA 2WU5D 1XTGB 1Y9BA 3U1CA 4I6MC 3A3YB 1FZCA 2D2CD 4GOEA 1NTMJ 1YJWP 5CJ0A 3IN6A 3L37A 2Y9YA 2HODB 4YTMC 3AEFD 3M0DA 1L0NJ 1LNQA 5CCGC 4O9BA 1FJPA 1KILE 2IDBA 1URQA 1OFCX 1ZR2A 3VMYA 2KXPB 1R8EA 3A2AA 3II6A 1L0LG 2WZ7A 1NH4A 4DHIB 3AE9C 3HD7B 1L0LD 4PJ0E 2OGUA 5AW6B 4HYTB 3Q3DA 1Q7YQ 2C0XA 1VQPP 2IBZI 3TDKA 1YTZT 3CMEP 1SQBE 2HR3A 2JWAA 3L35A 3H32B 3VR8D 1SQVE 2QRXA 5APXA 4H44C 3CMAP 2OTKE 4YT0D 5KLIC 3CCSP 3L73J 2OTLP 1SP4A 2ZJSE 5KAIE 5KAIH 3H1HJ 5CCHC 1S4XA 3MUDC 4YSYC 3SWKA 3TF5A 1KF6C 2QJYB 2JWDA 1KF6D 4EIJA 1QL1A 3L70J 2B87A 5C39A 1EZVG 1LTJB 4H0LD 1SQVK 3EFGA 3GHGC 2N1TD 4DZOA 2UWJE 3TGUJ 2FY8A 3EQ2A 1IK7A 1RQVA 1PZQA 4H13B 3P4SD 2IFMA 1URQD 2BS3C 2FFDB 4AUWA 1BCCG 2Q6QA 1NU1G 2YKQA 3BVHA 5AVWB 3CIRD 4OWFA 2XU6A 2IBZE 3WU2E 1SQQD 3HE5A 5K5GB 1PFIA 2C9NY 3HD7C 4Y99B 3CCVP 4TLFA 4W7ZA 2JEEA 3A7OA 2KI7B 3P8CE 3HRNA 1LTJA 2NPSC 1SQBK 1S5LE 1BCCJ 1JTHA 4WY4A 2KLVA 5TISH 4UB6H 1FDMA 2PGDA 3FX0A 1NTZD 3L75E 1J1DB 1LWUC 3AE2D 3VP8A 2QJPB 1FOSF 2Z5HA 5KLVD 3AEFC 2IBZD 5E79E 1JY2O 1T2KD 5KLVK 4JPZB 2R5DA 4I2LC 4U3FE 1YQ3C 1SQVJ 2E5TA 1QEXA 1YIJP 1AFOA 3JCUH 1KN7A 4RJTA 1NKNA 3U59A 2WITA 2ZXEB 2KSJA 3L73E 3M9QA 3AEAD 3V2QA 5KTBA 5TISE 2YIUB 2J5UA 2G3AA 1YI2P 1S5LH 3A0HE 1SQXD 2ZVOB 1N7SD 1SFCC 2YKOA 1ZOYC 1GTWA 1L4AA 3AEED 3V4QA 1Q90D 1X9VA 3GMAA 1ZN5A 3AE8C 2HFED 3TSIA 1LTAC 2E75C 1GL2D 3P4RC 1NTZJ 1GD2E 3AECC 2WSSH 1ZLLA 4N6JA 5APSA 1P84H 4GIFA 4JYBA 1RH5B 1P84D 2H8PD 5AVSB 1SQBJ 1GK6A 1VQOP 1EZVI 2WU2D 2FYNB 1M1JB 3AEBC 3BRTB 3P4SC 1HBWA 3LIEA 2ZVNB 3AECD 3AEEC 1M56D 1NU1D 4I1LA 5KKZB 3H1IG 3NMDA 3L74E 2W6JH 3CPWO 1JO5A 2FYUK 4IL6X 5AW1B 4W80A 1KORA 4BWNA 1FBMA 3TGUD 3RK2D 4U7JA 1EDLA 1CZQA 3H32A 3BATA 1NTKE 1KYOI 3S4RA 2QJPC 1PGOA 3L70D 3L4FA 4YTMD 3AE1C 4RO0A 5GTHE 1CSBA 1XTCC 1NTKD 1EQ7A 3VMZA 1PIXA 1QVGO 3AEGD 1RE4C 1NEKD 3N4XA 3PTZA 1VQ4P 1KMIZ 1IFDA 1JCDA 1KYOH 4IFDK 2O1JA 3L73D 1CW5A 3L70E 1AVYA 1DD4A 2XZRA 3CI9A 2A06G 2K9YA 3RK3B 1NTZK 1YITP 2WDQD 2AXTE 2XV5A 4L73A 3L71G 1HUCA 1PP9G 3PHLA 3H1LE 1AV1A 2Y0DA 2WSFJ 3TK1A 4C46A 4R4MA 1G2CB 4LDTA 2KIKA 1QX8A 1FAVA 3HD7D 3B71A 1NU1K 1NENC 4IFFA 4N78D 1KILB 3L75D 3CIRC 2LKMA 5CCGD 5CBOA 4GKGA 3HUSC 2N1TC 2VRSA 1OMIA 3R2PA 2QJKB 1M1JC 3CWBG 1D7MA 1PPJE 1L0ND 2FXOA 2HYNA 2Z4EA 4BXLA 4W7YA 2B87B 2K1AA 1RE3A 2O1KA 1FZFA 1SQVD 2RMZA 4Y28J 2N9BA 5AW5B 2FXMA 3A0BH 1SQVG 2ACZD 3CX5I 1IFIA 2IZ1A 1KFMA 1KQSO 3O6QB 1MFTA 1S72P 1X0TA 1ZR4A 2QM7A 2BEQD 5AW8B 1N73A 4BRYB 4MN4C 3M91A 5B5EH 3MGNA 4LC1A 1FDOA 1A02J 5GTIH 1NTZE 3I55P 4H0LB 4OGQC 2WTYA 1PGQA 1OWAA 2W8ZA 2RKLA 2FBWC 3CX5E 2CK3H 1KFYC 1Q86Q 1CI6B 5APTA 1ZRTD 2AEFA 1GDTA 1KB9D 1SQPE 3H1KE 5C2TC 4OGQB 1JB0J 2OYHB 1DEEG 4HJGH 4UB6E 5BU8B 1EXIA 2KNCB 2H89C 5AVQB 4R4LA 1KYOD 4YXWH 2K9JB 2WDQC 3OA7A 1LT1A 2V4HA 3H1LG 1MFZA 4C7RA 1FU1A 3UIAA 3QH9A 1DH3A 1SVFA 3BASA 3AE5C 3FGAD 4EOTA 2AXTH 2E75B 1JMMA 2B76D 1K04A 5KJ7D 3IR9A 1VPCA 3AEGC 2M8RA 1JY3O 1FDIA 3E1RA 3VONA 2WT7A 4Y99C 4NPDA 1N7SA 4PD4H 3V2NA 3G3ZA 3P8MC 1KYOE 3H1HD 5CBNA 3H1JD 3PP5A 2P10A 1IFNA 2H88C 2K88A 3L36A 1GW3A 3MZWB 3SWYA 1E5WA 1NTKG 1E7PC 