3AEAC

Crystal structure of porcine heart mitochondrial complex ii bound with n-(3-dimethylaminomethyl-phenyl)-2-trifluoromethyl-benzamide
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 47
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3aeaC01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3aeaC02
2WU2D 3AEFD 1PV3A 3AE4D 3P4RD 3VR9D 3S9OA 2B76D 3AEBD 3AEGD 3AE6D 3AE1C 4KX6C 1NENC 1L0VC 1NEKC 1OW7A 3AE7C 4YSYD 2WS3D 3AE3C 3AE2C 1KFYC 3CIRD 3SFDC 3AECC 2BS2C 4YTPD 1KF6D 1E7PC 3ABVC 4YSXC 3AE8C 4YTND 2ACZC 2FBWD 1KTMA 1YQ3D 3VR8D 2G3AA 4YTMC 2WDVD 1K05A 4YSZC 4YT0D 5C3JD 2BS3C 1ZP0C 2H88C 3P4SD 3AEAD 2BS4C 4YXDD 2WU5D 2WP9C 1ZOYD 3AE5D 1K04A 3SFED 1NEND 1L0VD 2WU2C 5C2TC 3AEFC 1OW6A 3P4PD 3AE4C 3AE3D 3P4RC 3VR9C 3SFDD 3AEBC 3AEGC 2B76C 3AE9D 3AE6C 1YQ4C 3VRAD 4YSYC 3P4QD 3VRBD 3AE8D 3CIRC 2H89D 2WQYD 4YTPC 3AEEC 3AEDD 1KF6C 3B71A 2WDRC 4YTNC 2FBWC 2WDQC 1YQ3C 3VR8C 3AE1D 4KX6D 1NEKD 3AE7D 2WDVC 3AE2D 4YT0C 1KFYD 5C3JC 3AECD 5C2TD 3P4SC 3AEAC 4YSXD 3ABVD 4YXDC 1OW8A 2WU5C 2WS3C 1ZOYC 3AE5C 2ACZD 3SFEC 1YQ4D 3P4PC 4YTMD 3AE9C 3AEED 4YSZD 1ZP0D 2H88D 3VRAC 3P4QC 3VRBC 1QLBC 2WDRD 2WP9D 2H89C 2WQYC 2WDQD 3AEDC
chains in the Genus database with same CATH superfamily
2K9JB 3KDPB 3V4QA 4H13B 3B4SA 2E75C 2FKWB 1NEKC 3K5BA 4YTPD 2HPCA 1DEBA 4PD4I 3AE8C 2Z4EA 4Y28J 2W8ZA 1LTJC 1OFCX 3H1IJ 2O1KA 4IFFA 2H8PD 5GTIE 3CXHI 4OGQD 3CCVP 3BCCG 1RF0C 1S5LX 1IFPA 1X22A 1N8RQ 4H13C 2Y9ZA 3L36A 5AW1B 3AE4C 3AEBC 3AEGC 3L74E 2JWAA 3AE6C 4HB1A 2KLVA 2KZIA 2RH0A 2ZFCA 2P58A 1L0LE 1UIIA 3AEEC 1L4AD 1PFIA 2Q6QA 1CI6B 4GOEA 3G4SP 2CK3H 4H0LD 3GLMA 2QE7H 1EDIA 1K9MQ 1SQPJ 3VP8A 2FXMA 1M8OB 3H1IG 5KJ7A 2V7QH 3FWLA 1BDCA 2E76B 1PPJD 1JOCA 1VQ9P 1BDDA 4ASVA 3HTKA 2XNXA 5DJTB 4D6TE 2QIWA 3A0HH 2CPBA 1P84E 3FGAD 2BASA 3O6QA 1FZAA 1S9KE 3VRBC 1NTZD 1ZN5A 4JYBA 1KZUB 2WDQD 2HPCB 1CZQA 1YTZT 5APTA 2Z5HA 2B76D 3HRNA 1DD4A 1OX3A 1P84I 1KFYC 1SQPG 3PP5A 1NTKD 2W6AA 2E76C 1GTWA 1Y9BA 3BCCE 3H1LD 2OTKE 2KUBA 1U57A 2HR3A 4YT0D 1X0TA 4W7YA 1JO5A 1ZP0C 2NPSD 2BS4C 1IFMA 1PIXA 3L75D 1NEND 2WPVB 4I6MC 1QL1A 2YXQB 2M0BA 3JC22 1KFMA 4XE5B 2FFDA 2QRXA 2KOGA 4PV1B 3SWKA 4GKGA 1KFNA 3L71D 2K1AA 1BCCJ 3H1IE 1T3UA 1KQFB 2WDRC 3CI9A 3HTKB 2ZVOB 2JWDA 1DD3A 4WY4A 3RBZA 1H88A 4GDOA 1HTLC 2M3BA 3P8CE 3P4SC 2E5TA 5KLIB 1EDJA 3VMAA 1Q2NA 1QVGO 2XV5A 4DDGA 1VF5B 2E42A 4PV1C 4WBAA 1BGYD 4EIJA 2XU6A 3RL0g 5KJ7C 2WP9D 4DZOA 3AEDC 3MHVA 3AEFD 1SQPE 4C7NA 2JR8A 3E7KA 4CPGA 5E79E 3GG2A 1Q86Q 2YO3A 2Y0EA 5AVYB 1BCCG 1Y8AA 5AW5B 3WU2H 4RJTA 4AYCA 1G1JA 1T3JA 1SFCA 1Q7YQ 1KB9D 4BRYA 3A3YB 2LKMA 2RKLA 1CSBA 5CCHD 2FFDB 3Q2YA 3V6IA 3CWBJ 1HH0A 1JM0A 3PHLA 1SQXD 3SFED 2KSJA 1S3JA 2QM8A 2L5GB 4PJ0E 2YKQA 2WZ7A 2POHA 2YNYA 4WY4B 1SS1A 4JQ0D 4BXLA 1L0LK 5APWA 5TJHA 5KTBA 3CX5D 1AJYA 4H44B 2IYOA 3IR9A 4HKZH 4Z1MH 4WWIA 3AE1D 1KV4A 2I1KA 2WSFJ 1VQOP 3CCLP 2FFDC 2C0WA 1M90Q 2D2CD 3MTUE 3CWBG 4C7NB 3P4PC 2GA1A 1IK9A 1K8AQ 1MUUA 2JP3A 3Q5PA 2N9BA 1M1KQ 1BCCE 1RQUA 5CCGD 3M0AA 3M0DA 3D71A 1J1EB 4H44C 3S9OA 1VQ4P 2FYUJ 1SFCB 3B5ND 1L0VC 3U1AA 4BRYB 4ASWA 2IPPA 3D6ZA 1KF6D 1GW3A 4YSXC 1NWQA 2IZ0A 3IFMA 2R32A 2PP6A 4IL6X 3JCUE 3A0BH 1LWUA 4TT3H 1HJBA 1NO4A 3KPEA 2JJLA 2ITAA 3L37A 1KB9H 1S5LH 1SFCC 5AVRB 2C9NY 1YQ4C 1FC2C 3CIRC 3FX0A 2WQYD 1EC5A 2FYUG 2RMZA 1S72P 3EQ2A 1JY2P 1SQBJ 3L35A 1RQVA 4AQRD 1IFIA 1A02J 3KYQA 4N6JA 1L0ND 3CWBE 1BE3J 3PRJA 2BEQD 2HYNA 2HG5D 1PGPA 3L4FA 3AE5C 1LTIC 1MKMA 2I8DA 4UB8H 1GL2C 2ZAEB 1T6AA 4N78E 3VRAC 2V4HA 3VTPC 4DOJA 2FYNB 1EQ7A 2E74C 3FWNA 3LW5H 2AEMA 1S2EA 5AW2B 1ZR4A 2Y0DA 4KX6C 5KLVJ 3AE2C 3BATA 1LWUB 2QJPC 1FBMA 2K88A 2WMMA 1SQBG 1NTZK 4I7ZB 1K73Q 1KYOH 2WWWA 4K35A 4WB4A 1YITP 3HD7C 2AXTH 