3AEAC

Crystal structure of porcine heart mitochondrial complex ii bound with n-(3-dimethylaminomethyl-phenyl)-2-trifluoromethyl-benzamide
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
138
structure length
138
Chain Sequence
TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
total genus 47
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3aeaC01
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3aeaC02
2H88C 3AEAC 2WQYC 3SFED 1YQ4C 3AEDC 4YSZC 4YTPD 3P4QD 1OW8A 3VR8C 1KFYD 1ZP0D 3AECD 3AE7D 3AE2C 1OW7A 2WDVC 1NEND 3ABVD 2WU5C 4YT0D 1K04A 3AE3C 3AE8D 2ACZD 2BS4C 3AEEC 2G3AA 2B76C 1QLBC 3P4RD 4KX6D 3AE6D 3B71A 3SFEC 3AE1D 3AEBD 2WU2D 3AE9D 4YTPC 3P4QC 3AEGD 2WP9D 1K05A 1KFYC 3P4SC 3AE7C 5C3JD 4YSYD 3VR9D 1NENC 4YXDD 1ZOYD 1KTMA 3ABVC 4YT0C 3AE8C 2H89D 2WQYD 3AE5C 1L0VD 2BS3C 3P4PD 2BS2C 3P4RC 3AE6C 3CIRD 4YTND 3AE1C 3AEBC 2WU2C 3AE9C 4YSXD 3AEFD 2WDVD 3AEGC 1NEKD 2WP9C 1ZP0C 3AECC 2WDQD 5C3JC 4YTMD 1OW6A 3VRAD 1YQ3D 3VR9C 4YSYC 3AE4D 3VRBD 3S9OA 4YXDC 5C2TD 1ZOYC 2FBWD 1KF6D 3SFDD 2H89C 2WDRD 2ACZC 2WS3D 2H88D 3AEAD 1YQ4D 1L0VC 3AEDD 4YSZD 1PV3A 3P4PC 4KX6C 3VR8D 3CIRC 4YTNC 3P4SD 3AE2D 4YSXC 3AEFC 1NEKC 2WDQC 4YTMC 2WU5D 3VRAC 1YQ3C 3AE3D 3AE4C 3VRBC 3AEED 3AE5D 5C2TC 2FBWC 2B76D 1KF6C 1E7PC 3SFDC 2WDRC 2WS3C
chains in the Genus database with same CATH superfamily
4N6JA 1LTAC 5KTBA 2A06E 1KFYD 3KZIH 1PGJA 3MP7B 1KB9H 3L35A 2BS4C 3AEEC 5M1BA 3V2RA 1SQXE 2NPSA 1KILE 2NRGA 4Y28J 2Q7CA 1NTMD 1VQ9P 4YTPC 1OX3A 2O01H 3P4QC 2NPSC 3CWBD 1ZXGA 3CCVP 3SWKA 1YITP 3T97A 2FFDA 4PV1B 2N9BA 4YT0C 4C7RA 2E5YA 3AE8C 1XTCC 4I6MC 1KQGB 1FZGA 3P4PD 1VQ8P 3P4RC 2FFDC 3CIRD 3L73J 4N78E 2DW3A 4EDFA 3U1AA 1X8YA 2OYHB 3C9IA 1YQ3D 4YSYC 1L0LG 5C2TD 2E75C 4ZKUA 2B87B 1PV3A 5AVXB 2QG4A 1NTKE 2HODB 5AW0B 5KAFH 3P8CE 3I55P 3L74G 1ZR2A 3L72G 3CCQP 2ZJSE 1J1EB 3V4WA 4PJ0E 3G71P 2WS3C 1T8ZA 3AEDC 1CSBA 2HFED 3NFQA 2M8RA 3H1HJ 2WDVC 2D2CD 5E79H 3H6PA 1LTGC 1N7SB 5APSA 2G3AA 4C7NB 3H1LG 3GMAA 1QLBC 1U57A 4UB6E 4I7ZB 3VONA 1N73C 1KILB 2HG5D 1NTME 1N7LA 1VDFA 3OW2O 5EFWB 3AE7C 3CWBE 4YXWH 2W27A 2WWWA 2BASA 5CCHC 1BE3J 1YJNP 1NO4A 2FY8A 2KI7B 4BWNA 2Q9IA 2WITA 1NWQA 4LDTA 3ABVC 2IPPA 1IFIA 3AE5C 5AW9B 1LWUB 4U3FJ 3CCLP 3HD7C 5B5EH 3E1IA 1M1KQ 1S3JA 2P58A 2C9LY 2MKVA 3H32B 3AEGC 4DHJA 1ZP0C 2GA1A 1KYOI 2KUBA 2WSCH 1E5WA 3W68A 2K9JA 5AVVB 1QVGO 2E43A 1NTZK 5CHXA 1KF6D 1S72P 1R5LA 3U59A 1CW5A 2NZ2A 5TJHA 1JEKA 4UB8E 1Q82Q 3L71G 4KX6C 1RF1C 3L75D 4WVZA 2AEJA 4AUWA 1NEKC 4ASVA 4NPFX 3I5CA 4DHZA 2AXTE 2L91A 1HGZA 3NXSA 3FGAD 5KLVK 3RK2D 2H88C 3IN6A 3H1LD 1N86A 4YPCA 3PTZA 1LTJB 3AE2C 3CLQA 2WPQA 2E74C 2FYNC 5CBOA 1NVOA 3N7NA 3FXDA 5TISE 1NJIQ 2WPRA 1L2PA 1K9MQ 4OVNF 2KS1B 1T2KD 5CBNA 1M57D 3RK3C 2WZ7A 1KB9D 1SQBG 1QEXA 5BU8B 1Q81Q 1RE3A 3R2PA 1GL2C 4U7JA 1URQB 2Z5IA 3AE1C 5DJTB 3IF4A 3MUDA 3L71D 4PD4I 3VYIA 4RO0A 4PV1C 3AECC 4HYTB 3SSUA 1GW3A 2KXPB 3H25A 3MUDC 2K37A 3PP5A 2OYHA 