2GUVA 5KJ7A 1MKMA 3H1JE 3B5NC 3VRAC 2A45G 2LR2A 4TT3H 2ITAA 3RL0B 4ZKPA 2IFNA 3AEBD 2W27A 3L74G 3V2RA 2KZIA 5B66H 3VR8C 4XA4A 2OARA 4CPGA 1SQPK 1NOHA 1IC2A 1H89A 1X79B 1WT6A 4K3AA 3F89A 1L0LJ 2AEMA 4D6TD 4YTPD 1H0TA 4H13D 1VQ9P 1URQB 4EDFA 1X22A 2NRGA 1KB9E 3I5CA 5AVZB 1BE3E 2YKPA 2J59M 4WBAA 1WRGA 4DDGA 1LTIC 3CX5D 2HG5D 2WPSA 3H1IJ 2C9LY 3KZIH 2YXRB 5C3JD 4IFMA 4IOIH 2WS3C 3Q1MA 3L75G 1NVOA 3AEAC 4UB8H 1ZRTE 5CCGA 3A0HH 4JBZA 2IYPA 1RF0C 1L4AD 1LP1A 1LTGC 3MHVA 1NGMB 3NXSA 2E42A 1VDFA 3HD7A 2Y0EA 2FXPA 1HJBA 3OW2O 2WDVC 1KQLA 3H1HG 1YYCA 3KZIE 2QEXP 1BDDA 1NTZG 3RK3C 1VQ6P 3Q2YA 2KUBA 1SFCA 3HUSB 4WB4A 5H2FH 1PL5A 3IF4A 3RK3E 1S3JA 1Z56A 2M3BA 3P4PD 3AE7C 2QA4P 4I7ZC 2H43A 5AW3B 1KD1Q 2NPSD 5AVYB 3VMAA 3WMM0 2OYIC 3RK3D 2LXBA 1EDKA 1OW8A 5CCHA 1MZ9A 5AW7B 2WPQA 2Q5UA 3A5TA 2WSFH 1PPJG 3O8ZA 3L72J 5KAFH 3VYIA 3D6ZA 5EFWB 1SQQE 3H6PA 1HWTC 3H1KG 2IBZG 3L74D 1VF5C 1Q2NA 1X8YA 3GF3A 2E74D 1EZVD 2O01J 2D2CC 3VN0A 2XDJA 2OYOA 1P84E 2HLOA 5AVRB 5AVUB 5APVA 4B86A 3H1KD 1RF1A 1OW6A 2A06D 2E74C 3O6QA 1HH0A 3RGUA 2R3SA 1BCCE 4KHXA 2E76C 4N78E 3LW5J 2ZXXA 1EZVE 3MD0A 1T3UA 2E5YA 2HPCB 3TYYA 3L71J 3GHGB 4WY4B 3MIWA 5AW2B 1PV3A 3B8EB 2OQQA 1QLBC 3HTKB 4GODA 5KKZC 2IX7C 4LGDE 1GU5A 4DCKA 3MTUE 1U57A 4U3FJ 1VL2A 3RL0D 3FXDA 2KP8A 1OXZA 3SFED 4H44B 3CWBJ 1YQ4D 1L4AB 1VQLP 3JSVC 1FZCC 1RQUA 2BASA 2FFDA 2FKWB 4FJVA 3F5HA 2GA1A 2KSEA 5KLVE 2IZ0A 3T97B 3TGUE 3K5BA 1L0NK 2M3EA 4JF7A 4NPEA 2YMYA 3AE9D 3L72E 3Q5PA 1YQ3D 3AE3C 4AYCA 3HE4B 2B76C 1JNMA 1IZNB 5AVVB 3H1IE 1NO4A 2L91A 1N86A 1E79H 2AEJA 2WSEJ 2Q7CA 3M9BA 2WQYC 1OIPA 1JMBA 4DDIA 1KTMA 1PGJA 1M1KQ 4OVNF 3B5NA 2Q3IA 1RE4A 1WMKA 5BVZA 3AE4D 2YO3A 1MV8A 3D71A 2FFDC 3P4QD 1LT9A 4KJMA 2WU5C 3L75J 1OVUA 2B88A 3VR9C 3A0BE 5CMZA 4YTND 4PV1C 5KLIB 1GK4A 3VRBC 5M1BA 5APYA 5GTHH 3S9OA 1W2BO 3WUUA 2POHA 3G71P 1VQ5P 4ZKUA 1PP9D 2AXCA 4DHJA 1BE3G 2I1KA 4OH8B 4IL6H 4PD4D 4PV1B 2P1JA 5E79H 1NEKC 1J2JB 5KAFE 3S1KA 5AVXB 3GG2A 4I7ZB 2WSCJ 1JOCA 1GL2C 1HVVA 2KB7P 3BRVB 4YSXC 4LLHA 1GU4A 1BGYJ 1AVOA 2BCCJ 1H0TB 1NTKK 4U3FG 1L0VC 1L0NE 1NTKJ 2K3RA 1GZLA 1JCCA 2FYUJ 2I8DA 3P8CD 4AQRD 3RK2C 4DHZA 1GL2B 2WWWA 2GM4A 1NTME 1H88A 2RH0A 2OYIB 4GT1A 1LWUB 2SPZA 2KZJA 4PD4E 1T3JA 1AQ5A 1NJIQ 2DW3A 3TGUG 3D6YA
chains in the Genus database with same CATH topology
2G3AA 1IK7A 2ACZD 4YT0C 1RQVA 2E74C 2V7QJ 3O6QA 1NEKD 1ZP0D 1R8EA 1KTMA 1NGMB 4H44D 4H13B 5L8RJ 1ZOYC 2ZT9D 3ABVC 3P4SD 1K05A 1UIXA 1WMKA 2E76C 1ZMEC 3AEDD 3AE4D 2FXPA 5C2TD 2P10A 3D71A 2BS3C 1KMIZ 3LW5J 1HF9A 2WDVC 2WU2C 2WDRD 1Q90D 3AEED 3AE5D 3P4QD 1DD3A 3AE9C 3GMAA 2H88C 3AE8C 2D2CB 1L0VD 2WU5C 3P4PC 1NYHA 4GDOA 4H13C 3VR9C 2MKVA 4KX6D 1DD4A 2BEQD 2BS4C 4YTND 2E75C 2K9YA 4PV1C 2H89D 2WP9C 3CIRD 3P4RC 4YXDD 1E7PC 1FDOA 3AE2C 3Q3DA 1NEND 3AECC 2NZ2A 2WDQD 3VRBC 3Q2YA 2QJYC 4RKUJ 4H0LB 1YQ4C 5M1BA 4OGQC 3AEGD 1MKMA 3S9OA 4OGQD 3SFDC 3G9RA 3SFEC 2QSIA 3VRAC 4TT3H 4YSZC 2FBWC 1PL5A 2FBWD 1PV3A 3RK3E 1S5LX 2E76B 3SFDD 1TU3F 2OQQA 4KX6C 1KFYC 1QLBC 2WSFJ 3P4PD 2G8YA 5KKZC 3AEBD 1VF5B 3AE7C 4YXDC 3VR8D 2WDRC 4I7ZC 3P4QC 2WU2D 3VR8C 4R4MA 