2FBWD 2HLOA 1BE3G 1NVOA 3EWKA 4YTMC 1LTJA 1U7MA 3M06A 3RGUA 2FYNC 2H88C 3OAKA 1NTKK 4XA4A 2WU5D 1T2KC 3M91A 2KYVA 2FYUE 1M56D 3SFDD 4ZKPA 1T8ZA 2W90A 1LWUC 4L75A 3KZIH 1E79H 4I7ZC 3L74D 2OYIA 5KLVG 1HGZA 1L0LD 3CMEP 3RL0D 1SLQA 1QEXA 1VQKP 1L4AA 2R5DA 2K9YA 1VQMP 5AW4B 3PLNA 2LXBA 2ZFYA 2YKOA 1IJDB 2V7QJ 3RK3B 4EDFA 4D6TD 3WUVA 1QLBC 2KS1A 2H89C 1P84D 1SQBE 1CI6A 1S9KD 2ZXXA 3RK2D 5KKZB 2K3RA 1OXZA 1N73C 1Z56A 4NPDA 2BCCJ 1OVVA 1BE3E 2WS3D 1SQQJ 1ZR2A 4EOTA 1OZHA 2QG4A 3PTZA 4PD4H 3C8VA 1AQ5A 1YHQP 3G6EP 2OARA 3MUDC 3CXHH 4JF7A 4YSZC 3SWFA 3RK3C 3BCCD 4OGQB 1YI2P 3AEAD 2J58A 4YXDD 2Q3IA 1FZCA 3M9QA 1BSNA 2E75D 5C2TC 2OYIB 2WSCH 2N1TD 1GK6A 1RHZB 5KKZC 1BSHA 1URQD 3D6YA 2AEFA 3M9HA 1SQVJ 2OYOA 5KLVE 2QM7A 4IOIH 4TLFA 1JY2O 3AE8D 3VYIA 4YXWH 2NPSA 1DH3A 4YTPC 5CJ4A 1SQXK 1E5WA 1L4AB 2BCCG 4H0LB 1SQQG 3CPWO 5AVQB 3H1ID 1QLED 4OGQC 4U3FJ 2XZRA 3AECD 1VQ7P 2KS1B 5AVUB 2OYIC 1HF9A 1MV8A 2SPZA 3TF5A 4K3AA 3P8CD 3HE5A 2QA4P 3AEED 1IK7A 1SQVG 5CJ0A 1L4AC 2WU2D 4H0LC 1GMJA 2J59M 3L72J 3CC7P 1JY2N 3N4XA 1RE3A 1W5CE 3R2PA 1SP4A 3L70J 3ZDMA 1RF1A 1FZCB 4U3FG 3V5BA 3W67A 2RN0A 5CBNA 4O9BA 1PGOA 2DW3A 4IL6H 3VMXA 3A0HE 2NPSB 4ZNCA 2Z5IA 2H43A 4M3LA 1TU3F 2FYZA 2Q5UA 1KILA 2BCCE 2FYUK 3V2NA 2B76C 2O01H 2R3CA 3TK1A 1SQQE 1W2EA 2PAJA 3P4QD 5CCHA 1H89A 3L72G 2NZ2A 3Q1MA 2B87A 1FZCC 2OYHA 5B66H 2KK7A 1VQ6P 3L70G 3L75J 2Q9IA 3AE7D 1OWAA 3PH0A 3HE5B 1AA0A 3CMAP 4YT0C 1NHLA 1EXIA 2YO2A 1NU1J 2NPSC 3WUTA 3ABVD 1VQLP 1SQVE 1KQLA 1YJNP 3T97A 2ZYAA 1L2PA 1L0NK 1LTSC 4ZKUA 2BEZF 1ZLLA 2WDRD 2OQQA 1U7JA 1RF1B 3VR9D 2PRRA 1BCCD 3CC2P 4U3FE 5BU8B 4YSYD 1ZXGA 3CCMP 3AE3C 4AUWA 1JUNA 3IN6A 1ZRTE 1HUCA 3L75G 3F89A 4U7JA 4YTND 1BGYJ 1N86A 3NTNA 1H8AA 3VR8D 1NU1G 1KILB 3U59A 5GTHH 3NFQA 2WDVD 3B5NA 3USSA 2A45G 3KXDA 1KQGB 1RE3C 1NYHA 4DT0A 2WP9C 2P7JA 1RF1C 2N9YB 3L72E 2B87B 3AEFC 2OYHB 1X8YA 1OVUA 2VRSA 3CLQA 3IF4A 3AE9D 5APVA 1PL5A 3L70E 3KHUA 1HJ0A 1VF5D 3HE4A 1EZVG 3VP9A 1KILC 3GW6A 3WU2E 3TSIA 2IDBA 3TGUJ 3T97B 1BGYG 1WT6A 5CCHC 5H2FH 1DIPA 3KQGA 5L8RJ 2ACZD 3IAOA 3SFEC 3O8ZA 2OYHC 1XTCC 4I2LC 4RO0A 3V2RA 1Y47A 2QJKB 4IFMA 1GL2A 5AW6B 3RBXA 1N7SA 4RESB 5B5EH 1J1DC 1NJIQ 2JO1A 3V4WA 1YTZI 5AVSB 4N78D 3L75E 3P4RD 1LT9A 2GM4A 3L73J 3AE1C 2IFNA 3H1HD 3B5NB 1M7LA 3GMAA 1NU1E 1FDOA 1G1IA 2M5AA 3LW5J 2FXOA 2M8RA 1HWTC 3TGUG 1RY3A 5KAFH 4WY4D 3CCEP 1YQ3D 1IO4A 3HD7A 1FS0E 4C7RA 2QJKC 3VMZA 2HODA 1ZMEC 2P67A 1FE6A 3F5HA 2XNDH 3I55P 5CCGC 1L0VD 2A45I 3WUUA 2ZXEB 3HE4B 3B5NC 2W83C 5AW8B 1EZVE 1SQQK 2KLUA 2FYUD 1LP1A 1S4XA 4L73A 3L73G 1BGYE 1KF6C 3GHGB 2YKPA 1JY3P 5APUA 3QH9A 3VMYA 1KORA 1TFFA 2IYPA 1GL2B 1J2JB 1EZVI 1N7SB 1VDFA 3A0BE 1AFOA 2Q7CA 5AW0B 1YQ4D 1RH5B 3H1JJ 3NXSA 1IFNA 1LT9B 1KILE 1FOSF 2E74B 2L91A 1EXJA 3E1IA 1S5LE 5AVXB 2WQYC 2M5AB 3GHGC 3JSVC 3SWYA 2QJPB 3CX5H 2JDIH 1H0TA 4Y99C 3CCUP 5KAIH 1N2DC 3TGUE 1LJ2A 3HD7B 1SQBD 1RE4A 1N73A 1FAVA 2HODB 5CHXA 3P8MC 1N7SC 5C39A 2CPSA 3LIEA 1BE3D 1PP9J 5BU5A 1W2BO 1LT9C 1JMMA 1M1JA 1SQPK 3MUDA 3H1JG 1NTMJ 2KP8A 4UB8E 3UIAA 1LP1B 1ZOYD 4IFDK 2C0XA 3L73E 3S1KA 1FOSE 5AW3B 2W27A 1HBWA 1USEA 2WSCJ 1LTAC 5KLVD 2IZ1A 1PZQA 5AW7B 3V2QA 2N1TA 3FXDA 2FBWC 2B88A 1KYOE 1PP9G 2AXTE 4A7PA 1A02F 2WU5C 1NAFA 1NTMG 3II6A 4DHZA 1H0TB 5TISH 2P2UA 1Q82Q 2ZYDA 2QJYB 4BWNA 4NPEA 1KYOI 5M1BA 1N73B 4UB6H 4I1LA 4FJVA 4L74A 2O01N 3KZIE 4C46A 1PGQA 3RK2B 3RL0C 4HH2A 3LIDA 1DX7A 2E43A 1M1JB 3H1KJ 2QVAA 3MP7B 1E7PC 3H1JE 1FU1A 3I5CA 2KNCA 2YMYA 2QJYC 2ZT9D 5C3JD 1RE4C 2IBZG 2WT7B 1OW6A 3CC4P 2N1TB 2R3SA 1NKZB 3RK2C 3TNUA 2IFMA 2P1JA 1M1JC 4NPFX 1SVFA 4EYYQ 1LTGC 2BCCD 1MFZA 1NH4A 1PP9E 1SQQD 2O01J 3H1KG 1G2CA 4W7ZA 4JPZB 1NEKD 4PD4E 1NTME 2WSEH 3C1LA 3A5TA 1EDLA 5C2TD 3AEAC 2NRGA 