3KYQA 2OYOA 2J5UA 3ZDMA 2JR8A 1L0VC 2PFXA 2E42A 3OA7A 5B66E 1RE4C 3CCEP 3H1JG 2XKMA 2B87A 3L75E 3L70G 1M56D 4ASWA 2WDQC 2MJZA 1VPCA 2HODA 3BATA 3VRAC 3CX5D 3LW5J 2SPZA 1J1DC 1W2EA 1T3JA 1LJ2A 1SQVD 3V2PA 3A3YB 1KMIZ 2B89A 3H1LE 1PGOA 2BEZF 3L36A 4H44D 1S2EA 3I56P 1LP1B 1SQBD 4KJMA 1IFJA 2D2CB 2LKMA 2RMZA 5AW8B 1LTBC 4R4LA 1N7SA 3AEBD 4H0LB 4W7YA 1A02F 5APVA 2IFNA 1KYOH 1M1JC 3KZIE 1N7SC 1FDOA 1KILA 1PFIA 1KB9E 4BRYB 1TFFA 1J2JB 3A0BH 2H89D 4JYCA 1EDIA 1Q7YQ 2M5AB 4I6LA 1JCCA 2YIUB 2A06G 3A0HH 2BEQD 1PIXA 3TGUJ 3S1KA 1BDDA 1VQ6P 5C39A 4YSXD 1LWUA 1H8AA 3L71E 1NTZJ 3H1JD 2IBZI 3MHVA 3L70D 3H32A 2K9YA 2W8ZA 2QJKB 2QSIA 3RL0C 3VTPC 1HTLC 1FOSE 2XU6A 3EFGA 2BCCJ 5KLVJ 2FYUG 2XDJA 3O8ZA 3SFDC 3V2QA 2IZ0A 3CX5E 3HUSB 1YHQP 3C1LA 1JY2N 1NAYA 2FYZA 1IFPA 4WY4C 1SQXK 4HB1A 4RESB 1SQVE 3VR8C 1PP9J 1YJ9P 2A45G 3BRTB 3Q5RA 1LTJA 4WB4A 1AQTA 3EWKA 1SQBE 1FC2C 1IZNB 1UIXA 1ZW0A 5L8RJ 2K1AA 1SQQK 2WU2D 1USDA 4GIFA 2VRSA 1KFYC 1OZHA 3UIAA 2KS1A 1YI2P 3VMAA 1VQOP 1ZOYD 4W80A 1JY2O 1A02J 2IFMA 2QEXP 4K3AA 2N1TD 1JTHB 3D6ZA 1GDTA 2O01N 5AVTB 2K88A 3D71A 1URQA 5AVQB 2AXCA 1NTKK 1T6AA 3H1JE 1MFZA 4XA4A 3L70E 2FYUD 2QJPC 3LW5H 3AEAD 5GTIH 4YSZD 3P4PC 1QL1A 2E76C 2ZXXA 3CIRC 3CWBG 1RHZB 3RBXA 3CMEP 3CI9A 5AW5B 3H1KJ 1YQ3C 4IL6E 5C2TC 1VQ5P 4AYCA 1PGPA 4RJTA 1AVYA 2WVRA 1AFOA 1SS1A 1LTTC 3H1HD 1RQUA 2WSCJ 1NTMK 1U7MA 3WMM0 4ZMDA 1GZLA 2C0WA 1P84D 2JP3A 4HKZH 1L0NK 5APUA 4BXLA 1GD2E 3GLMA 1LP1A 1FE6A 1JY3N 1FZCC 3V2NA 4KT0J 1LT9B 2KLVA 1NKNA 2ZVOB 2O1KA 2FXPA 1M7LA 2UWJE 4U3FD 4BRYA 1QLED 2Q3EA 2M5AA 3AEFD 1YTZI 3G6EP 1VQ7P 1SQPG 1U7JA 2C0XA 4M3LA 2V7QJ 3VRBD 1URQD 3M0DA 2FBWD 1JY3O 2FYUE 1BCCJ 3M0DC 1OWAA 3PHLA 2R5BA 1MUUA 2J59M 3U1CA 1GW4A 3AE3D 4D6TJ 1HVVA 1SQXJ 4DJGA 1KF6C 2POHA 1FJPA 1FDMA 1JCDA 3HUSA 4DDIA 3H1HE 2CK3H 1NEND 3F89A 5AW1B 1KFMA 5AVUB 1CZQA 4Y99C 1SQQJ 5KLIB 4KHXA 1P84E 3RK2C 3CCRP 2K3RA 3L75G 2LXBA 1SLQA 1L0LK 3N4XA 2KP8A 1NU1G 1SQPD 3VMYA 2QJYB 1Q2NA 4PD4D 4H0LD 3BCCG 4U3FE 2BS2C 1EDLA 4LC1A 1NTKJ 2FKWB 1LTIC 2LR2A 1T2KC 2N1TB 1JTHA 1EQ7A 1VQKP 4H13B 5AW4B 3CD6P 5KJ7A 4Z1MH 3VP8A 1BSNA 1VL2A 1VQ4P 1EDKA 1Q86Q 2IBZG 1IJDB 2V4HA 3B5ND 2QVAA 1WMKA 3P8MC 1BGYG 2KLUA 4DOJA 1IK7A 2RH0A 4L73A 3GF3A 2WT7B 2KZJA 3V6IA 5AW6B 2W6JH 5KAIH 1HJBA 1X0TA 1NTMJ 1OW8A 2PAJA 1S5LX 1IFMA 2RKLA 1L0NJ 2GUVA 2Y0EA 1NU1D 3RBZA 1JO5A 1PPJG 3AE6D 3O6QB 3BCCD 1S5LE 1W5CE 2P67A 1S9KE 1H88A 2IDBA 5APWA 1YIJP 3H1IG 4A7PA 4H44C 1LT9A 2V7QH 1SQPE 1IC2A 1SQVG 4PD4E 3JC22 3TGUD 3CCJP 1LT9C 2O3JA 3AEBC 2IBZD 5K5GB 1NTZD 2WDVD 1BGYD 2FXMA 1MKMA 3JSVC 1PZQA 2Y9ZA 3AE4D 2Q3IA 3HTKB 3MIWA 2OTKE 2H89C 2WDRD 5APTA 2ZT9B 5KJ7D 4JYBA 2IZ1A 5AW3B 3CC4P 1FZBA 1RE3C 3Q5SA 1FZFA 4DHIB 4YSXC 3WU2E 2YO3A 3HRNA 5KLVD 1SFCD 1ZR4A 2Y0CA 1GU5A 3AE5D 2B76D 1JUNA 1LTSC 2GUSA 1PPJD 1OVVA 2N9YB 2OYHC 3D70A 1USEA 1YTZT 1ZP0D 3CCMP 3M9QA 2YMKA 1G2CB 3H1ID 1NU1E 2YKPA 1VF5B 4KX6D 1L0LJ 2W6AA 1K73Q 4GT1A 4WBAA 