3AE4C 3AE7D 2E76D 2QJKC 1U57A 3AEBC 1GMJA 3P4SC 1VL2A 4PV1B 4OGQB 1JB0J 3SFED 3VRAD 5C2TC 4H44C 1KFYD 3GF7A 4H44B 1YQ4D 1OW7A 1NEKC 3B71A 4YT0D 2ACZC 2BEZF 5KLIC 4I7ZB 3AEEC 3Q5SA 3GLMA 3D70A 1NENC 2WDVD 3AE2D 3AECD 4KT0J 4YSZD 3ABVD 1EXIA 2WSCJ 1ZOYD 1RQUA 2H89C 4PV1D 2WP9D 1OW8A 2E75D 4R4LA 3CIRC 4YTPD 4Z1MH 4H13D 3H25A 2WDQC 4YSXC 3VRBD 3AE8D 1AJYA 2H88D 2E74B 3C8VA 4XFJA 3AEFC 3T97B 4IL6X 3P4RD 4YTNC 4YSYC 1KORA 2ZT9C 2YMKA 1OMIA 3VR9D 3Q5RA 4U7JA 2QIWA 1L0VC 2WU5D 3D6ZA 1KF6C 3AE9D 3AE5C 3FGAD 3AE3D 1Y9BA 3Q5PA 2FYNC 2JO1A 1YQ3C 2E75B 3AEDC 1KQFB 1YQ3D 1VF5C 2D2CD 3AE3C 1HJ0A 2JP3A 1KF6D 3GF3A 2B76C 2B76D 1K04A 2QJPC 3RL0g 1ZP0C 2E74D 2O01J 1VF5D 2D2CC 3IN6A 5C3JD 4YSYD 3AEGC 3R4YA 2WQYD 3EWKA 2WS3D 2WS3C 4YTMD 4YTMC 1EXJA 3AE6D 3AEFD 1FDIA 3IAOA 1KQGB 3AE1C 4H0LD 3Q1MA 5C3JC 3AEAC 1ZRTE 3D6YA 3AEAD 1KILE 2IDBA 4Y28J 2BS2C 4H0LC 3AE1D 4YTPC 2WPVB 2ZT9B 3AE6C 1S1CX 2WSEJ 1DIPA 2WQYC 2YIUC 1PIXA 1OW6A 2J5UA 4YSXD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G3A A;  2ACZ D;  4YT0 C;  1ZP0 D;  1NEK D;  1KTM A;  1ZOY C;  3ABV C;  3P4S D;  1K05 A;  5C2T D;  3AED D;  3AE4 D;  2BS3 C;  3AEE D;  2WDV C;  2WU2 C;  2WDR D;  3P4Q D;  3AE5 D;  3AE9 C;  2H88 C;  3AE8 C;  1L0V D;  2WU5 C;  3P4P C;  3VR9 C;  4KX6 D;  2BS4 C;  4YTN D;  3CIR D;  2H89 D;  2WP9 C;  3P4R C;  4YXD D;  1E7P C;  3AE2 C;  1NEN D;  3AEC C;  2WDQ D;  3VRB C;  3AEG D;  1YQ4 C;  3S9O A;  3SFD C;  3SFE C;  3VRA C;  4YSZ C;  2FBW C;  2FBW D;  1PV3 A;  3SFD D;  4KX6 C;  1KFY C;  1QLB C;  3P4P D;  3AEB D;  3AE7 C;  4YXD C;  3VR8 D;  2WDR C;  3P4Q C;  2WU2 D;  3VR8 C;  3AE4 C;  3AE7 D;  3AEB C;  3P4S C;  5C2T C;  3VRA D;  3SFE D;  1KFY D;  1YQ4 D;  1OW7 A;  1NEK C;  3B71 A;  4YT0 D;  2ACZ C;  2WDV D;  3AEC D;  3AEE C;  1NEN C;  3AE2 D;  4YSZ D;  3ABV D;  1ZOY D;  2H89 C;  2WP9 D;  3CIR C;  4YTP D;  1OW8 A;  4YSX C;  2WDQ C;  3VRB D;  3AE8 D;  2H88 D;  3AEF C;  3P4R D;  4YTN C;  4YSY C;  3VR9 D;  1L0V C;  2WU5 D;  1KF6 C;  3AE9 D;  3AE5 C;  3AE3 D;  1YQ3 D;  1YQ3 C;  3AED C;  3AE3 C;  1KF6 D;  2B76 C;  2B76 D;  1K04 A;  1ZP0 C;  5C3J D;  4YSY D;  3AEG C;  2WQY D;  2WS3 D;  2WS3 C;  4YTM D;  4YTM C;  3AE6 D;  3AEF D;  3AE1 C;  5C3J C;  3AEA C;  3AEA D;  2BS2 C;  3AE1 D;  4YTP C;  3AE6 C;  2WQY C;  1OW6 A;  4YSX D; 
#chains in the Genus database with same CATH topology
 4YT0 C;  5APW A;  4H44 D;  1UIX A;  1HF9 A;  1DD3 A;  1ZXG A;  1VQK P;  2WPR A;  1KB9 I;  2D2C B;  1NYH A;  1NU1 J;  5AVT B;  5GTI E;  1BDC A;  1LTB C;  2CPB A;  5DJT B;  1J1E C;  3AE2 C;  4I6L A;  3M0A A;  3G9R A;  3KHU A;  1KV4 A;  1SQB D;  4EYY Q;  2OYI A;  5AW0 B;  1GL2 A;  3U1A A;  1VF5 B;  1IFP A;  1HGZ A;  3P4Q C;  3AE4 C;  4XE5 B;  1GMJ A;  1T6A A;  1KFY D;  1NAF A;  1BE3 D;  1OW7 A;  1BSH A;  1OVV A;  1AQT A;  2E74 B;  4XFJ A;  1QL2 A;  1SQX J;  4DJG A;  2K37 A;  3BCC J;  2O01 N;  1KC8 Q;  2BCC E;  4JYC A;  2HOD A;  2IPP A;  2ZFY A;  2C0W A;  1R5L A;  2OYH A;  2B9B A;  2JR8 A;  2ZAE B;  4M3L A;  1FZC B;  3CX5 H;  1L4A C;  1EC5 A;  1FS0 E;  1FE6 A;  1TFF A;  