3AEAC

Crystal structure of porcine heart mitochondrial complex ii bound with n-(3-dimethylaminomethyl-phenyl)-2-trifluoromethyl-benzamide
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 47
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3aeaC01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3aeaC02
1YQ4D 2ACZC 1OW6A 1ZOYC 4YTPD 5C2TD 3SFDD 3P4PD 3AEEC 2WDQD 1L0VC 2WQYD 3VR8D 3VRBD 2WU2D 4YT0D 1E7PC 5C3JD 1ZP0D 2H89D 2WP9C 3P4SD 4YTMC 1NEND 3AEDC 3AE2C 1KTMA 3AE7D 3P4QC 3VRAC 1NEKD 3AE9D 3AE4D 2FBWC 2B76C 2WDVC 2WU5C 1YQ4C 4YSZD 3AE6D 2H88D 5C2TC 3SFDC 3ABVC 3P4RD 2WS3C 3AE1D 2WDQC 1KFYD 2WDRD 3AEBD 1QLBC 1YQ3D 3AECD 3AEAC 3AE8D 3VR8C 3VRBC 3AE3D 4YXDC 4YSYD 1K04A 1OW8A 3CIRC 3SFED 1KF6D 4YSXD 1ZOYD 3AE5C 2G3AA 3VR9D 2H89C 3AEED 1L0VD 3AEFC 3P4SC 2BS2C 4KX6D 2BS3C 4YTNC 3AEGD 3AE9C 3AE4C 4YTPC 3P4PC 3S9OA 2H88C 2WQYC 3AE2D 3AEDD 3P4RC 3P4QD 2WDRC 3VRAD 3AECC 2WU2C 3AE8C 2ACZD 2FBWD 4YT0C 5C3JC 4YSYC 2B76D 2WDVD 2WU5D 1ZP0C 3SFEC 1KF6C 4YSXC 3ABVD 3B71A 3VR9C 2WS3D 1NENC 3AE7C 3AEAD 4KX6C 1NEKC 4YXDD 3CIRD 3AEGC 3AE5D 2WP9D 4YSZC 3AE6C 2BS4C 4YTMD 3AEFD 3AE1C 1KFYC 3AEBC 1YQ3C 4YTND 3AE3C 1OW7A 1PV3A 1K05A
chains in the Genus database with same CATH superfamily
1FOSE 1LTJB 3SFDD 2AXCA 3PHLA 2WZ7A 2O1KA 2IX7C 4C7NA 2WU2D 2H7HA 2W27A 1LWUB 1NHLA 2AXTH 5KAFE 1VQ6P 2YXQB 1FZCB 1LTSC 1BCCG 2QJYC 2B76C 2I1KA 3AE6D 3O6QB 3SSUA 3P4RD 1Q2NA 3L73G 3AEAC 1RF1A 1FAVA 1N7SA 3WUUA 2ZYAA 2KLVA 1KQSO 2G3AA 3K5BA 3P8MC 2QEXP 1GK6A 3CWBD 1TFFA 3VP9A 1IK7A 1RF1C 1N7SC 3CX5H 2K9JA 3RBZA 3BCCD 1P84D 2E5YA 1CSBA 3BRVB 1VF5D 3QH9A 2HLOA 2W83C 4YSYC 1ZXGA 2WPSA 5EFWB 4H13B 3HD7D 1H89A 2A06G 1FOSF 2BCCG 2GA1A 2E75D 4N78E 1GTWA 3E7KA 4JQ0D 5APYA 3RK3D 1SFCB 2Q3EA 1YQ3C 4NPFX 4YTND 2QG4A 2P10A 4DDIA 5KLVD 1IO4A 4QMAA 1ZOYC 1VDFA 3AEEC 1JY3P 3R2PA 1L0VC 1IFMA 1JMBA 1SQXG 3UIAA 3KZIE 1CZQA 2KUBA 4UB8H 4MN4C 2WP9C 2NPSA 2WPVB 1L4AA 1KYOD 1S4XA 1SQBE 3LIDA 5B5EH 3PLNA 4PD4I 1CW5A 3HTKA 2YIUC 1KILC 4D6TD 2Y9ZA 2NPSC 1A02J 1IFJA 3VR9D 1L4AC 1G1JA 2WSCJ 4HKZH 5DJTB 1P84H 1J1EC 1SQVE 4H44C 4EOTA 3T97A 5E79H 1EZVI 1QVFO 1W2BO 3L72D 4K35A 1NKZB 2PRRA 1FU1A 2WU2C 4I7ZB 1NTZG 3OAKA 4EYYQ 1LTJA 2IBZG 3CCJP 3CXHE 1H88A 1N8RQ 2A45H 3B71A 1HTLC 2QVAA 4H0LB 3B5NB 5GTHH 5AVWB 3TGUE 3KDPB 1SQPJ 3BATA 4PV1C 1LWUA 1NTKK 1HWTC 3AE6C 1BDCA 4YTMD 4IOIH 2Z4EA 4HB1A 3V2RA 3NFQA 1FZCA 1LTJC 1ZR2A 1QL1A 3H6PA 3RK2D 3CX5I 3O6QA 1LWUC 4HJGH 2W6JH 1NKNA 4Z1MH 2B9BA 3B5ND 3HRNA 1KYOH 1FZCC 3A2AA 1L0LE 3TF5A 2WSEH 2XNXA 3CCQP 1KTMA 1NEKD 1VF5C 3CC2P 1EC5A 3Q5SA 2H88D 3HD7C 1VPCA 1SP4A 3AE1D 2WDQC 2E75C 1K04A 4L74A 3H1LG 3A5TA 1GW4A 4ZNCA 1FDOA 4KX6D 1EDLA 3L71D 4YTNC 3WUVA 1VQMP 1L0NK 2W6BA 3CC4P 1SFCA 1NU1G 2FYUJ 1ZV8A 3Q2YA 2P1JA 4OGQB 3EFGA 4UB6E 1T3UA 3O8ZA 2WS3D 1NOHA 3TSIA 2FYNB 1SFCC 2ZVNB 2WT7B 3CIRD 4R4LA 5CCHD 4RJTA 1WRGA 3PRJA 1P84I 3H1ID 1HGZA 1NTKD 1YQ4D 1GU4A 4ASWA 1AA0A 5AW2B 3H1HJ 2ZXEB 2K88A 3A0BE 1ZR4A 3BCCG 5AVTB 1BGYG 1NTME 2A45I 3WU2E 3L70J 2C0WA 2IYOA 3AE9D 1SQQJ 2YNYA 2HFED 3VMYA 2H43A 2PAJA 1VL2A 3A0HE 1RQVA 5GTIH 1IK9A 4DDGA 1PPJD 3U1AA 4YSXD 3KYQA 1LTAC 1PGQA 2R32A 3C1LA 5KLVG 5C39A 2XNDH 3V2NA 1LNQA 1WT6A 1KYOI 3RK2C 4U3FE 1VQ7P 3L74E 4I7ZC 1L0ND 1VQPP 1YTZT 1LJ2A 3P32A 4H0LC 4LC1A 3B5NC 4YPCA 3MTUE 1GU5A 3GHGB 4DCKA 3L75E 2Y0DA 1NEKC 4U3FG 1USEA 3H1JE 2XV5A 5AW0B 3AE1C 3QWOC 3JC22 4PJ0E 1OX3A 4M3LA 1FJKA 3B8EB 3N7NA 3OA7A 1S9KD 1E7PC 1GDTA 1KB9I 5AVUB 5L8RJ 4WBAA 4B86A 3FXDA 1JY2P 3G6EP 3G71P 2ZYDA 5APXA 4YSZD 4GT1A 3D6ZA 1FC2C 1KFMA 1RF0A 5AVZB 2N1TB 2WS3C 5AVXB 2POHA 4YSYD 3CIRC 1JOCA 1JB0J 1BE3G 4HH2A 3V5BA 3VONA 1PP9E 3P4SC 2ITAA 2Q7CA 2MJZA 2OYHB 1RF0C 1J2JB 2WT7A 1Y9BA 