5GTIH 4YXDC 2XKMA 2QSIA 3CXHE 3CCSP 2N1TC 1URQC 1FDIA 4QMAA 1Q81Q 1JTHA 1JB0J 2A06G 1SQVD 3H25A 1VQ5P 1IZNB 4H13D 3AE4D 3W68A 3AEBD 3AEGD 2KNCB 4R4LA 1GD2E 3AE6D 1FJKA 1JY3N 2WPRA 3S4RA 3AECC 2C9LY 3BVHA 4U3FD 2O1JA 1LGHB 3MGNA 2IBZE 4RKUJ 1NKNA 1D7MA 1ZRTD 2O3JA 4JYCA 3GF3A 1YIJP 1HGVA 5AW9B 1KMIZ 3TNUB 4DHIB 1QGKB 2WTYA 1P84H 1SQPD 1K04A 5APQA 2WU2C 2IBZI 1G2CB 1NTZJ 3H1KE 2M3EA 1VQNP 3L72D 3VRBD 3MZWB 4OH8B 1NOHA 1OMIA 2W6BA 2PGDA 5APSA 1ZV8A 3L70D 4JBZA 2WDQC 4N3YB 1NTKJ 1KFYD 1FDMA 1JTHB 2KB7P 1JNMA 1ZW0A 3QWOC 3H1LJ 2E76D 3Q5SA 2Y9YA 4KHXA 2A06E 2ZYGA 3RK3E 2B9BA 2P10A 1PPJG 4LLHA 3VOPA 3D70A 4IL6E 2PFXA 1ZP0D 3P4QC 3HUSA 3CD6P 5DJUB 1NTZG 2KI7B 3VN0A 1WRGA 4KT0J 3P32A 1PV3A 1LTTC 4KJMA 2Q1KA 1NENC 3AE7C 1MFTA 5B66E 3L71J 5EFWB 1QX8A 4GOFA 3ABVC 1NTKG 1NU1D 3H6PA 3U1CA 3H1LG 1NAYA 2G3AA 1K05A 1SQBK 1X79B 1OIPA 3P4SD 1R5SA 1NGMB 1YJWP 3A2AA 2AXCA 4EI2A 5CCGA 2Y0CA 3Q5RA 4ZMDA 3AE3D 3VR9C 3O6QB 2KIKA 1S1CX 4PV1D 4YSYC 5KJ7D 5E79H 1GDTA 3AEDD 1N7LA 3OA7A 1EZVD 3L71G 4YTNC 2WPSA 3VR8C 1PPJE 1VQPP 2WDVC 2GUVA 1IFJA 2LXCB 1KN7A 1NTMK 2OTLP 4I6LA 1XTGB 3HUSB 5GTHE 5KLVK 2FXPA 2Q3EA 4DJGA 2ZJSE 4GODA 4W80A 1GU5A 3TYYA 1J1DB 1NTZE 3BRVB 3AE9C 5KLIC 1DEEG 2QEXP 2UWJE 1SQXJ 2B89A 5CMZA 3E1RA 1USDA 4PJ0H 1KILD 1VF5C 1IC2A 3A7OA 3GHGA 4LDTA 2E5YA 1KQSO 1FZFA 1NTKE 3CWBD 1AV1A 5AVWB 2D2CB 1WMKA 3H1LE 2KXPB 3HUSC 3TGUD 3CCRP 3Q3DA 2ACZC 5H2FE 4YPCA 1AVOA 2H7HA 2KZJA 2WSSH 4HYTB 3H1HJ 1SQXG 1FZBA 2A45H 3P4PD 3P4RC 5B5EE 3L71E 2D2CC 1OVRA 2WPQA 1VPCA 3I56P 1FZGA 1IFDA 3L73D 4LC1A 2YMKA 4H44D 4WY4C 1QL2A 3MD0A 1YQ3C 4OVNF 4DDIA 2KSEA 3CCJP 3H32A 1JCCA 3M9BA 5KAFE 1KYOD 4DHJA 4YSXD 3JCUH 3C9IA 1YYCA 3BRTB 3H1HG 3TDKA 4Y99B 3EFFK 4L76A 2WITA 1M57D 3G9RA 3G71P 1SFCD 1OW7A 1GW4A 1SQVK 2HFED 3CIRD 1J1EC 1Q90D 2BS2C 1PGJA 1KB9E 5K5GB 1KTMA 1L0NJ 1SQXE 3H1JD 2JEEA 2BS3C 1FZEA 2K37A 3AE5D 1KB9I 2OTJP 4MN4C 1GL2D 1N7SD 1JMBA 4B86A 3CX5E 3VRAD 2IX7C 3H32B 3OJAB 5KAIE 2WSFH 2XDJA 2GUSA 3PJSK 2E74D 3MIWA 3B71A 4OWFA 3WMM0 4KX6D 1PP9D 5AVVB 1FJPA 1VQ8P 3AE2D 3H1HE 3CX5I 1L0NG 3FXEA 4XFJA 4PD4D 1NTMD 3NMDA 1R5LA 1ZOYC 3HD7D 2WVRA 2WSEJ 2OGUA 2WT7A 4YTMD 3CXHD 1URQA 2H88D 1QVFO 3M0DC 3RL0B 1T2KD 4DCKA 2MJZA 4HJGH 3R4YA 1LT1A 1GZLA 3L74J 5APYA 1YJ9P 3SFDC 2J5UA 1RF0A 1L0LJ 2K9JA 2FY8A 3N7NA 4R4MA 3CCQP 1JEKA 5AVZB 3P7KA 2IBZD 3SSUA 2ZT9B 1GU4A 1MZ9A 5TISE 1KD1Q 3B8EB 1NU1K 1CW5A 5CBOA 2G8YA 4UB6E 3VONA 3V2PA 1LNQA 4D6TJ 4WVZA 1UIXA 1R8EA 2YXRB 2R5BA 1GK4A 3CL3D 5BVZA 3BASA 2H89D 1AVYA 2YIUB 3H1KD 3L74G 2JKVA 2I1JA 1KC8Q 1L0NE 4LGDE 1LTBC 1L0LG 5APXA 2W6JH 4GT1A 3GF7A 2LR2A 1YBKA 2E75B 2MKVA 2ZT9C 3EFGA 2AEJA 5C3JC 1URQB 1OW8A 1JY3O 1AQTA 2WS3C 1EDKA 3ITKA 3G3ZA 1LTJB 3BCCJ 4GIFA 2R44A 3OW2O 2ZVNB 2A06D 4YSZD 3RK3D 1JCDA 1VL2A 1X9VA 5AVTB 2YIUC 4D6TG 1HVVA
chains in the Genus database with same CATH topology
4H13D 4H0LC 2WU2D 3AEFD 4KT0J 3D71A 2E74C 4H13B 1GMJA 1PV3A 4H44C 3G9RA 3AE4D 3P4RD 3VR9D 3S9OA 2B76D 3AEBD 3AEGD 1DD4A 4R4LA 3AE6D 3AE1C 4KX6C 1NENC 2E75C 1L0VC 1OW7A 3AE7C 1NEKC 2D2CB 4YSYD 1WMKA 3GMAA 2WS3D 3AE3C 3AE2C 3D6ZA 2QJPC 3SFDC 1FDOA 1KFYC 3CIRD 2J5UA 1Q90D 3AECC 2BS2C 4YTPD 3LW5J 3IN6A 4I7ZB 2E76C 1ZRTE 1KF6D 1E7PC 3ABVC 4YSXC 3Q3DA 1Y9BA 3C8VA 4U7JA 3AE8C 4R4MA 4Y28J 4YTND 4RKUJ 2ACZC 2FBWD 1KTMA 1YQ3D 3VR8D 3EWKA 3GF3A 2G3AA 1U57A 2QJKC 2QJYC 4IL6X 2WDVD 4YTMC 1K05A 2ZT9D 4YSZC 4YT0D 4OGQD 1KMIZ 5C3JD 2ZT9B 2BS3C 4TT3H 4OGQB 1ZP0C 2FYNC 2H88C 1ZMEC 3P4SD 3Q2YA 2BS4C 3AEAD 1KQGB 1NYHA 1S5LX 2WU5D 4YXDD 2WP9C 1NGMB 1ZOYD 3AE5D 1PIXA 1K04A 3SFED 1NEND 2E75D 4H13C 1L0VD 2WU2C 3AEFC 1OW6A 5C2TC 1TU3F 2WPVB 5KKZC 2G8YA 3Q5RA 3D6YA 3P4PD 3AE4C 3AE3D 3P4RC 3VR9C 3SFDD 3AEBC 3AEGC 