4HH2A 2L5GB 3BCCE 4JBZA 2PP6A 2I1JA 2XZRA 1Q90D 3P4SC 1QL2A 4MN4C 1PL5A 2IX7C 1J1EC 2CPSA 1ZMEC 2QA4P 2B88A 1KV4A 3Q2YA 3TDKA 3IAOA 1D7MA 1FBMA 3L74J 1EC5A 1NH4A 2YXRB 4NPDA 1JY2P 3L72J 1H89A 2JEEA 3TGUE 2WU2C 1EZVI 1GTWA 1Z56A 4C7NA 2IBZE 1VQLP 1NTZE 1BGYE 3TSIA 4YTMD 3CXHI 1N8RQ 2W83C 3S9OA 1MZ9A 2N1TA 2JWAA 1ZOYC 4I7ZC 2ACZC 2G8YA 1KILC 3FWNA 3GF7A 1N2DC 3B5NB 4L74A 3V4QA 5KLVE 2RN0A 1BCCG 1LWUC 1KFNA 3A2AA 3M0AA 2ZXEB 3L73G 2WT7A 3AEAC 2WQYC 4YSZC 1KORA 3M9BA 2WSSH 4GODA 1E79H 1PPJE 2FFDB 3AECD 1XTGB 1OW7A 4DDGA 1HGVA 3VOPA 1K04A 2OQQA 1FZAA 1IFDA 1IFNA 5CCGA 1EXIA 3H1IE 1KQLA 3NTNA 2E75B 5KAFE 3L71J 2LXCB 3O6QA 4XE5B 5C3JD 5AVWB 2I1KA 1KQSO 3F5HA 1HJ0A 2AXTH 3OJAB 1OXZA 2OTJP 3HE5B 1L4AD 2Q1KA 2Q6QA 2ZYDA 1LTJC 2QRXA 3H1HG 3TYYA 2R44A 2FYUK 1BSHA 5KKZB 3HE4B 5E79E 3L37A 4DZOA 1X9VA 3BASA 2R32A 3CMAP 3WUTA 3G3ZA 1BCCD 5TISH 1JMBA 1YQ4D 3L73D 2W90A 4GDOA 3HTKA 2HPCB 3CX5I 4QMAA 4EI2A 4L76A 4H13D 1N73B 1BE3G 3AEFC 5CJ4A 1AVOA 2YXQB 2JDIH 2WU5D 4D6TD 2HYNA 4U3FG 3VRBC 1URQC 1SFCB 3JCUH 3KQGA 2FBWC 2JKVA 1E7PC 1HF9A 5B5EE 1KC8Q 4IL6X 3KPEA 3HD7B 4N3YB 2Z5HA 3SWYA 2XNXA 1SQQD 2AEFA 3AE3C 5AVRB 2W6BA 2YO2A 1FJKA 1GMJA 1YJWP 1G2CA 3RL0D 3M9HA 3AE9D 2ZFYA 1K8AQ 5CCGD 1L0NG 5APYA 3Q1MA 5CJ0A 3CC2P 2WP9D 1RF1B 1FS0E 3CXHH 3VR9D 3RL0g 1NENC 3H1JJ 2P7JA 2YKQA 2GM4A 3EFFK 3L70J 1JM0A 1DEBA 1G1JA 2WSEJ 1YYCA 1X22A 1QVFO 1NKZB 3MGNA 4IFMA 1BE3D 4OGQD 2D2CC 2M3EA 2E74B 2FYNB 2OYIB 3VMZA 3OAKA 4I2LC 1X79B 4H0LC 4LLHA 1BCCE 1RH5B 1KYOD 3KXDA 3L73E 3GHGB 2OGUA 5APXA 3RK3B 2I8DA 1T3UA 2YIUC 2ZT9D 3B5NA 1NOHA 4D6TE 1NAFA 1KZUB 3SFED 1GL2B 3MD0A 3B5NC 2PGDA 3PRJA 2QE7H 5GTHH 2AEMA 1L0ND 2ITAA 1JMMA 3PLNA 3B4SA 3TK1A 1SQQE 1FU1A 2H8PD 2QJKC 2E76D 1SQPK 1PGQA 2Z4EA 3M06A 3EQ2A 4IOIH 1TU3F 4TLFA 4YXDD 1FZEA 1VF5D 1ZRTD 3HUSC 1RY3A 2FYUJ 3CX5H 4DCKA 3IR9A 3SWFA 1J1DB 3AE6C 4YTND 1L4AB 3HE5A 1IK9A 1S9KD 4EOTA 4JPZB 2B9BA 1ZV8A 1BE3E 1EZVG 3M91A 2WSFJ 3HE4A 3SFDD 3G9RA 2ZVNB 1OVUA 2A45I 5KKZC 5BU5A 1JB0J 1KYOE 2KB7P 2HPCA 4OH8B 1M1JB 3WUVA 3FXEA 2ZYAA 2IYOA 3A0BE 1N73A 3AE4C 2Y0DA 3AEED 5AW2B 1S1CX 3TGUG 3A0HE 2FXOA 2WDRC 2QM7A 1WRGA 5KJ7C 1LGHB 5CCHA 1SFCA 3IFMA 1NTZG 1NU1K 3P4QD 4YTPD 1P84I 1AQ5A 2NPSD 1IO4A 2ZAEB 3Q5PA 1ZN5A 4W7ZA 2KYVA 3VMXA 4B86A 1SFCC 2KNCB 1L0NE 3HD7A 1OFCX 4YT0D 3TNUB 3AE8D 1L0LD 1SVFA 5APQA 2B76C 3P4RD 3S4RA 1DX7A 1M8OB 2BCCG 5KLVG 2WSEH 3RL0B 3CWBJ 4YSYD 4EIJA 3CL3D 2YKOA 2E75D 3L74D 1RF1A 4I1LA 1EZVD 3L72D 1SP4A 1ZRTE 4IL6H 5H2FH 3CCUP 2BS3C 1GK6A 1PP9G 2ZYGA 1R5SA 4GKGA 3CXHD 4WY4B 3QH9A 4C46A 2J58A 4OGQB 2WS3D 4XFJA 3E1RA 3AEDD 2OYIA 2HLOA 1BDCA 2KSEA 2OYIC 4YTMC 3GHGA 2HR3A 1HWTC 2O1JA 1OVRA 3GHGC 3G4SP 3VP9A 1KQFB 1M90Q 4IFFA 1KD1Q 3AE7D 2OTLP 1GL2A 2JWDA 2BCCD 5CCHD 3FX0A 1SQVK 1CI6B 4RKUJ 1VQPP 3GG2A 3ABVD 3JCUE 2QIWA 1SQPJ 3LIDA 5GTIE 2WTYA 3HD7D 1S4XA 1L0LE 2QJPB 1KN7A 3B71A 3H1KG 1SQBK 1QX8A 1PP9D 3AEGD 2E76B 3E7KA 1UIIA 1EXJA 3L4FA 1VQMP 