2OYOA 2FFDB 2RKLA 3FWLA 2PGDA 3FXEA 3I55P 1OVVA 1SLQA 5APTA 1RE3C 1VQOP 3H1KE 2FYNC 4DHIB 2WP9D 3Q5PA 3RBXA 4IL6E 3ITKA 1SQBJ 1T2KC 1S5LE 3L71G 1M90Q 3HE5B 2KSEA 2JR8A 2D2CD 1L4AD 3VN0A 1UIIA 4GKGA 1IFDA 1SQVJ 5AW6B 2KYVA 3N4XA 4LDTA 1NTMK 1BCCE 5C2TC 2N9YB 3I5CA 1LTTC 5CJ0A 3VR8C 3L73E 2M0BA 3VMXA 2Q5UA 2Z5HA 1KMIZ 3EFFK 3H1IG 1EDKA 1PZQA 2NRGA 2Q6QA 3GHGA 2BEZF 1OMIA 3TGUJ 1FZFA 1SQPK 3BVHA 4PV1D 5TISE 1OZHA 1MV8A 1J1DB 1UIXA 2IDBA 1KFNA 2KZIA 3VYIA 1EDJA 1M56D 2KI7B 2JKVA 5CCGA 2WDRC 2YO3A 5CHXA 1YTZI 3PJSK 4L76A 1DD3A 2J59M 2WITA 3PP5A 2MKVA 4N6JA 2B87B 1GK4A 2A06E 3PH0A 2BCCE 2HG5D 1L0LJ 2V7QJ 2JEEA 3V6IA 4WWIA 4YSZC 2QJKB 1PPJG 2O1JA 3W67A 3FX0A 3SWYA 3AEFD 2Q9IA 1RQUA 1KQFB 2FXMA 3MD0A 3P8CE 1N73B 2M3EA 5H2FE 2WDQD 2N1TA 1RY3A 4O9BA 1KC8Q 1SQXE 3RGUA 2NZ2A 1L0NG 5AW8B 1IFNA 3E1RA 1PFIA 3L36A 3G9RA 2OYHA 2N1TC 4RKUJ 2FFDA 2K9YA 1JCDA 2IZ0A 1U7MA 2I8DA 4H13D 2FYUK 1NTMD 4JYCA 5KLIB 3OW2O 1NAYA 3AE3D 3I56P 3MZWB 5KAIE 2OYHC 2FFDC 1IFPA 3KQGA 1SFCD 2M5AB 2Q3IA 5AW9B 2BASA 4PD4E 3CCSP 1KV4A 1IC2A 2WPQA 3P7KA 1SQPD 2HYNA 4KT0J 1M1KQ 2WU5D 1NTZE 2D2CC 2ZT9B 3VMZA 1KF6C 2ZXXA 2IBZE 1FDIA 3H32B 4A7PA 1EZVE 3B4SA 5K5GB 3HE5A 2AXTE 1NTMJ 3CC7P 3CCRP 3AE5D 4BRYB 1MFTA 2BEQD 1LTBC 2GUVA 1SQQK 3SWFA 1E79H 3MP7B 4IFDK 3CPWO 1VQ4P 1OW6A 1EZVG 1OFCX 4FJVA 2KNCB 2VRSA 3Q3DA 1S72P 1QVGO 3M9HA 4YT0D 2RMZA 4LGDE 2WSCH 1YITP 1KB9D 2ZFCA 2P67A 1K8AQ 3LIEA 2M3BA 3CXHI 3CX5E 2QA4P 3WU2H 3CL3D 4U3FJ 3L74J 5APUA 1GZLA 3LW5J 1OXZA 1FDMA 4AQRD 3CCEP 1KILE 1KFYD 4IL6X 3EQ2A 4H0LD 5B66H 1KQGB 4AYCA 3H1LE 2FYUD 2IFNA 4I6MC 4BWNA 1S5LX 3AEFC 1URQB 3L75J 2B87A 1J1DC 3H1JJ 3AE4C 2OARA 3CCVP 1NU1E 2L91A 2ZYGA 4AUWA 1NWQA 3CD6P 4Y99B 4KHXA 3AE8C 2ZFYA 2OTLP 5AVYB 1N73A 2O01J 2FY8A 3C8VA 2R5BA 2QJKC 3H1HD 4UB8E 4ASVA 1URQD 3AEGC 1TU3F 2W6AA 2OYIB 3IAOA 2WSFJ 4OVNF 3MHVA 4H13C 3M0DA 5B5EE 1LT1A 3AE3C 1YI2P 1SVFA 1N73C 1DH3A 3L70D 1ZRTD 1R8EA 3WMM0 1KB9H 2YKPA 1SQQD 5APSA 4C46A 3P4PD 3CWBE 1X9VA 4L75A 4XA4A 1MKMA 1NYHA 3L35A 3BCCE 2SPZA 3M0DC 1BGYE 1JNMA 2O01H 1PP9J 4GOEA 3P4SD 4ZMDA 5E79E 3V4WA 2M5AA 1SQXK 1EXIA 1G1IA 2KS1B 3D71A 3MGNA 2WU5C 3CWBG 5KKZB 4OGQD 1QLBC 1OW8A 3RK3E 1LT9B 5AVQB 3H1KJ 3AE5C 5BU8B 3M06A 5GTHE 2FXOA 2H89C 3H32A 5KLVE 2Z5IA 3M91A 4JF7A 1VQ5P 2OTJP 2E74B 1YYCA 4BRYA 4WB4A 1AQ5A 2A45G 3KXDA 1IJDB 3AEDD 2QRXA 1SQBK 5AVSB 3P4QD 1T2KD 3VRAD 3AECC 2FBWD 4YT0C 2DW3A 2IZ1A 2WDVD 1FE6A 2KOGA 4TLFA 3TYYA 4DHZA 2KNCA 1SQVK 4DT0A 4D6TE 1KFYC 3JCUH 4I6LA 1OW7A 1BCCJ 3FWNA 2GUSA 5C2TD 1JMMA 3IF4A 2C0XA 2WQYD 3L73J 3VR8D 4RO0A 1S5LH 2J5UA 4N3YB 4L73A 1SQPG 1ZP0D 4D6TG 3ZDMA 1URQA 1M1JB 1NJIQ 1A02F 2WWWA 3NXSA 4N78D 5AW3B 2YKOA 2P2UA 1SQXD 3L72G 2WDRD 3NTNA 3GF3A 1URQC 1XTGB 2UWJE 1BE3E 1X22A 2BCCJ 1PGPA 2LKMA 1L0LK 1OVUA 4DZOA 5KAFH 5CCGD 1SS1A 2Q1KA 3A3YB 2OYIA 3P4PC 3VTPC 2ZAEB 5CMZA 1AQTA 1S1CX 1SQBD 1NU1K 1JY3O 1SQXJ 3GF7A 2OYIC 1QL2A 1DEEG 4OGQC 1W5CE 4U7JA 3G3ZA 2M8RA 1LTGC 2IFMA 4DOJA 2N1TD 2FYUG 2KS1A 4CPGA 2ACZC 3H25A 1SQVD 3L71E 3V4QA 1LP1B 3PTZA 4C7RA 2R3SA 1FZEA 1USDA 3R4YA 1LT9A 1VQLP 2JWDA 4XFJA 1OVRA 1KILB 2H8PD 3CXHD 2QM8A 3AEDC 1U57A 3P4QC 3RL0B 3MUDA 5KKZC 3VRAC 2CK3H 2FBWC 1ZN5A 2WDVC 2WSSH 1PGOA 3IR9A 3TGUD 3H1HG 2K37A 1BDDA 1Y47A 4H44B 1EDIA 1LT9C 3OJAB 3AEBD 1GW3A 2QIWA 1NTZJ 3L37A 1Q86Q 1KF6D 2L5GB 3MUDC 1HGVA 3H1IE 3KZIH 4JPZB 1NTKE 4GIFA 1MFZA 1YBKA 2E74C 1SQQG 1M57D 1NVOA 5KAIH 3NMDA 3RL0D 2FKWB 1X79B 3S9OA 2WQYC 1L0LD 1D7MA 4EI2A 1N86A 3FGAD 3HUSB 1NTKG 1ZP0C 2YMYA 5AW1B 2RN0A 1KN7A 1FBMA 1R5SA 1FZGA 2YO2A 5AVVB 1NU1D 3KHUA 3G4SP 3V2PA 1PPJE 1M1JA 2CPSA 1VQ9P 3GHGC 4YTPD 1M8OB 1Q90D 1ZLLA 1AFOA 3CCMP 1VF5B 2IYPA 3E1IA 1GL2B 1EQ7A 1OWAA 3CXHH 1N2DC 3HD7B 5CCGC 