3IAO A;  3AE6 C;  3N7N A;  4ASV A;  1IFJ A;  1FOS E;  2Z5I A;  2V7Q J;  1IJD B;  3TNU A;  1HGV A;  3PJS K;  4BRY A;  2Y9Z A;  3AED D;  3M06 A;  2WDR D;  1N73 C;  1FJK A;  3B5N B;  3W67 A;  1BE3 J;  1KIL D;  3CXH I;  1SQQ K;  2NZ2 A;  2ZYG A;  1KB9 H;  4YSZ C;  3CC7 P;  2FBW D;  1R5S A;  3E7K A;  4D6T G;  1BGY G;  4DT0 A;  1JY2 N;  2E76 D;  2KS1 B;  4WWI A;  3JC2 2;  1SQX E;  3GF7 A;  1SQP G;  3RBX A;  1PPJ D;  3NTN A;  3LID A;  2FYU G;  4D6T E;  1ZOY D;  4PV1 D;  2E75 D;  2PFX A;  3VTP C;  2NPS A;  2WVR A;  4ZMD A;  2R5B A;  3CCQ P;  1JY2 P;  2N1T A;  3AE8 D;  3C8V A;  2Q3E A;  3RBZ A;  3C1L A;  3QWO C;  2KOG A;  1QGK B;  3CCM P;  4WVZ A;  3KDP B;  4A7P A;  2JO1 A;  4DOJ A;  1U7J A;  1JY3 P;  4YSY D;  2QVA A;  3PLN A;  1N8R Q;  3BCC G;  3CC2 P;  2BS2 C;  3AE1 D;  2M5A A;  1S2E A;  2YIU C;  1YTZ I;  2BCC D;  2P58 A;  2NPS B;  3PH0 A;  5L8R J;  4PJ0 H;  3VP9 A;  1SS1 A;  1K05 A;  1YJ9 P;  3AE5 D;  4C7N B;  3P4P C;  2XND H;  4KX6 D;  4N3Y B;  3OAK A;  1G1J A;  4L76 A;  4HKZ H;  2M5A B;  2J58 A;  1A02 F;  2QM8 A;  3RL0 C;  2QSI A;  3SFE C;  2P7J A;  1RF1 B;  1PP9 J;  4L75 A;  2B89 A;  2E76 B;  3H1J G;  2QE7 H;  3M9H A;  3CXH H;  3OJA B;  3MUD A;  2JJL A;  1EDI A;  1S9K E;  4YPC A;  4UB8 E;  1M8O B;  2KYV A;  1OVR A;  3Q5S A;  1BSN A;  1W2E A;  2LXC B;  1LT9 C;  1PGP A;  1GW4 A;  3L70 G;  2W6A A;  3KPE A;  4JQ0 D;  1K73 Q;  1OX3 A;  3P4R D;  1JUN A;  2KLU A;  3L71 E;  2OTJ P;  1N7S B;  2YMK A;  1UII A;  3Q5R A;  3AE3 D;  2JKV A;  1FZG A;  1RHZ B;  3AED C;  1Y8A A;  5B5E E;  1NTM K;  1LWU A;  3EFF K;  1NHL A;  1Q81 Q;  2PAJ A;  1NTM D;  3W68 A;  5BU5 A;  1QVF O;  1EXJ A;  1MUU A;  4HB1 A;  3BCC D;  1ZW0 A;  5KLV J;  1ZME C;  1LTJ C;  1NTM G;  2K9J A;  2M0B A;  3T97 A;  3IFM A;  3H1L J;  1RF0 A;  2MKV A;  4ASW A;  3CWB D;  5AW9 B;  3V4W A;  1RY3 A;  4U3F D;  3B5N D;  1M90 Q;  1BCC D;  1S5L X;  1NAY A;  5APU A;  3CLQ A;  4EI2 A;  1KIL C;  1SQQ J;  2Q9I A;  2N1T B;  1OZH A;  1M7L A;  2A45 H;  4ZNC A;  2BEZ F;  3CCU P;  1LT9 B;  1IO4 A;  3V5B A;  5KJ7 C;  2ZYD A;  5APQ A;  1USE A;  3VOP A;  4RES B;  2YO2 A;  2WMM A;  5KLV G;  1YBK A;  2E43 A;  1JTH B;  2WS3 D;  1KQG B;  3RK2 B;  2FYU D;  3HE4 A;  5C3J C;  3L74 J;  1K9M Q;  1SQX G;  2R44 A;  1VQ7 P;  3KXD A;  1T2K C;  1FZB A;  4H0L C;  2WSE H;  1M57 D;  3L72 D;  3FXE A;  1BGY D;  3SWF A;  3CC4 P;  2ZT9 D;  3ABV C;  2W90 A;  3ITK A;  3TNU B;  1L0V D;  1K8A Q;  4H13 C;  1RE3 C;  4L74 A;  3CCR P;  2WP9 C;  3L72 G;  5CCH D;  4YXD D;  1JM0 A;  3BCC E;  1YQ4 C;  3ZDM A;  2R3C A;  2RN0 A;  4OGQ D;  2WSC H;  2WT7 B;  3I56 P;  3HTK A;  1VQ8 P;  1M1J A;  1PP9 E;  2I1J A;  1KFN A;  1IFM A;  1YJN P;  3KYQ A;  1N2D C;  2HPC A;  3CWB E;  2OYH C;  1USD A;  1QLE D;  2ACZ C;  3GLM A;  1URQ C;  3MP7 B;  3CL3 D;  4YSZ D;  2IYO A;  3G4S P;  1NU1 E;  1EDJ A;  3VRB D;  5CHX A;  2KNC A;  2H7H A;  1LTT C;  4YTN C;  3PRJ A;  2A45 I;  2BCC G;  2ZT9 C;  1SQQ G;  1JEK A;  1KQF B;  1VQN P;  1DEB A;  1SFC D;  2O01 H;  3RL0 g;  3CXH E;  1VF5 D;  3H1I D;  5H2F E;  1CI6 A;  4PD4 I;  2WQY