2CPBA 1RE4A 4JF7A 1AJYA 2KIKA 2WSFH 2A45H 3L74E 3P7KA 1EZVE 3BRVB 3L72E 1AV1A 3FWLA 3CXHE 3PH0A 1NEKD 4K35A 1OMIA 5C3JC 1L4AA 2QM8A 1RF0A 5KLIC 3R4YA 4R4MA 1H0TB 2XV5A 1FOSF 1Y8AA 1L4AC 3PJSK 4GOEA 2H88D 1RF0C 4L75A 1P84H 4PJ0H 5AW7B 5DJUB 3B8EB 3AE2D 2YNYA 1HH0A 1FZCB 1FAVA 3II6A 1WT6A 3L75J 2E74D 1LT1A 1JNMA 3CCSP 2QJYC 4OWFA 2XNDH 1ZLLA 1DIPA 5CMZA 2ZFCA 1NU1J 1M1JA 5AVYB 3MTUE 1YQ4C 1YBKA 4UB6H 2N1TC 2JJLA 4FJVA 2P10A 3BCCJ 3H1LJ 3RK3D 2KK7A 1AA0A 4H13C 3H1KD 1HBWA 2M0BA 2NPSB 2BCCE 5AVSB 2WU5C 1MV8A 1GL2D 3V5BA 2KNCA 3TNUA 3AE1D 4NPEA 2H7HA 1NHLA 1GK4A 5GTHE 3W67A 3T97B 2R5DA 4PV1D 1PP9E 2PRRA 1BGYJ 4D6TG 4EYYQ 1SQXG 2R3SA 3USSA 1KTMA 1NGMB 1KB9I 3BVHA 1L0VD 2O01J 4UB8H 4GOFA 3AE9C 3C8VA 5CCGC 1Y9BA 2P1JA 4O9BA 2WP9C 2WDQD 1SQQG 1R8EA 2E5TA 1OW6A 3VRAD 3VR9C 4WY4A 3VN0A 3KHUA 4Y99B 4TT3H 2C9NY 2KOGA 2WPSA 3RK2B 1S5LH 3P4SD 3K5BA 1DD3A 4OGQC 3NMDA 3QWOC 1Y47A 3H1IJ 1NTKG 3LIEA 3D6YA 1RQVA 1JOCA 1JY3P 4PD4H 5AVZB 2A06D 2IYPA 2JO1A 1SQVJ 2P2UA 4ZKPA 1DH3A 3RK3E 1N7SD 3H1KE 2R3CA 1LNQA 1QGKB 3TF5A 1SQXD 2ACZD 1KILD 2M3BA 2ZT9C 1SQBJ 1CI6A 3Q3DA 2WPVB 3MZWB 3SFEC 3CC7P 4LGDE 1VQNP 1MFTA 1K05A 3WUUA 2H43A 3WU2H 1DEEG 1W2BO 1OIPA 3KDPB 2YMYA 2WQYD 1NTMG 5KAIE 1EDJA 4N78D 2K9JB 5B66H 2Y9YA 3CPWO 1NYHA 4CPGA 1FDIA 2WMMA 1DD4A 3P32A 4YXDC 4HJGH 2OARA 1G1IA 1VF5C 5H2FE 4ZNCA 2KSJA 4DT0A 1GU4A 4WY4D 2KZIA 1NTKD 1H0TA 3ITKA 4WWIA 3GW6A 3VR8D 2Q5UA 4YTNC 3A7OA 5BVZA 3P8CD 1HUCA 4IFDK 4AQRD 1FZCA 3RGUA 4JQ0D 4H44B 3A5TA
chains in the Genus database with same CATH topology
2H88C 1RQVA 3IN6A 3AEAC 2WQYC 3SFED 1YQ4C 3AEDC 4YSZC 4IL6X 1KQFB 4YTPD 1KMIZ 3P4QD 2JO1A 3D70A 2P10A 1KORA 1OW8A 3VR8C 4H13C 1RQUA 1KFYD 3Q5PA 2BEZF 1ZP0D 3AECD 3AE7D 3AE2C 3RK3E 1OW7A 2WSCJ 2WDVC 1S5LX 1NEND 2E74C 2D2CD 2FYNC 4H44D 2YMKA 4RKUJ 3ABVD 3Q5RA 2WU5C 4YT0D 1K04A 2OQQA 2QIWA 3AE3C 3AE8D 2ACZD 2BS4C 3AEEC 2D2CB 2JP3A 2ZT9C 2G3AA 3EWKA 5M1BA 1EXIA 1HF9A 2QJKC 3GMAA 2B76C 1KILE 1VF5B 1UIXA 2E76D 1GMJA 1U57A 3Q3DA 1QLBC 4R4LA 3P4RD 4KX6D 2E75B 2WPVB 4I7ZB 4Y28J 3AE6D 5L8RJ 3B71A 3GLMA 3SFEC 3AE1D 3AEBD 2WU2D 4H0LB 3AE9D 4YTPC 3P4QC 4KT0J 3T97B 3AEGD 2E76B 3Q1MA 4PV1D 1Q90D 1K05A 1KFYC 2WP9D 3P4SC 3AE7C 3O6QA 5C3JD 1FDOA 4YSYD 1PL5A 1TU3F 3RL0g 3VR9D 2IDBA 1NENC 1EXJA 4YXDD 1HJ0A 4H44C 1VF5D 1ZMEC 2FXPA 4PV1B 1KTMA 1ZOYD 3ABVC 2E75D 4YT0C 3AE8C 2H89D 1NGMB 1KQGB 3Q2YA 1AJYA 3IAOA 1ZRTE 4YSYC 4H0LD 2WQYD 3AE5C 4U7JA 1L0VD 2BS3C 3P4PD 2BS2C 3P4RC 2BEQD 3D6ZA 3AE6C 3CIRD 4YTND 2O01J 1PIXA 3AE1C 3AEBC 2WU2C 2MKVA 3AE9C 4YSXD 2WSEJ 3C8VA 3AEFD 3D71A 2WDVD 1Y9BA 3AEGC 1NEKD 4PV1C 1NYHA 2WP9C 1ZP0C 1MKMA 3AECC 1OMIA 2WDQD 5C3JC 1FDIA 4H13B 1R8EA 4YTMD 1OW6A 4OGQD 1YQ3D 3VRAD 1DD4A 2V7QJ 3H25A 3AE4D 3VR9C 2D2CC 3R4YA 5KLIC 4R4MA 3VRBD 3S9OA 4YXDC 2E74B 4Z1MH 1VF5C 2WSFJ 2K9YA 5C2TD 1ZOYC 2FBWD 2E75C 4I7ZC 1KF6D 2QJPC 1VL2A 3SFDD 2H89C 2WDRD 4OGQB 2J5UA 2G8YA 2ACZC 4XFJA 3G9RA 2H88D 2WS3D 3AEAD 