1M1JC 3H1LJ 4DHJA 2P58A 2E75B 1L0NE 5AVRB 1Q81Q 3CCUP 1NEND 1U7JA 2E5TA 3AE4D 3RK3B 3TDKA 3CI9A 3F5HA 1K9MQ 1NU1J 3C9IA 2G8YA 2YMKA 5AW4B 1HUCA 5AW7B 3AE8D 3GG2A 1BGYD 3VRBC 2R3CA 5APVA 1RHZB 2WTYA 1GL2D 4K3AA 1YJNP 1NAFA 2IPPA 1CI6B 1RE4A 2V7QH 3TK1A 3AEGD 1AVYA 2CPBA 3M0AA 2OTKE 3M9QA 1S9KE 2GM4A 3GW6A 3BRTB 4W7ZA 2LR2A 1RE4C 1JM0A 1KD1Q 3JSVC 3SFEC 3CWBJ 1LP1A 3BCCJ 1BGYJ 2I1JA 3VOPA 2FYZA 2WVRA 1KILA 4W80A 3AEBC 2B88A 3IN6A 1S2EA 1H8AA 1K73Q 1KZUB 4U3FD 1LGHB 3L74D 4BXLA 1Q82Q 1JEKA 4UB6H 2E42A 3BASA 3VMAA 1DEBA 1VQKP 3RL0C 2C9LY 2H89D 2N9BA 3EWKA 5KLVJ 4NPEA 3AE7D 1E5WA 1SQBG 2IBZI 1HVVA 1W2EA 3L75D 1X8YA 3CCLP 3SFDC 3II6A 1RH5B 3H1JD 2ZT9D 5BVZA 3AECD 2O01N 3RK2B 2Y0EA 2C9NY 1OIPA 3HUSA 1XTCC 3A0BH 5BU5A 1JY3N 2WSEJ 1SQVG 2BS3C 5CBOA 2YKQA 2Y0CA 4YXWH 4YTPC 4Y28J 1FZBA 2QJPB 4D6TJ 5CBNA 3VP8A 3AE2D 3P4RC 3HUSC 2YXRB 1BE3D 1WMKA 3S4RA 4GOFA 1KORA 3A0HH 1IFIA 2OGUA 1GL2A 4I2LC 1NENC 3L72J 3TGUG 2KZJA 3HD7A 5KJ7D 1VQNP 4KJMA 4OWFA 3W68A 1EXJA 1PP9D 3LW5H 1GL2C 1JY2O 2LXCB 1YJ9P 1DIPA 1HF9A 3TNUB 2O3JA 2ZJSE 1YJWP 3A7OA 4EDFA 4ZKPA 2HPCB 1QLED 2P7JA 5C3JD 1L0LG 1BE3J 1CI6A 3RK3C 2XZRA 3H1KD 1ZW0A 1R5LA 2E43A 3V2QA 1QGKB 3CMEP 2QSIA 3MIWA 2KXPB 3U1CA 4PJ0H 4XE5B 5AW5B 3F89A 1NGMB 1T3JA 3SWKA 2E76B 2KSJA 3HE4B 2B89A 1P84E 2XU6A 4HYTB 2K1AA 2HR3A 2BS2C 3Q5RA 4TT3H 2PP6A 2WSFH 5KLIC 1N7LA 3GLMA 2ACZD 4WY4B 1S3JA 1JTHB 3CLQA 2HODB 4NPDA 3L71J 1Q7YQ 5KTBA 1VQ8P 1G2CB 3ABVD 3VR9C 5M1BA 1BCCD 2E76D 3RL0g 3WUTA 3AE7C 4YXDD 4IFMA 1DD4A 3L73D 1KQLA 1H0TB 1L2PA 2W90A 2KB7P 2ZT9C 2OQQA 1FZAA 1PIXA 1M7LA 4IFFA 2AEJA 2AEFA 1KYOE 4WY4D 5B66E 1AV1A 1NTZK 2AEMA 5TJHA 4ZKUA 1NTMG 1Z56A 3H1IJ 2J58A 1NTKJ 1SQPE 2RH0A 4YTMC 1HJBA 2E74D 2JP3A 3AE2C 3L4FA 3B5NA 1GMJA 5KJ7A 4IL6H 2A06D 1NO4A 2BCCD 1DX7A 2QJYB 4R4MA 4C7NB 3L72E 1AVOA 1T8ZA 4OH8B 5KJ7C 3P8CD 5CJ4A 2QJPC 1ZMEC 1YHQP 3S1KA 2WMMA 2R44A 3L74G 3CMAP 1AJYA 2H88C 5DJUB 2KP8A 2FXPA 1RF1B 1N7SB 1KB9E 2K3RA 1BSHA 5C3JC 3IFMA 2B76D 2QE7H 2KLUA 3TNUA 1GD2E 1PGJA 3L75G 1NH4A 2QM7A 3AEAD 4KX6C 2HPCA 3H1JG 1HH0A 1QX8A 4RESB 1L0NJ 1MUUA 4Y99C 4EIJA 2BS4C 2K9JB 1JUNA 5TISH 5APQA 2R5DA 5CCHA 3KPEA 2FYUE 1N7SD 3D6YA 3Q1MA 4PD4D 3VRBD 4DJGA 2JJLA 2XDJA 2LXBA 2XKMA 3HE4A 4GDOA 4JBZA 2PFXA 2V4HA 1BSNA 2ZVOB 4LLHA 5CCHC 1JO5A 1NTZD 2IBZD 1QEXA 1RE3A 1EZVD 5GTIE 1YQ4C 1FS0E 2JWAA 3ABVC 4WVZA 2E76C 3H1HE 1YQ3D 2Y9YA 4GODA 4YXDC 3D70A 5H2FH 4JYBA 4WY4A 3SFED 1JTHA 1ZOYD 2JDIH 2HODA 2KIKA 2YIUB 1G2CA 1PP9G 3AEED 5APWA 1L0VD 2NPSB 3L70E 1ZRTE 2D2CB 1L4AB 3AE9C 1SQQE 3JCUE 3M9BA 1J1EB 1H0TA 1HBWA 4WY4C 3U59A 2KK7A 3HTKB 1JCCA 1JY2N 2JO1A 3H1KG 3CX5D 4YSXC 3L70G 4W7YA 4I1LA 1MZ9A 3GMAA 1LTIC 2WPRA 1KILD 2W8ZA 3T97B 2NPSD 1YIJP 3USSA 1T6AA 1FJPA 1Y8AA 5KLVK 1HJ0A 1PL5A 4PV1B 4PD4H 3H1LD 1IZNB 1X0TA 4H44D 1PV3A 1K05A
chains in the Genus database with same CATH topology
1YQ4D 1KQFB 2ACZC 1OW6A 1ZOYC 3H25A 4YTPD 5C2TD 3SFDD 1R8EA 1Q90D 1DIPA 1HF9A 3O6QA 3D6YA 3P4PD 3AEEC 3Q1MA 2WDQD 1VF5B 1L0VC 2WQYD 3VR8D 3VRBD 3Q3DA 2WU2D 2J5UA 4YT0D 1MKMA 1E7PC 3R4YA 4GDOA 4Z1MH 1NYHA 5C3JD 4YSYC 2D2CD 2NZ2A 1ZP0D 2H89D 4XFJA 2E75B 2WP9C 3EWKA 3P4SD 4YTMC 5L8RJ 2E74D 2JP3A 3AE2C 3AEDC 1NEND 1U57A 2WPVB 1KTMA 3AE7D 3P4QC 5KKZC 1GMJA 3VRAC 1NEKD 3G9RA 1VF5C 3AE9D 1EXIA 3AE4D 2FBWC 2QJYC 4RKUJ 2B76C 3D71A 2WDVC 2WU5C 1YQ4C 3P4RD 3Q5SA 4YSZD 3D6ZA 3AE6D 2K9YA 1EXJA 2H88D 2QSIA 3LW5J 5C2TC 3SFDC 3ABVC 4OGQD 2E76C 1VL2A 2ZT9D 4H44B 1KILE 2WS3C 3AE1D 4R4MA 2G8YA 1KFYD 2WDQC 2WDRD 1RQVA 4H13D 2YMKA 1QLBC 1YQ3D 3AEBD 2E75C 4IL6X 3AEAC 3AECD 1NGMB 3AE8D 2QIWA 2YIUC 3AE3D 3VRBC 3VR8C 4YXDC 3D70A 4H0LD 4YSYD 3GF3A 1K04A 1OW8A 2E76B 3CIRC 3RK3E 1KQGB 1KF6D 3SFED 1ZOYD 3AE5C 4YSXD 