D;  3EWK A;  2XKM A;  3AE6 D;  1RF1 C;  1SQX K;  4YTP C;  4GOF A;  2WPV B;  2ZT9 B;  5B66 E;  1AA0 A;  4YSX D;  5AW4 B;  2A06 E;  5CJ4 A;  1N73 B;  2Y0C A;  2CPS A;  3FWN A;  1DX7 A;  4D6T J;  4GDO A;  3P32 A;  2W6B A;  3CD6 P;  3JCU E;  4WY4 D;  2H89 D;  1J1E B;  2FYU E;  3V2P A;  1IK9 A;  3SFD C;  3H1H E;  3USS A;  1VQM P;  3SFD D;  1U7M A;  1BGY E;  4KX6 C;  2N9Y B;  3HUS A;  1SQB G;  3G6E P;  1L0L K;  2W83 C;  2O3J A;  3L71 D;  2P2U A;  3WUT A;  4C7N A;  1SQP J;  1KZU B;  2WDV D;  3D70 A;  2V7Q H;  3V6I A;  2Q1K A;  3E1I A;  1YHQ P;  3NFQ A;  3FWL A;  3M0D C;  3H1J J;  1T8Z A;  3LW5 H;  4HH2 A;  1L0N G;  5DJU B;  2QIW A;  3CCE P;  1LP1 B;  3H1K J;  4QMA A;  3WU2 H;  2FYN C;  4IL6 E;  1G1I A;  1HJ0 A;  2JP3 A;  1ZP0 C;  2L5G B;  3SSU A;  1W5C E;  1JY3 N;  3R4Y A;  1L0L E;  2YNY A;  3WUV A;  3GHG A;  1ZV8 A;  1S1C X;  2PRR A;  1DIP A;  2XNX A;  2FYZ A;  2R32 A;  1ZP0 D;  3CCJ P;  3CXH D;  4K35 A;  5TJH A;  5C2T D;  1NWQ A;  2WU2 C;  1FZA A;  2KS1 A;  2BS4 C;  3P7K A;  2ZYA A;  1SQP D;  3GW6 A;  3CCL P;  1Q82 Q;  1J1D C;  1NEN D;  2QJY C;  4RKU J;  1FC2 C;  2KK7 A;  3L73 G;  2JDI H;  1SFC B;  1TU3 F;  3VMX A;  1LTS C;  2G8Y A;  1N7L A;  2ZFC A;  4YXD C;  1LGH B;  2WDR C;  2QG4 A;  3C9I A;  4NPF X;  3AE7 D;  2QJK C;  3VRA D;  3B4S A;  3HE5 B;  1LJ2 A;  1N7S C;  3H1L D;  2PP6 A;  1L2P A;  1FZE A;  4KT0 J;  3ABV D;  2GUS A;  2WP9 D;  2MJZ A;  1SLQ A;  4Z1M H;  1H8A A;  3KQG A;  2YXQ B;  1HTL C;  3H25 A;  1KIL A;  2P67 A;  1AJY A;  2H88 D;  1P84 I;  1Y47 A;  1S9K D;  4WY4 C;  1NKZ B;  3VR9 D;  1G2C A;  2WU5 D;  1XTG B;  1Y9B A;  3U1C A;  4I6M C;  3A3Y B;  1FZC A;  2D2C D;  4GOE A;  1NTM J;  1YJW P;  5CJ0 A;  3IN6 A;  3L37 A;  2Y9Y A;  2HOD B;  4YTM C;  3AEF D;  3M0D A;  1L0N J;  1LNQ A;  5CCG C;  4O9B A;  1FJP A;  1KIL E;  2IDB A;  1URQ A;  1OFC X;  1ZR2 A;  3VMY A;  2KXP B;  1R8E A;  3A2A A;  3II6 A;  1L0L G;  2WZ7 A;  1NH4 A;  4DHI B;  3AE9 C;  3HD7 B;  1L0L D;  4PJ0 E;  2OGU A;  5AW6 B;  4HYT B;  3Q3D A;  1Q7Y Q;  2C0X A;  1VQP P;  2IBZ I;  3TDK A;  1YTZ T;  3CME P;  1SQB E;  2HR3 A;  2JWA A;  3L35 A;  3H32 B;  3VR8 D;  1SQV E;  2QRX A;  5APX A;  4H44 C;  3CMA P;  2OTK E;  4YT0 D;  5KLI C;  3CCS P;  3L73 J;  2OTL P;  1SP4 A;  2ZJS E;  5KAI E;  5KAI H;  3H1H J;  5CCH C;  1S4X A;  3MUD C;  4YSY C;  3SWK A;  3TF5 A;  1KF6 C;  2QJY B;  2JWD A;  1KF6 D;  4EIJ A;  1QL1 A;  3L70 J;  2B87 A;  5C39 A;  1EZV G;  1LTJ B;  4H0L D;  1SQV K;  3EFG A;  3GHG C;  2N1T D;  4DZO A;  2UWJ E;  3TGU J;  2FY8 A;  3EQ2 A;  1IK7 A;  1RQV A;  1PZQ A;  4H13 B;  3P4S D;  2IFM A;  1URQ D;  2BS3 C;  2FFD B;  4AUW A;  1BCC G;  2Q6Q A;  1NU1 G;  2YKQ A;  3BVH A;  5AVW B;  3CIR D;  4OWF A;  2XU6 A;  2IBZ E;  3WU2 E;  1SQQ D;  3HE5 A;  5K5G B;  1PFI A;  2C9N Y;  3HD7 C;  4Y99 B;  3CCV P;  4TLF A;  4W7Z A;  2JEE A;  3A7O A;  2KI7 B;  3P8C E;  3HRN A;  1LTJ A;  2NPS C;  1SQB K;  1S5L E;  1BCC J;  1JTH A;  4WY4 A;  2KLV A;  5TIS H;  4UB6 H;  1FDM A;  2PGD A;  3FX0 A;  1NTZ D;  3L75 E;  1J1D B;  1LWU C;  3AE2 D;  3VP8 A;  2QJP B;  1FOS