2B76C 3AE9D 3AE6C 2D2CC 1UIXA 1R8EA 1YQ4C 1S1CX 1PL5A 4PV1D 3P4QD 3VRBD 3VRAD 3AE8D 4YSYC 4PV1B 3CIRC 4I7ZC 2WSCJ 1OMIA 2H89D 2WQYD 4YTPC 3AEEC 2YMKA 3AEDD 1KF6C 1HJ0A 1VF5D 2NZ2A 3GLMA 4H0LD 3Q1MA 2E74D 1KQFB 4H0LB 2O01J 4H44D 3B71A 1AJYA 2WDRC 4YTNC 4H44B 2FBWC 4Z1MH 2WDQC 1KORA 1YQ3C 3VR8C 3AE1D 4KX6D 1NEKD 1DD3A 3AE7D 1RQVA 2WSFJ 3GF7A 2IDBA 2E75B 2MKVA 2WDVC 3T97B 2ZT9C 4GDOA 3AE2D 4YT0C 4OGQC 1KFYD 5C3JC 1EXIA 3AECD 5C2TD 2E76D 2BEQD 3Q5SA 3AEAC 3P4SC 1DIPA 4YSXD 2K9YA 3ABVD 2E76B 4YXDC 1OW8A 2FXPA 4XFJA 2WU5C 2QSIA 5L8RJ 1ZOYC 3AE5C 3RK3E 2P10A 2ACZD 2WS3C 2D2CD 3IAOA 1HF9A 3SFEC 1YQ4D 2WSEJ 1MKMA 3D70A 2QIWA 3P4PC 4YTMD 1FDIA 1VF5B 1KILE 2V7QJ 3AE9C 5KLIC 3AEED 2E74B 3FGAD 1IK7A 1EXJA 3O6QA 4YSZD 2JP3A 5M1BA 1JB0J 1ZP0D 2H88D 2BEZF 4PV1C 1VL2A 3H25A 3Q5PA 3P4QC 3VRBC 3VRAC 1QLBC 2WDRD 2YIUC 3RL0g 2WP9D 2H89C 2WQYC 1RQUA 2WDQD 2JO1A 2OQQA 3AEDC 3R4YA 1VF5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WU2 D;  3AEF D;  1PV3 A;  3AE4 D;  3P4R D;  3VR9 D;  3S9O A;  2B76 D;  3AEB D;  3AEG D;  3AE6 D;  3AE1 C;  4KX6 C;  1NEN C;  1L0V C;  1NEK C;  1OW7 A;  3AE7 C;  4YSY D;  2WS3 D;  3AE3 C;  3AE2 C;  1KFY C;  3CIR D;  3SFD C;  3AEC C;  2BS2 C;  4YTP D;  1KF6 D;  1E7P C;  3ABV C;  4YSX C;  3AE8 C;  4YTN D;  2ACZ C;  2FBW D;  1KTM A;  1YQ3 D;  3VR8 D;  2G3A A;  4YTM C;  2WDV D;  1K05 A;  4YSZ C;  4YT0 D;  5C3J D;  2BS3 C;  1ZP0 C;  2H88 C;  3P4S D;  3AEA D;  2BS4 C;  4YXD D;  2WU5 D;  2WP9 C;  1ZOY D;  3AE5 D;  1K04 A;  3SFE D;  1NEN D;  1L0V D;  2WU2 C;  5C2T C;  3AEF C;  1OW6 A;  3P4P D;  3AE4 C;  3AE3 D;  3P4R C;  3VR9 C;  3SFD D;  3AEB C;  3AEG C;  2B76 C;  3AE9 D;  3AE6 C;  1YQ4 C;  3VRA D;  4YSY C;  3P4Q D;  3VRB D;  3AE8 D;  3CIR C;  2H89 D;  2WQY D;  4YTP C;  3AEE C;  3AED D;  1KF6 C;  3B71 A;  2WDR C;  4YTN C;  2FBW C;  2WDQ C;  1YQ3 C;  3VR8 C;  3AE1 D;  4KX6 D;  1NEK D;  3AE7 D;  2WDV C;  3AE2 D;  4YT0 C;  1KFY D;  5C3J C;  3AEC D;  5C2T D;  3P4S C;  3AEA C;  4YSX D;  3ABV D;  4YXD C;  1OW8 A;  2WU5 C;  2WS3 C;  1ZOY C;  3AE5 C;  2ACZ D;  3SFE C;  1YQ4 D;  3P4P C;  4YTM D;  3AE9 C;  3AEE D;  4YSZ D;  1ZP0 D;  2H88 D;  3VRA C;  3P4Q C;  3VRB C;  1QLB C;  2WDR D;  2WP9 D;  2H89 C;  2WQY C;  2WDQ D;  3AED C; 
#chains in the Genus database with same CATH topology
 2K9J B;  3KDP B;  3V4Q A;  4H13 B;  3B4S A;  2E75 C;  2FKW B;  1NEK C;  3K5B A;  4YTP D;  2HPC A;  1DEB A;  4PD4 I;  3AE8 C;  2Z4E A;  4Y28 J;  2W8Z A;  1LTJ C;  1OFC X;  3H1I J;  2O1K A;  4IFF A;  2H8P D;  5GTI E;  3CXH I;  4OGQ D;  3CCV P;  3BCC G;  1RF0 C;  1S5L X;  1IFP A;  1X22 A;  1N8R Q;  4H13 C;  2Y9Z A;  3L36 A;  5AW1 B;  3AE4 C;  3AEB C;  3AEG C;  3L74 E;  2JWA A;  3AE6 C;  4HB1 A;  2KLV A;  2KZI A;  2RH0 A;  2ZFC A;  2P58 A;  1L0L E;  1UII A;  3AEE C;  1L4A D;  1PFI A;  2Q6Q A;  1CI6 B;  4GOE A;  3G4S P;  2CK3 H;  4H0L D;  3GLM A;  2QE7 H;  1EDI A;  1K9M Q;  1SQP J;  3VP8 A;  2FXM A;  1M8O B;  3H1I G;  5KJ7 A;  2V7Q H;  3FWL A;  1BDC A;  2E76 B;  1PPJ D;  1JOC A;  1VQ9 P;  1BDD A;  4ASV A;  3HTK A;  2XNX A;  5DJT B;  4D6T E;  2QIW A;  3A0H H;  2CPB A;  1P84 E;  3FGA D;  2BAS A;  3O6Q A;  1FZA A;  1S9K E;  3VRB C;  1NTZ D;  1ZN5 A;  4JYB A;  1KZU B;  2WDQ D;  2HPC B;  1CZQ A;  1YTZ T;  5APT A;  2Z5H A;  2B76 D;  3HRN A;  1DD4 A;  1OX3 A;  1P84 I;  1KFY C;  1SQP G;  3PP5 A;  1NTK D;  2W6A A;  2E76 C;  1GTW A;  1Y9B A;  3BCC E;  3H1L D;  2OTK E;  2KUB A;  1U57 A;  2HR3 A;  4YT0 D;  1X0T A;  4W7Y A;  1JO5 A;  1ZP0 C;  2NPS D;  2BS4 C;  1IFM A;  1PIX A;  3L75 D;  1NEN D;  2WPV B;  4I6M C;  1QL1 A;  2YXQ B;  2M0B A;  3JC2 2;  1KFM A;  4XE5 B;  2FFD A;  2QRX A;  2KOG A;  4PV1 B;  3SWK