2G3AA 1KMIZ 1JB0J 3VR9D 2WSCJ 2H89C 3AEED 1S5LX 1L0VD 1FDOA 3AEFC 3P4SC 2BEZF 2WSEJ 2BS2C 1OMIA 4KX6D 2BS3C 4YTNC 1ZRTE 2D2CB 2E74C 3Q5RA 2QJPC 4TT3H 4H44C 1ZMEC 3AEGD 4PV1D 3AE9C 1Y9BA 3AE4C 5KLIC 4YTPC 1IK7A 4Y28J 1UIXA 2IDBA 2E74B 1AJYA 3P4PC 4I7ZC 3S9OA 2H88C 2WQYC 3AE2D 3AEDD 3P4RC 2FXPA 3P4QD 2WDRC 3VRAD 3GLMA 1VF5D 3AECC 2WU2C 1WMKA 3AE8C 4I7ZB 4KT0J 1KORA 3Q2YA 2ACZD 2FBWD 4YT0C 5C3JC 3FGAD 2JO1A 4H0LC 4OGQB 1DD3A 1S1CX 2B76D 2D2CC 2ZT9B 2WDVD 2WU5D 1ZP0C 3SFEC 1KF6C 4YSXC 4H13B 2FYNC 3ABVD 3B71A 3VR9C 1FDIA 2MKVA 5M1BA 2E76D 2O01J 4H0LB 3RL0g 2WS3D 3C8VA 1NENC 3GMAA 2E75D 3AE7C 2QJKC 3AEAD 3GF7A 4KX6C 1NEKC 4YXDD 3CIRD 3T97B 2V7QJ 4R4LA 3AEGC 3AE5D 4PV1C 1DD4A 1TU3F 2WP9D 4YSZC 3AE6C 2BS4C 1HJ0A 3IAOA 3Q5PA 2WSFJ 4YTMD 4OGQC 2BEQD 4H44D 1PL5A 4U7JA 2ZT9C 3AEFD 2OQQA 3AE1C 4PV1B 1KFYC 3AEBC 4H13C 1PIXA 1YQ3C 4YTND 3IN6A 1RQUA 3AE3C 2P10A 1OW7A 1PV3A 1K05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YQ4 D;  2ACZ C;  1OW6 A;  1ZOY C;  4YTP D;  5C2T D;  3SFD D;  3P4P D;  3AEE C;  2WDQ D;  1L0V C;  2WQY D;  3VR8 D;  3VRB D;  2WU2 D;  4YT0 D;  1E7P C;  5C3J D;  1ZP0 D;  2H89 D;  2WP9 C;  3P4S D;  4YTM C;  1NEN D;  3AED C;  3AE2 C;  1KTM A;  3AE7 D;  3P4Q C;  3VRA C;  1NEK D;  3AE9 D;  3AE4 D;  2FBW C;  2B76 C;  2WDV C;  2WU5 C;  1YQ4 C;  4YSZ D;  3AE6 D;  2H88 D;  5C2T C;  3SFD C;  3ABV C;  3P4R D;  2WS3 C;  3AE1 D;  2WDQ C;  1KFY D;  2WDR D;  3AEB D;  1QLB C;  1YQ3 D;  3AEC D;  3AEA C;  3AE8 D;  3VR8 C;  3VRB C;  3AE3 D;  4YXD C;  4YSY D;  1K04 A;  1OW8 A;  3CIR C;  3SFE D;  1KF6 D;  4YSX D;  1ZOY D;  3AE5 C;  2G3A A;  3VR9 D;  2H89 C;  3AEE D;  1L0V D;  3AEF C;  3P4S C;  2BS2 C;  4KX6 D;  2BS3 C;  4YTN C;  3AEG D;  3AE9 C;  3AE4 C;  4YTP C;  3P4P C;  3S9O A;  2H88 C;  2WQY C;  3AE2 D;  3AED D;  3P4R C;  3P4Q D;  2WDR C;  3VRA D;  3AEC C;  2WU2 C;  3AE8 C;  2ACZ D;  2FBW D;  4YT0 C;  5C3J C;  4YSY C;  2B76 D;  2WDV D;  2WU5 D;  1ZP0 C;  3SFE C;  1KF6 C;  4YSX C;  3ABV D;  3B71 A;  3VR9 C;  2WS3 D;  1NEN C;  3AE7 C;  3AEA D;  4KX6 C;  1NEK C;  4YXD D;  3CIR D;  3AEG C;  3AE5 D;  2WP9 D;  4YSZ C;  3AE6 C;  2BS4 C;  4YTM D;  3AEF D;  3AE1 C;  1KFY C;  3AEB C;  1YQ3 C;  4YTN D;  3AE3 C;  1OW7 A;  1PV3 A;  1K05 A; 
#chains in the Genus database with same CATH topology
 1FOS E;  1LTJ B;  3SFD D;  2AXC A;  3PHL A;  2WZ7 A;  2O1K A;  2IX7 C;  4C7N A;  2WU2 D;  2H7H A;  2W27 A;  1LWU B;  1NHL A;  2AXT H;  5KAF E;  1VQ6 P;  2YXQ B;  1FZC B;  1LTS C;  1BCC G;  2QJY C;  2B76 C;  2I1K A;  3AE6 D;  3O6Q B;  3SSU A;  3P4R D;  1Q2N A;  3L73 G;  3AEA C;  1RF1 A;  1FAV A;  1N7S A;  3WUU A;  2ZYA A;  2KLV A;  1KQS O;  2G3A A;  3K5B A;  3P8M C;  2QEX P;  1GK6 A;  3CWB D;  1TFF A;  3VP9 A;  1IK7 A;  1RF1 C;  1N7S C;  3CX5 H;  2K9J A;  3RBZ A;  3BCC D;  1P84 D;  2E5Y A;  1CSB A;  3BRV B;  1VF5 D;  3QH9 A;  2HLO A;  2W83 C;  4YSY C;  1ZXG A;  2WPS A;  5EFW B;  4H13 B;  3HD7 D;  1H89 A;  2A06 G;  1FOS F;  2BCC G;  2GA1 A;  2E75 D;  4N78 E;  1GTW A;  3E7K A;  4JQ0 D;  5APY A;  3RK3 D;  1SFC B;  2Q3E A;  1YQ3 C;  4NPF X;  4YTN D;  2QG4 A;  2P10 A;  4DDI A;  5KLV D;  1IO4 A;  4QMA A;  1ZOY C;  1VDF A;  3AEE C;  1JY3 P;  3R2P A;  1L0V C;  1IFM A;  1JMB A;  1SQX G;  3UIA A;  3KZI E;  1CZQ A;  2KUB A;  4UB8 H;  4MN4 C;  2WP9 C;  2NPS A;  2WPV B;  1L4A A;  1KYO D;  1S4X A;  1SQB E;  3LID A;  5B5E H;  3PLN A;  4PD4 I;  1CW5 A;  3HTK A;  2YIU C;  1KIL C;  4D6T D;  2Y9Z A;  2NPS C;  1A02 J;  1IFJ A;  3VR9 D;  1L4A C;  1G1J A;  2WSC J;  4HKZ H;  5DJT B;  1P84 H;  1J1E C;  1SQV E;  4H44 C;  4EOT A;  3T97 A;  5E79 H;  1EZV I;  1QVF O;  1W2B O;  3L72 D;  4K35 A;  1NKZ B;  2PRR A;  1FU1 