F;  2Z5H A;  5KLV D;  3AEF C;  2IBZ D;  5E79 E;  1JY2 O;  1T2K D;  5KLV K;  4JPZ B;  2R5D A;  4I2L C;  4U3F E;  1YQ3 C;  1SQV J;  2E5T A;  1QEX A;  1YIJ P;  1AFO A;  3JCU H;  1KN7 A;  4RJT A;  1NKN A;  3U59 A;  2WIT A;  2ZXE B;  2KSJ A;  3L73 E;  3M9Q A;  3AEA D;  3V2Q A;  5KTB A;  5TIS E;  2YIU B;  2J5U A;  2G3A A;  1YI2 P;  1S5L H;  3A0H E;  1SQX D;  2ZVO B;  1N7S D;  1SFC C;  2YKO A;  1ZOY C;  1GTW A;  1L4A A;  3AEE D;  3V4Q A;  1Q90 D;  1X9V A;  3GMA A;  1ZN5 A;  3AE8 C;  2HFE D;  3TSI A;  1LTA C;  2E75 C;  1GL2 D;  3P4R C;  1NTZ J;  1GD2 E;  3AEC C;  2WSS H;  1ZLL A;  4N6J A;  5APS A;  1P84 H;  4GIF A;  4JYB A;  1RH5 B;  1P84 D;  2H8P D;  5AVS B;  1SQB J;  1GK6 A;  1VQO P;  1EZV I;  2WU2 D;  2FYN B;  1M1J B;  3AEB C;  3BRT B;  3P4S C;  1HBW A;  3LIE A;  2ZVN B;  3AEC D;  3AEE C;  1M56 D;  1NU1 D;  4I1L A;  5KKZ B;  3H1I G;  3NMD A;  3L74 E;  2W6J H;  3CPW O;  1JO5 A;  2FYU K;  4IL6 X;  5AW1 B;  4W80 A;  1KOR A;  4BWN A;  1FBM A;  3TGU D;  3RK2 D;  4U7J A;  1EDL A;  1CZQ A;  3H32 A;  3BAT A;  1NTK E;  1KYO I;  3S4R A;  2QJP C;  1PGO A;  3L70 D;  3L4F A;  4YTM D;  3AE1 C;  4RO0 A;  5GTH E;  1CSB A;  1XTC C;  1NTK D;  1EQ7 A;  3VMZ A;  1PIX A;  1QVG O;  3AEG D;  1RE4 C;  1NEK D;  3N4X A;  3PTZ A;  1VQ4 P;  1KMI Z;  1IFD A;  1JCD A;  1KYO H;  4IFD K;  2O1J A;  3L73 D;  1CW5 A;  3L70 E;  1AVY A;  1DD4 A;  2XZR A;  3CI9 A;  2A06 G;  2K9Y A;  3RK3 B;  1NTZ K;  1YIT P;  2WDQ D;  2AXT E;  2XV5 A;  4L73 A;  3L71 G;  1HUC A;  1PP9 G;  3PHL A;  3H1L E;  1AV1 A;  2Y0D A;  2WSF J;  3TK1 A;  4C46 A;  4R4M A;  1G2C B;  4LDT A;  2KIK A;  1QX8 A;  1FAV A;  3HD7 D;  3B71 A;  1NU1 K;  1NEN C;  4IFF A;  4N78 D;  1KIL B;  3L75 D;  3CIR C;  2LKM A;  5CCG D;  5CBO A;  4GKG A;  3HUS C;  2N1T C;  2VRS A;  1OMI A;  3R2P A;  2QJK B;  1M1J C;  3CWB G;  1D7M A;  1PPJ E;  1L0N D;  2FXO A;  2HYN A;  2Z4E A;  4BXL A;  4W7Y A;  2B87 B;  2K1A A;  1RE3 A;  2O1K A;  1FZF A;  1SQV D;  2RMZ A;  4Y28 J;  2N9B A;  5AW5 B;  2FXM A;  3A0B H;  1SQV G;  2ACZ D;  3CX5 I;  1IFI A;  2IZ1 A;  1KFM A;  1KQS O;  3O6Q B;  1MFT A;  1S72 P;  1X0T A;  1ZR4 A;  2QM7 A;  2BEQ D;  5AW8 B;  1N73 A;  4BRY B;  4MN4 C;  3M91 A;  5B5E H;  3MGN A;  4LC1 A;  1FDO A;  1A02 J;  5GTI H;  1NTZ E;  3I55 P;  4H0L B;  4OGQ C;  2WTY A;  1PGQ A;  1OWA A;  2W8Z A;  2RKL A;  2FBW C;  3CX5 E;  2CK3 H;  1KFY C;  1Q86 Q;  1CI6 B;  5APT A;  1ZRT D;  2AEF A;  1GDT A;  1KB9 D;  1SQP E;  3H1K E;  5C2T C;  4OGQ B;  1JB0 J;  2OYH B;  1DEE G;  4HJG H;  4UB6 E;  5BU8 B;  1EXI A;  2KNC B;  2H89 C;  5AVQ B;  4R4L A;  1KYO D;  4YXW H;  2K9J B;  2WDQ C;  3OA7 A;  1LT1 A;  2V4H A;  3H1L G;  1MFZ A;  4C7R A;  1FU1 A;  3UIA A;  3QH9 A;  1DH3 A;  1SVF A;  3BAS A;  3AE5 C;  3FGA D;  4EOT A;  2AXT H;  2E75 B;  1JMM A;  2B76 D;  1K04 A;  5KJ7 D;  3IR9 A;  1VPC A;  3AEG C;  2M8R A;  1JY3 O;  1FDI A;  3E1R A;  3VON A;  2WT7 A;  4Y99 C;  4NPD A;  1N7S A;  4PD4 H;  3V2N A;  3G3Z A;  3P8M C;  1KYO E;  3H1H D;  5CBN A;  3H1J D;  3PP5 A;  2P10 A;  1IFN A;  2H88 C;  2K88 A;  3L36 A;  1GW3 A;  