4H0LC 2NZ2A 1YQ4D 1L0VC 4TT3H 3AEDD 2ZT9B 1PV3A 3P4PC 4YSZD 4GDOA 3GF7A 2E76C 5KKZC 4KX6C 1WMKA 2QSIA 3VR8D 3CIRC 3Q5SA 4YTNC 1JB0J 4H13D 1IK7A 3P4SD 3AE2D 4YSXC 3AEFC 3GF3A 2E74D 1NEKC 1DD3A 2WDQC 4YTMC 2QJYC 2WU5D 4OGQC 3VRAC 1YQ3C 3FGAD 3AE3D 3AE4C 2YIUC 3VRBC 3AEED 1DIPA 3LW5J 2ZT9D 3AE5D 5C2TC 2FBWC 2B76D 4H44B 1S1CX 1KF6C 1E7PC 3D6YA 3SFDC 2WDRC 2WS3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H88 C;  3AEA C;  2WQY C;  3SFE D;  1YQ4 C;  3AED C;  4YSZ C;  4YTP D;  3P4Q D;  1OW8 A;  3VR8 C;  1KFY D;  1ZP0 D;  3AEC D;  3AE7 D;  3AE2 C;  1OW7 A;  2WDV C;  1NEN D;  3ABV D;  2WU5 C;  4YT0 D;  1K04 A;  3AE3 C;  3AE8 D;  2ACZ D;  2BS4 C;  3AEE C;  2G3A A;  2B76 C;  1QLB C;  3P4R D;  4KX6 D;  3AE6 D;  3B71 A;  3SFE C;  3AE1 D;  3AEB D;  2WU2 D;  3AE9 D;  4YTP C;  3P4Q C;  3AEG D;  2WP9 D;  1K05 A;  1KFY C;  3P4S C;  3AE7 C;  5C3J D;  4YSY D;  3VR9 D;  1NEN C;  4YXD D;  1ZOY D;  1KTM A;  3ABV C;  4YT0 C;  3AE8 C;  2H89 D;  2WQY D;  3AE5 C;  1L0V D;  2BS3 C;  3P4P D;  2BS2 C;  3P4R C;  3AE6 C;  3CIR D;  4YTN D;  3AE1 C;  3AEB C;  2WU2 C;  3AE9 C;  4YSX D;  3AEF D;  2WDV D;  3AEG C;  1NEK D;  2WP9 C;  1ZP0 C;  3AEC C;  2WDQ D;  5C3J C;  4YTM D;  1OW6 A;  3VRA D;  1YQ3 D;  3VR9 C;  4YSY C;  3AE4 D;  3VRB D;  3S9O A;  4YXD C;  5C2T D;  1ZOY C;  2FBW D;  1KF6 D;  3SFD D;  2H89 C;  2WDR D;  2ACZ C;  2WS3 D;  2H88 D;  3AEA D;  1YQ4 D;  1L0V C;  3AED D;  4YSZ D;  1PV3 A;  3P4P C;  4KX6 C;  3VR8 D;  3CIR C;  4YTN C;  3P4S D;  3AE2 D;  4YSX C;  3AEF C;  1NEK C;  2WDQ C;  4YTM C;  2WU5 D;  3VRA C;  1YQ3 C;  3AE3 D;  3AE4 C;  3VRB C;  3AEE D;  3AE5 D;  5C2T C;  2FBW C;  2B76 D;  1KF6 C;  1E7P C;  3SFD C;  2WDR C;  2WS3 C; 
#chains in the Genus database with same CATH topology
 4N6J A;  1LTA C;  5KTB A;  2A06 E;  1KFY D;  3KZI H;  1PGJ A;  3MP7 B;  1KB9 H;  3L35 A;  2BS4 C;  3AEE C;  5M1B A;  3V2R A;  1SQX E;  2NPS A;  1KIL E;  2NRG A;  4Y28 J;  2Q7C A;  1NTM D;  1VQ9 P;  4YTP C;  1OX3 A;  2O01 H;  3P4Q C;  2NPS C;  3CWB D;  1ZXG A;  3CCV P;  3SWK A;  1YIT P;  3T97 A;  2FFD A;  4PV1 B;  2N9B A;  4YT0 C;  4C7R A;  2E5Y A;  3AE8 C;  1XTC C;  4I6M C;  1KQG B;  1FZG A;  3P4P D;  1VQ8 P;  3P4R C;  2FFD C;  3CIR D;  3L73 J;  4N78 E;  2DW3 A;  4EDF A;  3U1A A;  1X8Y A;  2OYH B;  3C9I A;  1YQ3 D;  4YSY C;  1L0L G;  5C2T D;  2E75 C;  4ZKU A;  2B87 B;  1PV3 A;  5AVX B;  2QG4 A;  1NTK E;  2HOD B;  5AW0 B;  5KAF H;  3P8C E;  3I55 P;  3L74 G;  1ZR2 A;  3L72 G;  3CCQ P;  2ZJS E;  1J1E B;  3V4W A;  4PJ0 E;  3G71 P;  2WS3 C;  1T8Z A;  3AED C;  1CSB A;  2HFE D;  3NFQ A;  2M8R A;  3H1H J;  2WDV C;  2D2C D;  5E79 H;  3H6P A;  1LTG C;  1N7S B;  5APS A;  2G3A A;  4C7N B;  3H1L G;  3GMA A;  1QLB C;  1U57 A;  4UB6 E;  4I7Z B;  3VON A;  1N73 C;  1KIL B;  2HG5 D;  1NTM E;  1N7L A;  1VDF A;  3OW2 O;  5EFW B;  3AE7 C;  3CWB E;  4YXW H;  2W27 A;  2WWW A;  2BAS A;  5CCH C;  1BE3 J;  1YJN