A;  2WU2 C;  4I7Z B;  1NTZ G;  3OAK A;  4EYY Q;  1LTJ A;  2IBZ G;  3CCJ P;  3CXH E;  1H88 A;  1N8R Q;  2A45 H;  3B71 A;  1HTL C;  2QVA A;  4H0L B;  3B5N B;  5GTH H;  5AVW B;  3TGU E;  3KDP B;  1SQP J;  3BAT A;  4PV1 C;  1LWU A;  1NTK K;  1HWT C;  3AE6 C;  1BDC A;  4YTM D;  4IOI H;  2Z4E A;  4HB1 A;  3V2R A;  3NFQ A;  1FZC A;  1LTJ C;  1ZR2 A;  1QL1 A;  3H6P A;  3RK2 D;  3CX5 I;  3O6Q A;  1LWU C;  4HJG H;  2W6J H;  1NKN A;  4Z1M H;  2B9B A;  3B5N D;  3HRN A;  1KYO H;  1FZC C;  3A2A A;  1L0L E;  3TF5 A;  2WSE H;  2XNX A;  3CCQ P;  1KTM A;  1NEK D;  1VF5 C;  3CC2 P;  1EC5 A;  3Q5S A;  2H88 D;  3HD7 C;  1VPC A;  1SP4 A;  3AE1 D;  2WDQ C;  2E75 C;  1K04 A;  4L74 A;  3H1L G;  3A5T A;  1GW4 A;  4ZNC A;  1FDO A;  4KX6 D;  1EDL A;  3L71 D;  4YTN C;  3WUV A;  1VQM P;  1L0N K;  2W6B A;  3CC4 P;  1SFC A;  1NU1 G;  2FYU J;  1ZV8 A;  3Q2Y A;  2P1J A;  4OGQ B;  3EFG A;  4UB6 E;  1T3U A;  3O8Z A;  2WS3 D;  1NOH A;  3TSI A;  2FYN B;  1SFC C;  2ZVN B;  2WT7 B;  3CIR D;  4R4L A;  5CCH D;  4RJT A;  1WRG A;  3PRJ A;  1P84 I;  3H1I D;  1HGZ A;  1NTK D;  1YQ4 D;  1GU4 A;  4ASW A;  1AA0 A;  5AW2 B;  3H1H J;  2ZXE B;  2K88 A;  3A0B E;  1ZR4 A;  3BCC G;  5AVT B;  1BGY G;  1NTM E;  2A45 I;  3WU2 E;  3L70 J;  2C0W A;  2IYO A;  3AE9 D;  1SQQ J;  2YNY A;  2HFE D;  3VMY A;  2H43 A;  2PAJ A;  1VL2 A;  3A0H E;  1RQV A;  5GTI H;  1IK9 A;  4DDG A;  1PPJ D;  3U1A A;  4YSX D;  3KYQ A;  1LTA C;  1PGQ A;  2R32 A;  3C1L A;  5KLV G;  5C39 A;  2XND H;  3V2N A;  1LNQ A;  1WT6 A;  1KYO I;  3RK2 C;  4U3F E;  1VQ7 P;  3L74 E;  4I7Z C;  1L0N D;  1VQP P;  1YTZ T;  1LJ2 A;  3P32 A;  4H0L C;  4LC1 A;  3B5N C;  4YPC A;  3MTU E;  1GU5 A;  3GHG B;  4DCK A;  3L75 E;  2Y0D A;  1NEK C;  4U3F G;  1USE A;  3H1J E;  2XV5 A;  5AW0 B;  3AE1 C;  3QWO C;  3JC2 2;  4PJ0 E;  1OX3 A;  4M3L A;  1FJK A;  3B8E B;  3N7N A;  3OA7 A;  1S9K D;  1E7P C;  1GDT A;  1KB9 I;  5AVU B;  5L8R J;  4WBA A;  4B86 A;  3FXD A;  1JY2 P;  3G6E P;  3G71 P;  2ZYD A;  5APX A;  4YSZ D;  4GT1 A;  3D6Z A;  1FC2 C;  1KFM A;  1RF0 A;  5AVZ B;  2N1T B;  2WS3 C;  5AVX B;  2POH A;  4YSY D;  3CIR C;  1JOC A;  1JB0 J;  1BE3 G;  4HH2 A;  3V5B A;  3VON A;  1PP9 E;  3P4S C;  2ITA A;  2Q7C A;  2MJZ A;  2OYH B;  1RF0 C;  1J2J B;  2WT7 A;  1Y9B A;  2OYO A;  2FFD B;  2RKL A;  3FWL A;  2PGD A;  3FXE A;  3I55 P;  1OVV A;  1SLQ A;  5APT A;  1RE3 C;  1VQO P;  3H1K E;  2FYN C;  4DHI B;  2WP9 D;  3Q5P A;  3RBX A;  4IL6 E;  3ITK A;  1SQB J;  1T2K C;  1S5L E;  3L71 G;  1M90 Q;  3HE5 B;  2KSE A;  2JR8 A;  2D2C D;  1L4A D;  3VN0 A;  1UII A;  4GKG A;  1IFD A;  1SQV J;  5AW6 B;  2KYV A;  3N4X A;  4LDT A;  1NTM K;  1BCC E;  5C2T C;  2N9Y B;  3I5C A;  1LTT C;  5CJ0 A;  3VR8 C;  3L73 E;  2M0B A;  3VMX A;  2Q5U A;  2Z5H A;  1KMI Z;  3EFF K;  3H1I G;  1EDK A;  1PZQ A;  2NRG A;  2Q6Q A;  3GHG A;  2BEZ F;  1OMI A;  3TGU J;  1FZF A;  1SQP K;  3BVH A;  4PV1 D;  5TIS E;  1OZH A;  1MV8 A;  1J1D B;  1UIX A;  2IDB A;  1KFN A;  2KZI A;  3VYI A;  1EDJ A;  1M56 D;  2KI7 B;  2JKV A;  5CCG A;  2WDR C;  2YO3 A;  5CHX A;  1YTZ I;  3PJS K;  4L76 A;  1DD3 A;  2J59 M;  2WIT A;  3PP5 A;  2MKV A;  4N6J A;  2B87 B;  1GK4 A;  2A06 E;  3PH0 A;  2BCC E;  2HG5 D;  1L0L J;  2V7Q J;  2JEE A;  3V6I A;  4WWI A;  4YSZ C;  2QJK B;  1PPJ G;  2O1J A;  3W67 A;  3FX0 A;  3SWY A;  3AEF D;  2Q9I A;  1RQU A;  1KQF B;  2FXM A;  3MD0 A;  3P8C E;  1N73 B;  2M3E A;  5H2F E;  2WDQ D;  2N1T A;  1RY3 A;  4O9B A;  1KC8 Q;  1SQX E;  3RGU A;  2NZ2 A;  1L0N G;  5AW8 B;  1IFN A;  3E1R A;  1PFI A;  3L36 A;  3G9R A;  2OYH A;  2N1T C;  4RKU J;  2FFD A;  2K9Y A;  1JCD A;  2IZ0 A;  1U7M A;  2I8D A;  4H13 D;  2FYU K;  1NTM D;  4JYC A;  5KLI