A;  4GKG A;  1KFN A;  3L71 D;  2K1A A;  1BCC J;  3H1I E;  1T3U A;  1KQF B;  2WDR C;  3CI9 A;  3HTK B;  2ZVO B;  2JWD A;  1DD3 A;  4WY4 A;  3RBZ A;  1H88 A;  4GDO A;  1HTL C;  2M3B A;  3P8C E;  3P4S C;  2E5T A;  5KLI B;  1EDJ A;  3VMA A;  1Q2N A;  1QVG O;  2XV5 A;  4DDG A;  1VF5 B;  2E42 A;  4PV1 C;  4WBA A;  1BGY D;  4EIJ A;  2XU6 A;  3RL0 g;  5KJ7 C;  2WP9 D;  4DZO A;  3AED C;  3MHV A;  3AEF D;  1SQP E;  4C7N A;  2JR8 A;  3E7K A;  4CPG A;  5E79 E;  3GG2 A;  1Q86 Q;  2YO3 A;  2Y0E A;  5AVY B;  1BCC G;  1Y8A A;  5AW5 B;  3WU2 H;  4RJT A;  4AYC A;  1G1J A;  1T3J A;  1SFC A;  1Q7Y Q;  1KB9 D;  4BRY A;  3A3Y B;  2LKM A;  2RKL A;  1CSB A;  5CCH D;  2FFD B;  3Q2Y A;  3V6I A;  3CWB J;  1HH0 A;  1JM0 A;  3PHL A;  1SQX D;  3SFE D;  2KSJ A;  1S3J A;  2QM8 A;  2L5G B;  4PJ0 E;  2YKQ A;  2WZ7 A;  2POH A;  2YNY A;  4WY4 B;  1SS1 A;  4JQ0 D;  4BXL A;  1L0L K;  5APW A;  5TJH A;  5KTB A;  3CX5 D;  1AJY A;  4H44 B;  2IYO A;  3IR9 A;  4HKZ H;  4Z1M H;  4WWI A;  3AE1 D;  1KV4 A;  2I1K A;  2WSF J;  1VQO P;  3CCL P;  2FFD C;  2C0W A;  1M90 Q;  2D2C D;  3MTU E;  3CWB G;  4C7N B;  3P4P C;  2GA1 A;  1IK9 A;  1K8A Q;  1MUU A;  2JP3 A;  3Q5P A;  2N9B A;  1M1K Q;  1BCC E;  1RQU A;  5CCG D;  3M0A A;  3M0D A;  3D71 A;  1J1E B;  4H44 C;  3S9O A;  1VQ4 P;  2FYU J;  1SFC B;  3B5N D;  1L0V C;  3U1A A;  4BRY B;  4ASW A;  2IPP A;  3D6Z A;  1KF6 D;  1GW3 A;  4YSX C;  1NWQ A;  2IZ0 A;  3IFM A;  2R32 A;  2PP6 A;  4IL6 X;  3JCU E;  3A0B H;  1LWU A;  4TT3 H;  1HJB A;  1NO4 A;  3KPE A;  2JJL A;  2ITA A;  3L37 A;  1KB9 H;  1S5L H;  1SFC C;  5AVR B;  2C9N Y;  1YQ4 C;  1FC2 C;  3CIR C;  3FX0 A;  2WQY D;  1EC5 A;  2FYU G;  2RMZ A;  1S72 P;  3EQ2 A;  1JY2 P;  1SQB J;  3L35 A;  1RQV A;  4AQR D;  1IFI A;  1A02 J;  3KYQ A;  4N6J A;  1L0N D;  3CWB E;  1BE3 J;  3PRJ A;  2BEQ D;  2HYN A;  2HG5 D;  1PGP A;  3L4F A;  3AE5 C;  1LTI C;  1MKM A;  2I8D A;  4UB8 H;  1GL2 C;  2ZAE B;  1T6A A;  4N78 E;  3VRA C;  2V4H A;  3VTP C;  4DOJ A;  2FYN B;  1EQ7 A;  2E74 C;  3FWN A;  3LW5 H;  2AEM A;  1S2E A;  5AW2 B;  1ZR4 A;  2Y0D A;  4KX6 C;  5KLV J;  3AE2 C;  3BAT A;  1LWU B;  2QJP C;  1FBM A;  2K88 A;  2WMM A;  1SQB G;  1NTZ K;  4I7Z B;  1K73 Q;  1KYO H;  2WWW A;  4K35 A;  4WB4 A;  1YIT P;  3HD7 C;  2AXT H;  2FBW D;  2HLO A;  1BE3 G;  1NVO A;  3EWK A;  4YTM C;  1LTJ A;  1U7M A;  3M06 A;  3RGU A;  2FYN C;  2H88 C;  3OAK A;  1NTK K;  4XA4 A;  2WU5 D;  1T2K C;  3M91 A;  2KYV A;  2FYU E;  1M56 D;  3SFD D;  4ZKP A;  1T8Z A;  2W90 A;  1LWU C;  4L75 A;  3KZI H;  1E79 H;  4I7Z C;  3L74 D;  2OYI A;  5KLV G;  1HGZ A;  1L0L D;  3CME P;  3RL0 D;  1SLQ A;  1QEX A;  1VQK P;  1L4A A;  2R5D A;  2K9Y A;  1VQM P;  5AW4 B;  3PLN A;  2LXB A;  2ZFY A;  2YKO A;  1IJD B;  2V7Q J;  3RK3 B;  4EDF A;  4D6T D;  3WUV A;  1QLB C;  2KS1 A;  2H89 C;  1P84 D;  1SQB E;  1CI6 A;  1S9K D;  2ZXX A;  3RK2 D;  5KKZ B;  2K3R A;  1OXZ A;  1N73 C;  1Z56 A;  4NPD A;  2BCC J;  1OVV A;  1BE3 E;  2WS3 D;  1SQQ J;  1ZR2 A;  4EOT A;  1OZH A;  2QG4 A;  3PTZ A;  4PD4 H;  3C8V A;  1AQ5 A;  1YHQ P;  3G6E P;  2OAR A;  3MUD C;  3CXH H;  4JF7 A;  4YSZ C;  3SWF A;  3RK3 C;  3BCC D;  4OGQ B;  1YI2 P;  3AEA D;  2J58 A;  4YXD D;  2Q3I A;  1FZC A;  3M9Q A;  1BSN A;  2E75 D;  5C2T C;  2OYI B;  2WSC H;  2N1T D;  1GK6 A;  1RHZ B;  5KKZ C;  1BSH A;  1URQ D;  3D6Y A;  2AEF A;  3M9H A;  1SQV J;  2OYO A;  5KLV E;  2QM7 A;  4IOI H;  4TLF A;  1JY2 O;  3AE8 D;  3VYI A;  4YXW H;  2NPS A;  1DH3 A;  4YTP C;  5CJ4 A;  1SQX K;  1E5W A;  1L4A B;  2BCC G;  4H0L B;  1SQQ G;  3CPW O;  5AVQ B;  3H1I D;  1QLE D;  4OGQ C;  4U3F J;  2XZR A;  3AEC D;  1VQ7 P;  2KS1 B;  5AVU B;  2OYI C;  1HF9 A;  1MV8 A;  2SPZ A;  3TF5 A;  4K3A A;  3P8C D;  3HE5 A;  2QA4 P;  3AEE D;  1IK7 A;  1SQV G;  5CJ0 A;  1L4A C;  2WU2 D;  4H0L C;  1GMJ A;  2J59 M;  3L72 J;  3CC7 P;  1JY2 N;  3N4X A;  1RE3 A;  1W5C E;  3R2P A;  1SP4 A;  3L70 J;  3ZDM A;  1RF1 A;  1FZC B;  4U3F G;  3V5B A;  3W67 A;  2RN0 A;  5CBN A;  4O9B A;  1PGO A;  2DW3 A;  4IL6 H;  3VMX A;  3A0H E;  2NPS B;  4ZNC A;  2Z5I A;  2H43 A;  4M3L A;  1TU3 F;  2FYZ A;  2Q5U A;  1KIL A;  2BCC E;  2FYU K;  3V2N A;  2B76 C;  2O01 H;  2R3C A;  3TK1 A;  1SQQ E;  1W2E A;  2PAJ A;  3P4Q D;  5CCH A;  1H89 A;  3L72 G;  2NZ2 A;  3Q1M A;  2B87 A;  1FZC C;  2OYH A;  5B66 H;  2KK7 A;  1VQ6 P;  3L70 G;  3L75 J;  2Q9I A;  3AE7 D;  1OWA A;  3PH0 A;  3HE5 B;  1AA0 A;  3CMA P;  4YT0 C;  1NHL A;  1EXI A;  2YO2 A;  1NU1 J;  2NPS C;  3WUT A;  3ABV D;  1VQL P;  1SQV E;  1KQL A;  1YJN P;  3T97 A;  2ZYA A;  1L2P A;  1L0N K;  1LTS C;  4ZKU A;  2BEZ F;  1ZLL A;  2WDR D;  2OQQ A;  1U7J A;  1RF1 B;  3VR9 D;  2PRR A;  1BCC D;  3CC2 P;  4U3F E;  5BU8 B;  4YSY D;  1ZXG A;  3CCM P;  3AE3 C;  4AUW A;  1JUN A;  3IN6 A;  1ZRT E;  1HUC A;  3L75 G;  3F89 A;  4U7J A;  4YTN D;  1BGY J;  1N86 A;  3NTN A;  1H8A A;  3VR8 D;  1NU1 G;  1KIL B;  3U59 A;  5GTH H;  3NFQ A;  2WDV D;  3B5N A;  3USS A;  2A45 G;  3KXD A;  1KQG B;  1RE3 C;  1NYH A;  4DT0 A;  2WP9 C;  2P7J A;  1RF1 C;  2N9Y B;  3L72 E;  2B87 B;  3AEF C;  2OYH B;  1X8Y A;  1OVU A;  2VRS A;  3CLQ A;  3IF4 A;  3AE9 D;  5APV A;  1PL5 A;  3L70 E;  3KHU A;  1HJ0 A;  1VF5 D;  3HE4 A;  1EZV G;  3VP9 A;  1KIL C;  3GW6 A;  3WU2 E;  3TSI A;  2IDB A;  3TGU J;  3T97 B;  1BGY G;  1WT6 A;  5CCH C;  5H2F H;  1DIP A;  3KQG A;  5L8R J;  2ACZ D;  3IAO A;  3SFE C;  3O8Z A;  2OYH C;  1XTC C;  4I2L C;  4RO0 A;  3V2R A;  1Y47 A;  2QJK B;  4IFM A;  1GL2 A;  5AW6 B;  3RBX A;  1N7S A;  4RES B;  5B5E H;  1J1D C;  1NJI Q;  2JO1 A;  3V4W A;  1YTZ I;  5AVS B;  4N78 D;  3L75 E;  3P4R D;  1LT9 A;  2GM4 A;  3L73 J;  3AE1 C;  2IFN A;  3H1H D;  3B5N B;  1M7L A;  3GMA A;  1NU1 E;  1FDO A;  1G1I A;  2M5A A;  3LW5 J;  2FXO A;  2M8R A;  1HWT C;  3TGU G;  1RY3 A;  5KAF H;  4WY4 D;  3CCE P;  1YQ3 D;  1IO4 A;  3HD7 A;  1FS0 E;  4C7R A;  2QJK C;  3VMZ A;  2HOD A;  1ZME C;  2P67 A;  1FE6 A;  3F5H A;  2XND H;  3I55 P;  5CCG C;  1L0V D;  2A45 I;  3WUU A;  2ZXE B;  3HE4 B;  3B5N C;  2W83 C;  5AW8 B;  1EZV E;  1SQQ K;  2KLU A;  2FYU D;  1LP1 A;  1S4X A;  4L73 A;  3L73 G;  1BGY E;  1KF6 C;  3GHG B;  2YKP A;  1JY3 P;  5APU A;  3QH9 A;  3VMY A;  1KOR A;  1TFF A;  2IYP A;  1GL2 B;  1J2J B;  1EZV I;  1N7S B;  1VDF A;  3A0B E;  1AFO A;  2Q7C A;  5AW0 B;  1YQ4 D;  1RH5 B;  3H1J J;  3NXS A;  1IFN A;  1LT9 B;  1KIL E;  1FOS F;  2E74 B;  2L91 A;  1EXJ A;  3E1I A;  1S5L E;  5AVX B;  2WQY C;  2M5A B;  3GHG C;  3JSV C;  3SWY A;  2QJP B;  3CX5 H;  2JDI H;  1H0T A;  4Y99 C;  3CCU P;  5KAI H;  1N2D C;  3TGU E;  1LJ2 A;  3HD7 B;  1SQB D;  1RE4 A;  1N73 A;  1FAV A;  2HOD B;  5CHX A;  3P8M C;  1N7S C;  5C39 A;  2CPS A;  3LIE A;  1BE3 D;  1PP9 J;  5BU5 A;  1W2B O;  1LT9 C;  1JMM A;  1M1J A;  1SQP K;  3MUD A;  3H1J G;  1NTM J;  2KP8 A;  4UB8 E;  3UIA A;  1LP1 B;  1ZOY D;  4IFD K;  2C0X A;  3L73 E;  3S1K A;  1FOS E;  5AW3 B;  2W27 A;  1HBW A;  1USE A;  2WSC J;  1LTA C;  5KLV D;  2IZ1 A;  1PZQ A;  5AW7 B;  3V2Q A;  2N1T A;  3FXD A;  2FBW C;  2B88 A;  1KYO E;  1PP9 G;  2AXT E;  4A7P A;  1A02 F;  2WU5 C;  1NAF A;  1NTM G;  3II6 A;  4DHZ A;  1H0T B;  5TIS H;  2P2U A;  1Q82 Q;  2ZYD A;  2QJY B;  4BWN A;  4NPE A;  1KYO I;  5M1B A;  1N73 B;  4UB6 H;  4I1L A;  4FJV A;  4L74 A;  2O01 N;  3KZI E;  4C46 A;  1PGQ A;  3RK2 B;  3RL0 C;  4HH2 A;  3LID A;  1DX7 A;  2E43 A;  1M1J B;  3H1K J;  2QVA A;  