P;  1NO4 A;  2FY8 A;  2KI7 B;  4BWN A;  2Q9I A;  2WIT A;  1NWQ A;  4LDT A;  3ABV C;  2IPP A;  1IFI A;  3AE5 C;  5AW9 B;  1LWU B;  4U3F J;  3CCL P;  3HD7 C;  5B5E H;  3E1I A;  1M1K Q;  1S3J A;  2P58 A;  2C9L Y;  2MKV A;  3H32 B;  3AEG C;  4DHJ A;  1ZP0 C;  2GA1 A;  1KYO I;  2KUB A;  2WSC H;  1E5W A;  3W68 A;  2K9J A;  5AVV B;  1QVG O;  2E43 A;  1NTZ K;  5CHX A;  1KF6 D;  1S72 P;  1R5L A;  3U59 A;  1CW5 A;  2NZ2 A;  5TJH A;  1JEK A;  4UB8 E;  1Q82 Q;  3L71 G;  4KX6 C;  1RF1 C;  3L75 D;  4WVZ A;  2AEJ A;  4AUW A;  1NEK C;  4ASV A;  4NPF X;  3I5C A;  4DHZ A;  2AXT E;  2L91 A;  1HGZ A;  3NXS A;  3FGA D;  5KLV K;  3RK2 D;  2H88 C;  3IN6 A;  3H1L D;  1N86 A;  4YPC A;  3PTZ A;  1LTJ B;  3AE2 C;  3CLQ A;  2WPQ A;  2E74 C;  2FYN C;  5CBO A;  1NVO A;  3N7N A;  3FXD A;  5TIS E;  1NJI Q;  2WPR A;  1L2P A;  1K9M Q;  4OVN F;  2KS1 B;  1T2K D;  5CBN A;  1M57 D;  3RK3 C;  2WZ7 A;  1KB9 D;  1SQB G;  1QEX A;  5BU8 B;  1Q81 Q;  1RE3 A;  3R2P A;  1GL2 C;  4U7J A;  1URQ B;  2Z5I A;  3AE1 C;  5DJT B;  3IF4 A;  3MUD A;  3L71 D;  4PD4 I;  3VYI A;  4RO0 A;  4PV1 C;  3AEC C;  4HYT B;  3SSU A;  1GW3 A;  2KXP B;  3H25 A;  3MUD C;  2K37 A;  3PP5 A;  2OYH A;  3KYQ A;  2OYO A;  2J5U A;  3ZDM A;  2JR8 A;  1L0V C;  2PFX A;  2E42 A;  3OA7 A;  5B66 E;  1RE4 C;  3CCE P;  3H1J G;  2XKM A;  2B87 A;  3L75 E;  3L70 G;  1M56 D;  4ASW A;  2WDQ C;  2MJZ A;  1VPC A;  2HOD A;  3BAT A;  3VRA C;  3CX5 D;  3LW5 J;  2SPZ A;  1J1D C;  1W2E A;  1T3J A;  1LJ2 A;  1SQV D;  3V2P A;  3A3Y B;  1KMI Z;  2B89 A;  3H1L E;  1PGO A;  2BEZ F;  3L36 A;  4H44 D;  1S2E A;  3I56 P;  1LP1 B;  1SQB D;  4KJM A;  1IFJ A;  2D2C B;  2LKM A;  2RMZ A;  5AW8 B;  1LTB C;  4R4L A;  1N7S A;  3AEB D;  4H0L B;  4W7Y A;  1A02 F;  5APV A;  2IFN A;  1KYO H;  1M1J C;  3KZI E;  1N7S C;  1FDO A;  1KIL A;  1PFI A;  1KB9 E;  4BRY B;  1TFF A;  1J2J B;  3A0B H;  2H89 D;  4JYC A;  1EDI A;  1Q7Y Q;  2M5A B;  4I6L A;  1JCC A;  2YIU B;  2A06 G;  3A0H H;  2BEQ D;  1PIX A;  3TGU J;  3S1K A;  1BDD A;  1VQ6 P;  5C39 A;  4YSX D;  1LWU A;  1H8A A;  3L71 E;  1NTZ J;  3H1J D;  2IBZ I;  3MHV A;  3L70 D;  3H32 A;  2K9Y A;  2W8Z A;  2QJK B;  2QSI A;  3RL0 C;  3VTP C;  1HTL C;  1FOS E;  2XU6 A;  3EFG A;  2BCC J;  5KLV J;  2FYU G;  2XDJ A;  3O8Z A;  3SFD C;  3V2Q A;  2IZ0 A;  3CX5 E;  3HUS B;  1YHQ P;  3C1L A;  1JY2 N;  1NAY A;  2FYZ A;  1IFP A;  4WY4 C;  1SQX K;  4HB1 A;  4RES B;  1SQV E;  3VR8 C;  1PP9 J;  1YJ9 P;  2A45 G;  3BRT B;  3Q5R A;  1LTJ A;  4WB4 A;  1AQT A;  3EWK A;  1SQB E;  1FC2 C;  1IZN B;  1UIX A;  1ZW0 A;  5L8R J;  2K1A A;  1SQQ K;  2WU2 D;  1USD A;  4GIF A;  2VRS A;  1KFY C;  1OZH A;  3UIA A;  2KS1 A;  1YI2 P;  3VMA A;  1VQO P;  1ZOY D;  4W80 A;  1JY2 O;  1A02 J;  2IFM A;  2QEX P;  4K3A A;  2N1T D;  1JTH B;  3D6Z A;  1GDT A;  2O01 N;  5AVT B;  2K88 A;  3D71 A;  1URQ A;  5AVQ B;  2AXC A;  1NTK K;  1T6A A;  3H1J E;  1MFZ A;  4XA4 A;  3L70 E;  2FYU D;  2QJP C;  3LW5 H;  3AEA D;  5GTI H;  4YSZ D;  3P4P C;  1QL1 A;  2E76 C;  2ZXX A;  3CIR C;  3CWB G;  1RHZ B;  3RBX A;  3CME P;  3CI9 A;  5AW5 B;  3H1K J;  1YQ3 C;  4IL6 E;  5C2T C;  1VQ5 P;  4AYC A;  1PGP A;  4RJT A;  1AVY A;  2WVR A;  1AFO A;  1SS1 A;  1LTT C;  3H1H D;  1RQU A;  2WSC J;  1NTM K;  1U7M A;  3WMM 0;  4ZMD A;  1GZL A;  2C0W A;  1P84 D;  2JP3 A;  4HKZ H;  1L0N K;  5APU A;  4BXL A;  1GD2 E;  3GLM A;  1LP1 A;  1FE6 A;  1JY3 N;  1FZC C;  3V2N A;  4KT0 J;  1LT9 B;  2KLV A;  1NKN A;  2ZVO B;  2O1K A;  2FXP A;  1M7L A;  2UWJ E;  4U3F D;  4BRY A;  1QLE D;  2Q3E A;  2M5A A;  3AEF D;  1YTZ I;  3G6E P;  1VQ7 P;  1SQP G;  1U7J A;  2C0X A;  4M3L A;  2V7Q J;  3VRB D;  1URQ D;  3M0D A;  2FBW D;  1JY3 O;  2FYU E;  1BCC J;  3M0D C;  1OWA A;  3PHL A;  2R5B A;  1MUU A;  2J59 M;  3U1C A;  1GW4 A;  3AE3 D;  4D6T J;  1HVV A;  1SQX J;  4DJG A;  1KF6 C;  2POH A;  1FJP A;  1FDM A;  1JCD A;  3HUS A;  4DDI A;  3H1H E;  2CK3 H;  1NEN D;  3F89 A;  5AW1 B;  1KFM A;  5AVU B;  1CZQ A;  4Y99 C;  1SQQ J;  5KLI B;  4KHX A;  1P84 E;  3RK2 C;  3CCR P;  2K3R A;  3L75 G;  2LXB A;  1SLQ A;  1L0L K;  3N4X A;  2KP8 A;  1NU1 G;  1SQP D;  3VMY A;  2QJY B;  1Q2N A;  4PD4 D;  4H0L D;  3BCC G;  4U3F E;  2BS2 C;  1EDL A;  4LC1 A;  1NTK J;  2FKW B;  1LTI C;  2LR2 A;  1T2K C;  2N1T B;  1JTH A;  1EQ7 A;  1VQK P;  4H13 B;  5AW4 B;  3CD6 P;  5KJ7 A;  4Z1M H;  3VP8 A;  1BSN A;  1VL2 A;  1VQ4 P;  1EDK A;  1Q86 Q;  2IBZ G;  1IJD B;  2V4H A;  3B5N D;  2QVA A;  1WMK A;  3P8M C;  1BGY G;  2KLU A;  4DOJ A;  1IK7 A;  2RH0 A;  4L73 A;  3GF3 A;  2WT7 B;  2KZJ A;  3V6I A;  5AW6 B;  2W6J H;  5KAI H;  1HJB A;  1X0T A;  1NTM J;  1OW8 A;  2PAJ A;  1S5L X;  1IFM A;  2RKL A;  1L0N J;  2GUV A;  2Y0E A;  1NU1 D;  3RBZ A;  1JO5 A;  1PPJ G;  3AE6 D;  3O6Q B;  3BCC D;  1S5L E;  1W5C E;  2P67 A;  1S9K E;  1H88 A;  2IDB A;  5APW A;  1YIJ P;  3H1I G;  4A7P A;  4H44 C;  1LT9 A;  2V7Q H;  1SQP E;  1IC2 A;  1SQV G;  4PD4 E;  3JC2 2;  3TGU D;  3CCJ P;  1LT9 C;  2O3J A;  3AEB C;  2IBZ D;  5K5G B;  1NTZ D;  2WDV D;  1BGY D;  2FXM A;  1MKM A;  3JSV C;  1PZQ A;  2Y9Z A;  3AE4 D;  2Q3I A;  3HTK B;  3MIW A;  2OTK E;  2H89 C;  2WDR D;  5APT A;  2ZT9 B;  5KJ7 D;  4JYB A;  2IZ1 A;  5AW3 B;  3CC4 P;  1FZB A;  1RE3 C;  3Q5S A;  1FZF A;  4DHI B;  4YSX C;  3WU2 E;  2YO3 A;  3HRN A;  5KLV D;  1SFC D;  1ZR4 A;  2Y0C A;  1GU5 A;  3AE5 D;  2B76 D;  1JUN A;  1LTS C;  2GUS A;  1PPJ D;  1OVV A;  2N9Y B;  2OYH C;  3D70 A;  1USE A;  1YTZ T;  1ZP0 D;  3CCM P;  3M9Q A;  2YMK A;  1G2C B;  3H1I D;  1NU1 E;  2YKP A;  1VF5 B;  4KX6 D;  1L0L J;  2W6A A;  1K73 Q;  4GT1 A;  4WBA A;  4HH2 A;  2L5G B;  3BCC E;  4JBZ A;  2PP6 A;  2I1J A;  2XZR A;  1Q90 D;  3P4S C;  1QL2 A;  4MN4 C;  1PL5 A;  2IX7 C;  1J1E C;  2CPS A;  1ZME C;  2QA4 P;  2B88 A;  1KV4 A;  3Q2Y A;  3TDK A;  3IAO A;  1D7M A;  1FBM A;  3L74 J;  1EC5 A;  1NH4 A;  2YXR B;  4NPD A;  