B;  3OW2 O;  1NAY A;  3AE3 D;  3I56 P;  3MZW B;  5KAI E;  2OYH C;  2FFD C;  1IFP A;  3KQG A;  1SFC D;  2M5A B;  2Q3I A;  5AW9 B;  2BAS A;  4PD4 E;  3CCS P;  1KV4 A;  1IC2 A;  2WPQ A;  3P7K A;  1SQP D;  2HYN A;  4KT0 J;  1M1K Q;  2WU5 D;  1NTZ E;  2D2C C;  2ZT9 B;  3VMZ A;  1KF6 C;  2ZXX A;  2IBZ E;  1FDI A;  3H32 B;  4A7P A;  1EZV E;  3B4S A;  5K5G B;  3HE5 A;  2AXT E;  1NTM J;  3CC7 P;  3CCR P;  3AE5 D;  4BRY B;  1MFT A;  2BEQ D;  1LTB C;  2GUV A;  1SQQ K;  3SWF A;  1E79 H;  3MP7 B;  4IFD K;  3CPW O;  1VQ4 P;  1OW6 A;  1EZV G;  1OFC X;  4FJV A;  2KNC B;  2VRS A;  3Q3D A;  1S72 P;  1QVG O;  3M9H A;  4YT0 D;  2RMZ A;  4LGD E;  2WSC H;  1YIT P;  1KB9 D;  2ZFC A;  2P67 A;  1K8A Q;  3LIE A;  2M3B A;  3CXH I;  3CX5 E;  2QA4 P;  3WU2 H;  3CL3 D;  4U3F J;  3L74 J;  5APU A;  1GZL A;  3LW5 J;  1OXZ A;  1FDM A;  4AQR D;  3CCE P;  1KIL E;  1KFY D;  4IL6 X;  3EQ2 A;  4H0L D;  5B66 H;  1KQG B;  4AYC A;  3H1L E;  2FYU D;  2IFN A;  4I6M C;  4BWN A;  1S5L X;  3AEF C;  1URQ B;  3L75 J;  2B87 A;  1J1D C;  3H1J J;  3AE4 C;  2OAR A;  3CCV P;  1NU1 E;  2L91 A;  2ZYG A;  4AUW A;  1NWQ A;  3CD6 P;  4Y99 B;  4KHX A;  3AE8 C;  2ZFY A;  2OTL P;  5AVY B;  1N73 A;  2O01 J;  2FY8 A;  3C8V A;  2R5B A;  2QJK C;  3H1H D;  4UB8 E;  4ASV A;  1URQ D;  3AEG C;  1TU3 F;  2W6A A;  2OYI B;  3IAO A;  2WSF J;  4OVN F;  3MHV A;  4H13 C;  3M0D A;  5B5E E;  1LT1 A;  3AE3 C;  1YI2 P;  1SVF A;  1N73 C;  1DH3 A;  3L70 D;  1ZRT D;  1R8E A;  3WMM 0;  1KB9 H;  2YKP A;  1SQQ D;  5APS A;  4C46 A;  3P4P D;  3CWB E;  1X9V A;  4L75 A;  4XA4 A;  1MKM A;  1NYH A;  3L35 A;  3BCC E;  2SPZ A;  3M0D C;  1BGY E;  1JNM A;  2O01 H;  1PP9 J;  4GOE A;  3P4S D;  4ZMD A;  5E79 E;  3V4W A;  2M5A A;  1SQX K;  1EXI A;  1G1I A;  2KS1 B;  3D71 A;  3MGN A;  2WU5 C;  3CWB G;  5KKZ B;  4OGQ D;  1QLB C;  1OW8 A;  3RK3 E;  1LT9 B;  5AVQ B;  3H1K J;  3AE5 C;  5BU8 B;  3M06 A;  5GTH E;  2FXO A;  2H89 C;  3H32 A;  5KLV E;  2Z5I A;  3M91 A;  4JF7 A;  1VQ5 P;  2OTJ P;  2E74 B;  1YYC A;  4BRY A;  4WB4 A;  1AQ5 A;  2A45 G;  3KXD A;  1IJD B;  3AED D;  2QRX A;  1SQB K;  5AVS B;  3P4Q D;  1T2K D;  3VRA D;  3AEC C;  2FBW D;  4YT0 C;  2DW3 A;  2IZ1 A;  2WDV D;  1FE6 A;  2KOG A;  4TLF A;  3TYY A;  4DHZ A;  2KNC A;  1SQV K;  4DT0 A;  4D6T E;  1KFY C;  3JCU H;  4I6L A;  1OW7 A;  1BCC J;  3FWN A;  2GUS A;  5C2T D;  1JMM A;  3IF4 A;  2C0X A;  2WQY D;  3L73 J;  3VR8 D;  4RO0 A;  1S5L H;  2J5U A;  4N3Y B;  4L73 A;  1SQP G;  1ZP0 D;  4D6T G;  3ZDM A;  1URQ A;  1M1J B;  1NJI Q;  1A02 F;  2WWW A;  3NXS A;  4N78 D;  5AW3 B;  2YKO A;  2P2U A;  1SQX D;  3L72 G;  2WDR D;  3NTN A;  3GF3 A;  1URQ C;  1XTG B;  2UWJ E;  1BE3 E;  1X22 A;  2BCC J;  1PGP A;  2LKM A;  1L0L K;  1OVU A;  4DZO A;  5KAF H;  5CCG D;  1SS1 A;  2Q1K A;  3A3Y B;  2OYI A;  3P4P C;  3VTP C;  2ZAE B;  5CMZ A;  1AQT A;  1S1C X;  1SQB D;  1NU1 K;  1JY3 O;  1SQX J;  3GF7 A;  2OYI C;  1QL2 A;  1DEE G;  4OGQ C;  1W5C E;  4U7J A;  3G3Z A;  2M8R A;  1LTG C;  2IFM A;  4DOJ A;  2N1T D;  2FYU G;  2KS1 A;  4CPG A;  2ACZ C;  3H25 A;  1SQV D;  3L71 E;  3V4Q A;  1LP1 B;  3PTZ A;  4C7R A;  2R3S A;  1FZE A;  1USD A;  3R4Y A;  1LT9 A;  1VQL P;  2JWD A;  4XFJ A;  1OVR A;  1KIL B;  2H8P D;  3CXH D;  2QM8 A;  3AED C;  1U57 A;  3P4Q C;  3RL0 B;  3MUD A;  5KKZ C;  3VRA C;  2CK3 H;  2FBW C;  1ZN5 A;  2WDV C;  2WSS H;  1PGO A;  3IR9 A;  3TGU D;  3H1H G;  2K37 A;  1BDD A;  1Y47 A;  4H44 B;  1EDI A;  1LT9 C;  3OJA B;  3AEB D;  1GW3 A;  2QIW A;  1NTZ J;  3L37 A;  1Q86 Q;  1KF6 D;  2L5G B;  3MUD C;  1HGV A;  3H1I E;  3KZI H;  4JPZ B;  1NTK E;  4GIF A;  1MFZ A;  1YBK A;  2E74 C;  1SQQ G;  1M57 D;  1NVO A;  5KAI H;  3NMD A;  