3MP7 B;  1E7P C;  3H1J E;  1FU1 A;  3I5C A;  2KNC A;  2YMY A;  2QJY C;  2ZT9 D;  5C3J D;  1RE4 C;  2IBZ G;  2WT7 B;  1OW6 A;  3CC4 P;  2N1T B;  2R3S A;  1NKZ B;  3RK2 C;  3TNU A;  2IFM A;  2P1J A;  1M1J C;  4NPF X;  1SVF A;  4EYY Q;  1LTG C;  2BCC D;  1MFZ A;  1NH4 A;  1PP9 E;  1SQQ D;  2O01 J;  3H1K G;  1G2C A;  4W7Z A;  4JPZ B;  1NEK D;  4PD4 E;  1NTM E;  2WSE H;  3C1L A;  3A5T A;  1EDL A;  5C2T D;  3AEA C;  2NRG A;  5GTI H;  4YXD C;  2XKM A;  2QSI A;  3CXH E;  3CCS P;  2N1T C;  1URQ C;  1FDI A;  4QMA A;  1Q81 Q;  1JTH A;  1JB0 J;  2A06 G;  1SQV D;  3H25 A;  1VQ5 P;  1IZN B;  4H13 D;  3AE4 D;  3W68 A;  3AEB D;  3AEG D;  2KNC B;  4R4L A;  1GD2 E;  3AE6 D;  1FJK A;  1JY3 N;  2WPR A;  3S4R A;  3AEC C;  2C9L Y;  3BVH A;  4U3F D;  2O1J A;  1LGH B;  3MGN A;  2IBZ E;  4RKU J;  1NKN A;  1D7M A;  1ZRT D;  2O3J A;  4JYC A;  3GF3 A;  1YIJ P;  1HGV A;  5AW9 B;  1KMI Z;  3TNU B;  4DHI B;  1QGK B;  2WTY A;  1P84 H;  1SQP D;  1K04 A;  5APQ A;  2WU2 C;  2IBZ I;  1G2C B;  1NTZ J;  3H1K E;  2M3E A;  1VQN P;  3L72 D;  3VRB D;  3MZW B;  4OH8 B;  1NOH A;  1OMI A;  2W6B A;  2PGD A;  5APS A;  1ZV8 A;  3L70 D;  4JBZ A;  2WDQ C;  4N3Y B;  1NTK J;  1KFY D;  1FDM A;  1JTH B;  2KB7 P;  1JNM A;  1ZW0 A;  3QWO C;  3H1L J;  2E76 D;  3Q5S A;  2Y9Y A;  4KHX A;  2A06 E;  2ZYG A;  3RK3 E;  2B9B A;  2P10 A;  1PPJ G;  4LLH A;  3VOP A;  3D70 A;  4IL6 E;  2PFX A;  1ZP0 D;  3P4Q C;  3HUS A;  3CD6 P;  5DJU B;  1NTZ G;  2KI7 B;  3VN0 A;  1WRG A;  4KT0 J;  3P32 A;  1PV3 A;  1LTT C;  4KJM A;  2Q1K A;  1NEN C;  3AE7 C;  1MFT A;  5B66 E;  3L71 J;  5EFW B;  1QX8 A;  4GOF A;  3ABV C;  1NTK G;  1NU1 D;  3H6P A;  3U1C A;  3H1L G;  1NAY A;  2G3A A;  1K05 A;  1SQB K;  1X79 B;  1OIP A;  3P4S D;  1R5S A;  1NGM B;  1YJW P;  3A2A A;  2AXC A;  4EI2 A;  5CCG A;  2Y0C A;  3Q5R A;  4ZMD A;  3AE3 D;  3VR9 C;  3O6Q B;  2KIK A;  1S1C X;  4PV1 D;  4YSY C;  5KJ7 D;  5E79 H;  1GDT A;  3AED D;  1N7L A;  3OA7 A;  1EZV D;  3L71 G;  4YTN C;  2WPS A;  3VR8 C;  1PPJ E;  1VQP P;  2WDV C;  2GUV A;  1IFJ A;  2LXC B;  1KN7 A;  1NTM K;  2OTL P;  4I6L A;  1XTG B;  3HUS B;  5GTH E;  5KLV K;  2FXP A;  2Q3E A;  4DJG A;  2ZJS E;  4GOD A;  4W80 A;  1GU5 A;  3TYY A;  1J1D B;  1NTZ E;  3BRV B;  3AE9 C;  5KLI C;  1DEE G;  2QEX P;  2UWJ E;  1SQX J;  2B89 A;  5CMZ A;  3E1R A;  1USD A;  4PJ0 H;  1KIL D;  1VF5 C;  1IC2 A;  3A7O A;  3GHG A;  4LDT A;  2E5Y A;  1KQS O;  1FZF A;  1NTK E;  3CWB D;  1AV1 A;  5AVW B;  2D2C B;  1WMK A;  3H1L E;  2KXP B;  3HUS C;  3TGU D;  3CCR P;  3Q3D A;  2ACZ C;  5H2F E;  4YPC A;  1AVO A;  2H7H A;  2KZJ A;  2WSS H;  4HYT B;  3H1H J;  1SQX G;  1FZB A;  2A45 H;  3P4P D;  3P4R C;  5B5E E;  3L71 E;  2D2C C;  1OVR A;  2WPQ A;  1VPC A;  3I56 P;  1FZG A;  1IFD A;  3L73 D;  4LC1 A;  2YMK A;  4H44 D;  4WY4 C;  1QL2 A;  3MD0 A;  1YQ3 C;  4OVN F;  4DDI A;  2KSE A;  3CCJ P;  3H32 A;  1JCC A;  3M9B A;  5KAF E;  1KYO D;  4DHJ A;  4YSX D;  3JCU H;  3C9I A;  1YYC A;  3BRT B;  3H1H G;  3TDK A;  4Y99 B;  3EFF K;  4L76 A;  2WIT A;  1M57 D;  3G9R A;  3G71 P;  1SFC D;  1OW7 A;  1GW4 A;  1SQV K;  2HFE D;  3CIR D;  1J1E C;  1Q90 D;  2BS2 C;  1PGJ A;  1KB9 E;  5K5G B;  1KTM A;  1L0N J;  1SQX E;  3H1J D;  2JEE A;  2BS3 C;  1FZE A;  2K37 A;  3AE5 D;  1KB9 I;  2OTJ P;  4MN4 C;  1GL2 D;  1N7S D;  1JMB A;  4B86 A;  3CX5 E;  3VRA D;  2IX7 C;  3H32 B;  3OJA B;  5KAI E;  2WSF H;  2XDJ A;  2GUS A;  3PJS K;  2E74 D;  3MIW A;  3B71 A;  4OWF A;  3WMM 0;  4KX6 D;  1PP9 D;  5AVV B;  1FJP A;  1VQ8 P;  3AE2 D;  3H1H E;  3CX5 I;  1L0N G;  3FXE A;  4XFJ A;  4PD4 D;  1NTM D;  3NMD A;  1R5L A;  1ZOY C;  3HD7 D;  2WVR A;  2WSE J;  2OGU A;  2WT7 A;  4YTM D;  3CXH D;  