3MZW B;  3SWY A;  1E5W A;  1NTK G;  1E7P C;  2GUV A;  5KJ7 A;  1MKM A;  3H1J E;  3B5N C;  3VRA C;  2A45 G;  2LR2 A;  4TT3 H;  2ITA A;  3RL0 B;  4ZKP A;  2IFN A;  3AEB D;  2W27 A;  3L74 G;  3V2R A;  2KZI A;  5B66 H;  3VR8 C;  4XA4 A;  2OAR A;  4CPG A;  1SQP K;  1NOH A;  1IC2 A;  1H89 A;  1X79 B;  1WT6 A;  4K3A A;  3F89 A;  1L0L J;  2AEM A;  4D6T D;  4YTP D;  1H0T A;  4H13 D;  1VQ9 P;  1URQ B;  4EDF A;  1X22 A;  2NRG A;  1KB9 E;  3I5C A;  5AVZ B;  1BE3 E;  2YKP A;  2J59 M;  4WBA A;  1WRG A;  4DDG A;  1LTI C;  3CX5 D;  2HG5 D;  2WPS A;  3H1I J;  2C9L Y;  3KZI H;  2YXR B;  5C3J D;  4IFM A;  4IOI H;  2WS3 C;  3Q1M A;  3L75 G;  1NVO A;  3AEA C;  4UB8 H;  1ZRT E;  5CCG A;  3A0H H;  4JBZ A;  2IYP A;  1RF0 C;  1L4A D;  1LP1 A;  1LTG C;  3MHV A;  1NGM B;  3NXS A;  2E42 A;  1VDF A;  3HD7 A;  2Y0E A;  2FXP A;  1HJB A;  3OW2 O;  2WDV C;  1KQL A;  3H1H G;  1YYC A;  3KZI E;  2QEX P;  1BDD A;  1NTZ G;  3RK3 C;  1VQ6 P;  3Q2Y A;  2KUB A;  1SFC A;  3HUS B;  4WB4 A;  5H2F H;  1PL5 A;  3IF4 A;  3RK3 E;  1S3J A;  1Z56 A;  2M3B A;  3P4P D;  3AE7 C;  2QA4 P;  4I7Z C;  2H43 A;  5AW3 B;  1KD1 Q;  2NPS D;  5AVY B;  3VMA A;  3WMM 0;  2OYI C;  3RK3 D;  2LXB A;  1EDK A;  1OW8 A;  5CCH A;  1MZ9 A;  5AW7 B;  2WPQ A;  2Q5U A;  3A5T A;  2WSF H;  1PPJ G;  3O8Z A;  3L72 J;  5KAF H;  3VYI A;  3D6Z A;  5EFW B;  1SQQ E;  3H6P A;  1HWT C;  3H1K G;  2IBZ G;  3L74 D;  1VF5 C;  1Q2N A;  1X8Y A;  3GF3 A;  2E74 D;  1EZV D;  2O01 J;  2D2C C;  3VN0 A;  2XDJ A;  2OYO A;  1P84 E;  2HLO A;  5AVR B;  5AVU B;  5APV A;  4B86 A;  3H1K D;  1RF1 A;  1OW6 A;  2A06 D;  2E74 C;  3O6Q A;  1HH0 A;  3RGU A;  2R3S A;  1BCC E;  4KHX A;  2E76 C;  4N78 E;  3LW5 J;  2ZXX A;  1EZV E;  3MD0 A;  1T3U A;  2E5Y A;  2HPC B;  3TYY A;  3L71 J;  3GHG B;  4WY4 B;  3MIW A;  5AW2 B;  1PV3 A;  3B8E B;  2OQQ A;  1QLB C;  3HTK B;  4GOD A;  5KKZ C;  2IX7 C;  4LGD E;  1GU5 A;  4DCK A;  3MTU E;  1U57 A;  4U3F J;  1VL2 A;  3RL0 D;  3FXD A;  2KP8 A;  1OXZ A;  3SFE D;  4H44 B;  3CWB J;  1YQ4 D;  1L4A B;  1VQL P;  3JSV C;  1FZC C;  1RQU A;  2BAS A;  2FFD A;  2FKW B;  4FJV A;  3F5H A;  2GA1 A;  2KSE A;  5KLV E;  2IZ0 A;  3T97 B;  3TGU E;  3K5B A;  1L0N K;  2M3E A;  4JF7 A;  4NPE A;  2YMY A;  3AE9 D;  3L72 E;  3Q5P A;  1YQ3 D;  3AE3 C;  4AYC A;  3HE4 B;  2B76 C;  1JNM A;  1IZN B;  5AVV B;  3H1I E;  1NO4 A;  2L91 A;  1N86 A;  1E79 H;  2AEJ A;  2WSE J;  2Q7C A;  3M9B A;  2WQY C;  1OIP A;  1JMB A;  4DDI A;  1KTM A;  1PGJ A;  1M1K Q;  4OVN F;  3B5N A;  2Q3I A;  1RE4 A;  1WMK A;  5BVZ A;  3AE4 D;  2YO3 A;  1MV8 A;  3D71 A;  2FFD C;  3P4Q D;  1LT9 A;  4KJM A;  2WU5 C;  3L75 J;  1OVU A;  2B88 A;  3VR9 C;  3A0B E;  5CMZ A;  4YTN D;  4PV1 C;  5KLI B;  1GK4 A;  3VRB C;  5M1B A;  5APY A;  5GTH H;  3S9O A;  1W2B O;  3WUU A;  2POH A;  3G71 P;  1VQ5 P;  4ZKU A;  1PP9 D;  2AXC A;  4DHJ A;  1BE3 G;  2I1K A;  4OH8 B;  4IL6 H;  4PD4 D;  4PV1 B;  2P1J A;  5E79 H;  1NEK C;  1J2J B;  5KAF E;  3S1K A;  5AVX B;  3GG2 A;  4I7Z B;  2WSC J;  1JOC A;  1GL2 C;  1HVV A;  2KB7 P;  3BRV B;  4YSX C;  4LLH A;  1GU4 A;  1BGY J;  1AVO A;  2BCC J;  1H0T B;  1NTK K;  4U3F G;  1L0V C;  1L0N E;  1NTK J;  2K3R A;  1GZL A;  1JCC A;  2FYU J;  2I8D A;  3P8C D;  4AQR D;  3RK2 C;  4DHZ A;  1GL2 B;  2WWW A;  2GM4 A;  1NTM E;  1H88 A;  2RH0 A;  2OYI B;  4GT1 A;  1LWU B;  2SPZ A;  2KZJ A;  4PD4 E;  1T3J A;  1AQ5 A;  1NJI Q;  2DW3 A;  3TGU G;  3D6Y A; 