3RL0 D;  2FKW B;  1X79 B;  3S9O A;  2WQY C;  1L0L D;  1D7M A;  4EI2 A;  1N86 A;  3FGA D;  3HUS B;  1NTK G;  1ZP0 C;  2YMY A;  5AW1 B;  2RN0 A;  1KN7 A;  1FBM A;  1R5S A;  1FZG A;  2YO2 A;  5AVV B;  1NU1 D;  3KHU A;  3G4S P;  3V2P A;  1PPJ E;  1M1J A;  2CPS A;  1VQ9 P;  3GHG C;  4YTP D;  1M8O B;  1Q90 D;  1ZLL A;  1AFO A;  3CCM P;  1VF5 B;  2IYP A;  3E1I A;  1GL2 B;  1EQ7 A;  1OWA A;  3CXH H;  1N2D C;  3HD7 B;  5CCG C;  1M1J C;  3H1L J;  4DHJ A;  2P58 A;  2E75 B;  1L0N E;  5AVR B;  1Q81 Q;  3CCU P;  1NEN D;  1U7J A;  2E5T A;  3AE4 D;  3RK3 B;  3TDK A;  3CI9 A;  3F5H A;  1K9M Q;  1NU1 J;  3C9I A;  2G8Y A;  2YMK A;  5AW4 B;  1HUC A;  5AW7 B;  3AE8 D;  3GG2 A;  1BGY D;  3VRB C;  2R3C A;  5APV A;  1RHZ B;  2WTY A;  1GL2 D;  4K3A A;  1YJN P;  1NAF A;  2IPP A;  1CI6 B;  1RE4 A;  2V7Q H;  3TK1 A;  3AEG D;  1AVY A;  2CPB A;  3M0A A;  2OTK E;  3M9Q A;  1S9K E;  2GM4 A;  3GW6 A;  3BRT B;  4W7Z A;  2LR2 A;  1RE4 C;  1JM0 A;  1KD1 Q;  3JSV C;  3SFE C;  3CWB J;  1LP1 A;  3BCC J;  1BGY J;  2I1J A;  3VOP A;  2FYZ A;  2WVR A;  1KIL A;  4W80 A;  3AEB C;  2B88 A;  3IN6 A;  1S2E A;  1H8A A;  1K73 Q;  1KZU B;  4U3F D;  1LGH B;  3L74 D;  4BXL A;  1Q82 Q;  1JEK A;  4UB6 H;  2E42 A;  3BAS A;  3VMA A;  1DEB A;  1VQK P;  3RL0 C;  2C9L Y;  2H89 D;  2N9B A;  3EWK A;  5KLV J;  4NPE A;  3AE7 D;  1E5W A;  1SQB G;  2IBZ I;  1HVV A;  1W2E A;  3L75 D;  1X8Y A;  3CCL P;  3SFD C;  3II6 A;  1RH5 B;  3H1J D;  2ZT9 D;  5BVZ A;  3AEC D;  2O01 N;  3RK2 B;  2Y0E A;  2C9N Y;  1OIP A;  3HUS A;  1XTC C;  3A0B H;  5BU5 A;  1JY3 N;  2WSE J;  1SQV G;  2BS3 C;  5CBO A;  2YKQ A;  2Y0C A;  4YXW H;  4YTP C;  4Y28 J;  1FZB A;  2QJP B;  4D6T J;  5CBN A;  3VP8 A;  3AE2 D;  3P4R C;  3HUS C;  2YXR B;  1BE3 D;  1WMK A;  3S4R A;  4GOF A;  1KOR A;  3A0H H;  1IFI A;  2OGU A;  1GL2 A;  4I2L C;  1NEN C;  3L72 J;  3TGU G;  2KZJ A;  3HD7 A;  5KJ7 D;  1VQN P;  4KJM A;  4OWF A;  3W68 A;  1EXJ A;  1PP9 D;  3LW5 H;  1GL2 C;  1JY2 O;  2LXC B;  1YJ9 P;  1DIP A;  1HF9 A;  3TNU B;  2O3J A;  2ZJS E;  1YJW P;  3A7O A;  4EDF A;  4ZKP A;  2HPC B;  1QLE D;  2P7J A;  5C3J D;  1L0L G;  1BE3 J;  1CI6 A;  3RK3 C;  2XZR A;  3H1K D;  1ZW0 A;  1R5L A;  2E43 A;  3V2Q A;  1QGK B;  3CME P;  2QSI A;  3MIW A;  2KXP B;  3U1C A;  4PJ0 H;  4XE5 B;  5AW5 B;  3F89 A;  1NGM B;  1T3J A;  3SWK A;  2E76 B;  2KSJ A;  3HE4 B;  2B89 A;  1P84 E;  2XU6 A;  4HYT B;  2K1A A;  2HR3 A;  2BS2 C;  3Q5R A;  4TT3 H;  2PP6 A;  2WSF H;  5KLI C;  1N7L A;  3GLM A;  2ACZ D;  4WY4 B;  1S3J A;  1JTH B;  3CLQ A;  2HOD B;  4NPD A;  3L71 J;  1Q7Y Q;  5KTB A;  1VQ8 P;  1G2C B;  3ABV D;  3VR9 C;  5M1B A;  1BCC D;  2E76 D;  3RL0 g;  3WUT A;  3AE7 C;  4YXD D;  4IFM A;  1DD4 A;  3L73 D;  1KQL A;  1H0T B;  1L2P A;  2W90 A;  2KB7 P;  2ZT9 C;  2OQQ A;  1FZA A;  1PIX A;  1M7L A;  4IFF A;  2AEJ A;  2AEF A;  1KYO E;  4WY4 D;  5B66 E;  1AV1 A;  1NTZ K;  2AEM A;  5TJH A;  4ZKU A;  1NTM G;  1Z56 A;  3H1I J;  2J58 A;  1NTK J;  1SQP E;  2RH0 A;  4YTM C;  1HJB A;  2E74 D;  2JP3 A;  3AE2 C;  3L4F A;  3B5N A;  1GMJ A;  5KJ7 A;  4IL6 H;  2A06 D;  1NO4 A;  2BCC D;  1DX7 A;  2QJY B;  4R4M A;  4C7N B;  3L72 E;  1AVO A;  1T8Z A;  4OH8 B;  5KJ7 C;  3P8C D;  5CJ4 A;  2QJP C;  1ZME C;  1YHQ P;  3S1K A;  2WMM A;  2R44 A;  3L74 G;  3CMA P;  1AJY A;  2H88 C;  5DJU B;  2KP8 A;  2FXP A;  1RF1 B;  1N7S B;  1KB9 E;  2K3R A;  1BSH A;  5C3J C;  3IFM A;  2B76 D;  2QE7 H;  2KLU A;  3TNU A;  1GD2 E;  1PGJ A;  3L75 G;  1NH4 A;  2QM7 A;  3AEA D;  4KX6 C;  2HPC A;  3H1J G;  1HH0 A;  1QX8 A;  4RES B;  1L0N J;  1MUU A;  4Y99 C;  4EIJ A;  2BS4 C;  2K9J B;  1JUN A;  5TIS H;  5APQ A;  2R5D A;  5CCH A;  3KPE A;  2FYU E;  1N7S D;  