1URQ A;  2H88 D;  1QVF O;  3M0D C;  3RL0 B;  1T2K D;  4DCK A;  2MJZ A;  4HJG H;  3R4Y A;  1LT1 A;  1GZL A;  3L74 J;  5APY A;  1YJ9 P;  3SFD C;  2J5U A;  1RF0 A;  1L0L J;  2K9J A;  2FY8 A;  3N7N A;  4R4M A;  3CCQ P;  1JEK A;  5AVZ B;  3P7K A;  2IBZ D;  3SSU A;  2ZT9 B;  1GU4 A;  1MZ9 A;  5TIS E;  1KD1 Q;  3B8E B;  1NU1 K;  1CW5 A;  5CBO A;  2G8Y A;  4UB6 E;  3VON A;  3V2P A;  1LNQ A;  4D6T J;  4WVZ A;  1UIX A;  1R8E A;  2YXR B;  2R5B A;  1GK4 A;  3CL3 D;  5BVZ A;  3BAS A;  2H89 D;  1AVY A;  2YIU B;  3H1K D;  3L74 G;  2JKV A;  2I1J A;  1KC8 Q;  1L0N E;  4LGD E;  1LTB C;  1L0L G;  5APX A;  2W6J H;  4GT1 A;  3GF7 A;  2LR2 A;  1YBK A;  2E75 B;  2MKV A;  2ZT9 C;  3EFG A;  2AEJ A;  5C3J C;  1URQ B;  1OW8 A;  1JY3 O;  1AQT A;  2WS3 C;  1EDK A;  3ITK A;  3G3Z A;  1LTJ B;  3BCC J;  4GIF A;  2R44 A;  3OW2 O;  2ZVN B;  2A06 D;  4YSZ D;  3RK3 D;  1JCD A;  1VL2 A;  1X9V A;  5AVT B;  2YIU C;  4D6T G;  1HVV A; 
#chains in the Genus database with same CATH homology
 4H13 D;  4H0L C;  2WU2 D;  3AEF D;  4KT0 J;  3D71 A;  2E74 C;  4H13 B;  1GMJ A;  1PV3 A;  4H44 C;  3G9R A;  3AE4 D;  3P4R D;  3VR9 D;  3S9O A;  2B76 D;  3AEB D;  3AEG D;  1DD4 A;  4R4L A;  3AE6 D;  3AE1 C;  4KX6 C;  1NEN C;  2E75 C;  1L0V C;  1OW7 A;  3AE7 C;  1NEK C;  2D2C B;  4YSY D;  1WMK A;  3GMA A;  2WS3 D;  3AE3 C;  3AE2 C;  3D6Z A;  2QJP C;  3SFD C;  1FDO A;  1KFY C;  3CIR D;  2J5U A;  1Q90 D;  3AEC C;  2BS2 C;  4YTP D;  3LW5 J;  3IN6 A;  4I7Z B;  2E76 C;  1ZRT E;  1KF6 D;  1E7P C;  3ABV C;  4YSX C;  3Q3D A;  1Y9B A;  3C8V A;  4U7J A;  3AE8 C;  4R4M A;  4Y28 J;  4YTN D;  4RKU J;  2ACZ C;  2FBW D;  1KTM A;  1YQ3 D;  3VR8 D;  3EWK A;  3GF3 A;  2G3A A;  1U57 A;  2QJK C;  2QJY C;  4IL6 X;  2WDV D;  4YTM C;  1K05 A;  2ZT9 D;  4YSZ C;  4YT0 D;  4OGQ D;  1KMI Z;  5C3J D;  2ZT9 B;  2BS3 C;  4TT3 H;  4OGQ B;  1ZP0 C;  2FYN C;  2H88 C;  1ZME C;  3P4S D;  3Q2Y A;  2BS4 C;  3AEA D;  1KQG B;  1NYH A;  1S5L X;  2WU5 D;  4YXD D;  2WP9 C;  1NGM B;  1ZOY D;  3AE5 D;  1PIX A;  1K04 A;  3SFE D;  1NEN D;  2E75 D;  4H13 C;  1L0V D;  2WU2 C;  3AEF C;  1OW6 A;  5C2T C;  1TU3 F;  2WPV B;  5KKZ C;  2G8Y A;  3Q5R A;  3D6Y A;  3P4P D;  3AE4 C;  3AE3 D;  3P4R C;  3VR9 C;  3SFD D;  3AEB C;  3AEG C;  2B76 C;  3AE9 D;  3AE6 C;  2D2C C;  1UIX A;  1R8E A;  1YQ4 C;  1S1C X;  1PL5 A;  4PV1 D;  3P4Q D;  3VRB D;  3VRA D;  3AE8 D;  4YSY C;  4PV1 B;  3CIR C;  4I7Z C;  2WSC J;  1OMI A;  2H89 D;  2WQY D;  4YTP C;  3AEE C;  2YMK A;  3AED D;  1KF6 C;  1HJ0 A;  1VF5 D;  2NZ2 A;  3GLM A;  4H0L D;  3Q1M A;  2E74 D;  1KQF B;  4H0L B;  2O01 J;  4H44 D;  3B71 A;  1AJY A;  2WDR C;  4YTN C;  4H44 B;  2FBW C;  4Z1M H;  2WDQ C;  1KOR A;  1YQ3 C;  3VR8 C;  3AE1 D;  4KX6 D;  1NEK D;  1DD3 A;  3AE7 D;  1RQV A;  2WSF J;  3GF7 A;  2IDB A;  2E75 B;  2MKV A;  2WDV C;  3T97 B;  2ZT9 C;  4GDO A;  3AE2 D;  4YT0 C;  4OGQ C;  1KFY D;  5C3J C;  1EXI A;  3AEC D;  5C2T D;  2E76 D;  2BEQ D;  3Q5S A;  3AEA C;  3P4S C;  1DIP A;  4YSX D;  2K9Y A;  3ABV D;  2E76 B;  4YXD C;  1OW8 A;  2FXP A;  4XFJ A;  2WU5 C;  2QSI A;  5L8R J;  1ZOY C;  3AE5 C;  3RK3 E;  2P10 A;  2ACZ D;  2WS3 C;  2D2C D;  3IAO A;  1HF9 A;  3SFE C;  1YQ4 D;  2WSE J;  1MKM A;  3D70 A;  2QIW A;  3P4P C;  4YTM D;  1FDI A;  1VF5 B;  1KIL E;  2V7Q J;  3AE9 C;  5KLI C;  3AEE D;  2E74 B;  3FGA D;  1IK7 A;  1EXJ A;  3O6Q A;  4YSZ D;  2JP3 A;  5M1B A;  1JB0 J;  1ZP0 D;  2H88 D;  2BEZ F;  4PV1 C;  1VL2 A;  3H25 A;  3Q5P A;  3P4Q C;  3VRB C;  3VRA C;  1QLB C;  2WDR D;  2YIU C;  3RL0 g;  2WP9 D;  2H89 C;  2WQY C;  1RQU A;  2WDQ D;  2JO1 A;  2OQQ A;  3AED C;  3R4Y A;  1VF5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...