#chains in the Genus database with same CATH homology
 2G3A A;  1IK7 A;  2ACZ D;  4YT0 C;  1RQV A;  2E74 C;  2V7Q J;  3O6Q A;  1NEK D;  1ZP0 D;  1R8E A;  1KTM A;  1NGM B;  4H44 D;  4H13 B;  5L8R J;  1ZOY C;  2ZT9 D;  3ABV C;  3P4S D;  1K05 A;  1UIX A;  1WMK A;  2E76 C;  1ZME C;  3AED D;  3AE4 D;  2FXP A;  5C2T D;  2P10 A;  3D71 A;  2BS3 C;  1KMI Z;  3LW5 J;  1HF9 A;  2WDV C;  2WU2 C;  2WDR D;  1Q90 D;  3AEE D;  3AE5 D;  3P4Q D;  1DD3 A;  3AE9 C;  3GMA A;  2H88 C;  3AE8 C;  2D2C B;  1L0V D;  2WU5 C;  3P4P C;  1NYH A;  4GDO A;  4H13 C;  3VR9 C;  2MKV A;  4KX6 D;  1DD4 A;  2BEQ D;  2BS4 C;  4YTN D;  2E75 C;  2K9Y A;  4PV1 C;  2H89 D;  2WP9 C;  3CIR D;  3P4R C;  4YXD D;  1E7P C;  1FDO A;  3AE2 C;  3Q3D A;  1NEN D;  3AEC C;  2NZ2 A;  2WDQ D;  3VRB C;  3Q2Y A;  2QJY C;  4RKU J;  4H0L B;  1YQ4 C;  5M1B A;  4OGQ C;  3AEG D;  1MKM A;  3S9O A;  4OGQ D;  3SFD C;  3G9R A;  3SFE C;  2QSI A;  3VRA C;  4TT3 H;  4YSZ C;  2FBW C;  1PL5 A;  2FBW D;  1PV3 A;  3RK3 E;  1S5L X;  2E76 B;  3SFD D;  1TU3 F;  2OQQ A;  4KX6 C;  1KFY C;  1QLB C;  2WSF J;  3P4P D;  2G8Y A;  5KKZ C;  3AEB D;  1VF5 B;  3AE7 C;  4YXD C;  3VR8 D;  2WDR C;  4I7Z C;  3P4Q C;  2WU2 D;  3VR8 C;  4R4M A;  3AE4 C;  3AE7 D;  2E76 D;  2QJK C;  1U57 A;  3AEB C;  1GMJ A;  3P4S C;  1VL2 A;  4PV1 B;  4OGQ B;  1JB0 J;  3SFE D;  3VRA D;  5C2T C;  4H44 C;  1KFY D;  3GF7 A;  4H44 B;  1YQ4 D;  1OW7 A;  1NEK C;  3B71 A;  4YT0 D;  2ACZ C;  2BEZ F;  5KLI C;  4I7Z B;  3AEE C;  3Q5S A;  3GLM A;  3D70 A;  1NEN C;  2WDV D;  3AE2 D;  3AEC D;  4KT0 J;  4YSZ D;  3ABV D;  1EXI A;  2WSC J;  1ZOY D;  1RQU A;  2H89 C;  4PV1 D;  2WP9 D;  1OW8 A;  2E75 D;  4R4L A;  3CIR C;  4YTP D;  4Z1M H;  4H13 D;  3H25 A;  2WDQ C;  4YSX C;  3VRB D;  3AE8 D;  1AJY A;  2H88 D;  2E74 B;  3C8V A;  4XFJ A;  3AEF C;  3T97 B;  4IL6 X;  3P4R D;  4YTN C;  4YSY C;  1KOR A;  2ZT9 C;  2YMK A;  1OMI A;  3VR9 D;  3Q5R A;  4U7J A;  2QIW A;  1L0V C;  2WU5 D;  3D6Z A;  1KF6 C;  3AE9 D;  3AE5 C;  3FGA D;  3AE3 D;  1Y9B A;  3Q5P A;  2FYN C;  2JO1 A;  1YQ3 C;  2E75 B;  3AED C;  1KQF B;  1YQ3 D;  1VF5 C;  2D2C D;  3AE3 C;  1HJ0 A;  2JP3 A;  1KF6 D;  3GF3 A;  2B76 C;  2B76 D;  1K04 A;  2QJP C;  3RL0 g;  1ZP0 C;  2E74 D;  2O01 J;  1VF5 D;  2D2C C;  3IN6 A;  5C3J D;  4YSY D;  3AEG C;  3R4Y A;  2WQY D;  3EWK A;  2WS3 D;  2WS3 C;  4YTM D;  4YTM C;  1EXJ A;  3AE6 D;  3AEF D;  1FDI A;  3IAO A;  1KQG B;  3AE1 C;  4H0L D;  3Q1M A;  5C3J C;  3AEA C;  1ZRT E;  3D6Y A;  3AEA D;  1KIL E;  2IDB A;  4Y28 J;  2BS2 C;  4H0L C;  3AE1 D;  4YTP C;  2WPV B;  2ZT9 B;  3AE6 C;  1S1C X;  2WSE J;  1DIP A;  2WQY C;  2YIU C;  1PIX A;  1OW6 A;  2J5U A;  4YSX D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...