3D6Y A;  3Q1M A;  4PD4 D;  3VRB D;  4DJG A;  2JJL A;  2XDJ A;  2LXB A;  2XKM A;  3HE4 A;  4GDO A;  4JBZ A;  2PFX A;  2V4H A;  1BSN A;  2ZVO B;  4LLH A;  5CCH C;  1JO5 A;  1NTZ D;  2IBZ D;  1QEX A;  1RE3 A;  1EZV D;  5GTI E;  1YQ4 C;  1FS0 E;  2JWA A;  3ABV C;  4WVZ A;  2E76 C;  3H1H E;  1YQ3 D;  2Y9Y A;  4GOD A;  4YXD C;  3D70 A;  5H2F H;  4JYB A;  4WY4 A;  3SFE D;  1JTH A;  1ZOY D;  2JDI H;  2HOD A;  2KIK A;  2YIU B;  1G2C A;  1PP9 G;  3AEE D;  5APW A;  1L0V D;  2NPS B;  3L70 E;  1ZRT E;  2D2C B;  1L4A B;  3AE9 C;  1SQQ E;  3JCU E;  3M9B A;  1J1E B;  1H0T A;  1HBW A;  4WY4 C;  3U59 A;  2KK7 A;  3HTK B;  1JCC A;  1JY2 N;  2JO1 A;  3H1K G;  3CX5 D;  4YSX C;  3L70 G;  4W7Y A;  4I1L A;  1MZ9 A;  3GMA A;  1LTI C;  2WPR A;  1KIL D;  2W8Z A;  3T97 B;  2NPS D;  1YIJ P;  3USS A;  1T6A A;  1FJP A;  1Y8A A;  5KLV K;  1HJ0 A;  1PL5 A;  4PV1 B;  4PD4 H;  3H1L D;  1IZN B;  1X0T A;  4H44 D;  1PV3 A;  1K05 A; 
#chains in the Genus database with same CATH homology
 1YQ4 D;  1KQF B;  2ACZ C;  1OW6 A;  1ZOY C;  3H25 A;  4YTP D;  5C2T D;  3SFD D;  1R8E A;  1Q90 D;  1DIP A;  1HF9 A;  3O6Q A;  3D6Y A;  3P4P D;  3AEE C;  3Q1M A;  2WDQ D;  1VF5 B;  1L0V C;  2WQY D;  3VR8 D;  3VRB D;  3Q3D A;  2WU2 D;  2J5U A;  4YT0 D;  1MKM A;  1E7P C;  3R4Y A;  4GDO A;  4Z1M H;  1NYH A;  5C3J D;  4YSY C;  2D2C D;  2NZ2 A;  1ZP0 D;  2H89 D;  4XFJ A;  2E75 B;  2WP9 C;  3EWK A;  3P4S D;  4YTM C;  5L8R J;  2E74 D;  2JP3 A;  3AE2 C;  3AED C;  1NEN D;  1U57 A;  2WPV B;  1KTM A;  3AE7 D;  3P4Q C;  5KKZ C;  1GMJ A;  3VRA C;  1NEK D;  3G9R A;  1VF5 C;  3AE9 D;  1EXI A;  3AE4 D;  2FBW C;  2QJY C;  4RKU J;  2B76 C;  3D71 A;  2WDV C;  2WU5 C;  1YQ4 C;  3P4R D;  3Q5S A;  4YSZ D;  3D6Z A;  3AE6 D;  2K9Y A;  1EXJ A;  2H88 D;  2QSI A;  3LW5 J;  5C2T C;  3SFD C;  3ABV C;  4OGQ D;  2E76 C;  1VL2 A;  2ZT9 D;  4H44 B;  1KIL E;  2WS3 C;  3AE1 D;  4R4M A;  2G8Y A;  1KFY D;  2WDQ C;  2WDR D;  1RQV A;  4H13 D;  2YMK A;  1QLB C;  1YQ3 D;  3AEB D;  2E75 C;  4IL6 X;  3AEA C;  3AEC D;  1NGM B;  3AE8 D;  2QIW A;  2YIU C;  3AE3 D;  3VRB C;  3VR8 C;  4YXD C;  3D70 A;  4H0L D;  4YSY D;  3GF3 A;  1K04 A;  1OW8 A;  2E76 B;  3CIR C;  3RK3 E;  1KQG B;  1KF6 D;  3SFE D;  1ZOY D;  3AE5 C;  4YSX D;  2G3A A;  1KMI Z;  1JB0 J;  3VR9 D;  2WSC J;  2H89 C;  3AEE D;  1S5L X;  1L0V D;  1FDO A;  3AEF C;  3P4S C;  2BEZ F;  2WSE J;  2BS2 C;  1OMI A;  4KX6 D;  2BS3 C;  4YTN C;  1ZRT E;  2D2C B;  2E74 C;  3Q5R A;  2QJP C;  4TT3 H;  4H44 C;  1ZME C;  3AEG D;  4PV1 D;  3AE9 C;  1Y9B A;  3AE4 C;  5KLI C;  4YTP C;  1IK7 A;  4Y28 J;  1UIX A;  2IDB A;  2E74 B;  1AJY A;  3P4P C;  4I7Z C;  3S9O A;  2H88 C;  2WQY C;  3AE2 D;  3AED D;  3P4R C;  2FXP A;  3P4Q D;  2WDR C;  3VRA D;  3GLM A;  1VF5 D;  3AEC C;  2WU2 C;  1WMK A;  3AE8 C;  4I7Z B;  4KT0 J;  1KOR A;  3Q2Y A;  2ACZ D;  2FBW D;  4YT0 C;  5C3J C;  3FGA D;  2JO1 A;  4H0L C;  4OGQ B;  1DD3 A;  1S1C X;  2B76 D;  2D2C C;  2ZT9 B;  2WDV D;  2WU5 D;  1ZP0 C;  3SFE C;  1KF6 C;  4YSX C;  4H13 B;  2FYN C;  3ABV D;  3B71 A;  3VR9 C;  1FDI A;  2MKV A;  5M1B A;  2E76 D;  2O01 J;  4H0L B;  3RL0 g;  2WS3 D;  3C8V A;  1NEN C;  3GMA A;  2E75 D;  3AE7 C;  2QJK C;  3AEA D;  3GF7 A;  4KX6 C;  1NEK C;  4YXD D;  3CIR D;  3T97 B;  2V7Q J;  4R4L A;  3AEG C;  3AE5 D;  4PV1 C;  1DD4 A;  1TU3 F;  2WP9 D;  4YSZ C;  3AE6 C;  2BS4 C;  1HJ0 A;  3IAO A;  3Q5P A;  2WSF J;  4YTM D;  4OGQ C;  2BEQ D;  4H44 D;  1PL5 A;  4U7J A;  2ZT9 C;  3AEF D;  2OQQ A;  3AE1 C;  4PV1 B;  1KFY C;  3AEB C;  4H13 C;  1PIX A;  1YQ3 C;  4YTN D;  3IN6 A;  1RQU A;  3AE3 C;  2P10 A;  1OW7 A;  1PV3 A;  1K05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...