1JY2 P;  3L72 J;  1H89 A;  2JEE A;  3TGU E;  2WU2 C;  1EZV I;  1GTW A;  1Z56 A;  4C7N A;  2IBZ E;  1VQL P;  1NTZ E;  1BGY E;  3TSI A;  4YTM D;  3CXH I;  1N8R Q;  2W83 C;  3S9O A;  1MZ9 A;  2N1T A;  2JWA A;  1ZOY C;  4I7Z C;  2ACZ C;  2G8Y A;  1KIL C;  3FWN A;  3GF7 A;  1N2D C;  3B5N B;  4L74 A;  3V4Q A;  5KLV E;  2RN0 A;  1BCC G;  1LWU C;  1KFN A;  3A2A A;  3M0A A;  2ZXE B;  3L73 G;  2WT7 A;  3AEA C;  2WQY C;  4YSZ C;  1KOR A;  3M9B A;  2WSS H;  4GOD A;  1E79 H;  1PPJ E;  2FFD B;  3AEC D;  1XTG B;  1OW7 A;  4DDG A;  1HGV A;  3VOP A;  1K04 A;  2OQQ A;  1FZA A;  1IFD A;  1IFN A;  5CCG A;  1EXI A;  3H1I E;  1KQL A;  3NTN A;  2E75 B;  5KAF E;  3L71 J;  2LXC B;  3O6Q A;  4XE5 B;  5C3J D;  5AVW B;  2I1K A;  1KQS O;  3F5H A;  1HJ0 A;  2AXT H;  3OJA B;  1OXZ A;  2OTJ P;  3HE5 B;  1L4A D;  2Q1K A;  2Q6Q A;  2ZYD A;  1LTJ C;  2QRX A;  3H1H G;  3TYY A;  2R44 A;  2FYU K;  1BSH A;  5KKZ B;  3HE4 B;  5E79 E;  3L37 A;  4DZO A;  1X9V A;  3BAS A;  2R32 A;  3CMA P;  3WUT A;  3G3Z A;  1BCC D;  5TIS H;  1JMB A;  1YQ4 D;  3L73 D;  2W90 A;  4GDO A;  3HTK A;  2HPC B;  3CX5 I;  4QMA A;  4EI2 A;  4L76 A;  4H13 D;  1N73 B;  1BE3 G;  3AEF C;  5CJ4 A;  1AVO A;  2YXQ B;  2JDI H;  2WU5 D;  4D6T D;  2HYN A;  4U3F G;  3VRB C;  1URQ C;  1SFC B;  3JCU H;  3KQG A;  2FBW C;  2JKV A;  1E7P C;  1HF9 A;  5B5E E;  1KC8 Q;  4IL6 X;  3KPE A;  3HD7 B;  4N3Y B;  2Z5H A;  3SWY A;  2XNX A;  1SQQ D;  2AEF A;  3AE3 C;  5AVR B;  2W6B A;  2YO2 A;  1FJK A;  1GMJ A;  1YJW P;  1G2C A;  3RL0 D;  3M9H A;  3AE9 D;  2ZFY A;  1K8A Q;  5CCG D;  1L0N G;  5APY A;  3Q1M A;  5CJ0 A;  3CC2 P;  2WP9 D;  1RF1 B;  1FS0 E;  3CXH H;  3VR9 D;  3RL0 g;  1NEN C;  3H1J J;  2P7J A;  2YKQ A;  2GM4 A;  3EFF K;  3L70 J;  1JM0 A;  1DEB A;  1G1J A;  2WSE J;  1YYC A;  1X22 A;  1QVF O;  1NKZ B;  3MGN A;  4IFM A;  1BE3 D;  4OGQ D;  2D2C C;  2M3E A;  2E74 B;  2FYN B;  2OYI B;  3VMZ A;  3OAK A;  4I2L C;  1X79 B;  4H0L C;  4LLH A;  1BCC E;  1RH5 B;  1KYO D;  3KXD A;  3L73 E;  3GHG B;  2OGU A;  5APX A;  3RK3 B;  2I8D A;  1T3U A;  2YIU C;  2ZT9 D;  3B5N A;  1NOH A;  4D6T E;  1NAF A;  1KZU B;  3SFE D;  1GL2 B;  3MD0 A;  3B5N C;  2PGD A;  3PRJ A;  2QE7 H;  5GTH H;  2AEM A;  1L0N D;  2ITA A;  1JMM A;  3PLN A;  3B4S A;  3TK1 A;  1SQQ E;  1FU1 A;  2H8P D;  2QJK C;  2E76 D;  1SQP K;  1PGQ A;  2Z4E A;  3M06 A;  3EQ2 A;  4IOI H;  1TU3 F;  4TLF A;  4YXD D;  1FZE A;  1VF5 D;  1ZRT D;  3HUS C;  1RY3 A;  2FYU J;  3CX5 H;  4DCK A;  3IR9 A;  3SWF A;  1J1D B;  3AE6 C;  4YTN D;  1L4A B;  3HE5 A;  1IK9 A;  1S9K D;  4EOT A;  4JPZ B;  2B9B A;  1ZV8 A;  1BE3 E;  1EZV G;  3M91 A;  2WSF J;  3HE4 A;  3SFD D;  3G9R A;  2ZVN B;  1OVU A;  2A45 I;  5KKZ C;  5BU5 A;  1JB0 J;  1KYO E;  2KB7 P;  2HPC A;  4OH8 B;  1M1J B;  3WUV A;  3FXE A;  2ZYA A;  2IYO A;  3A0B E;  1N73 A;  3AE4 C;  2Y0D A;  3AEE D;  5AW2 B;  1S1C X;  3TGU G;  3A0H E;  2FXO A;  2WDR C;  2QM7 A;  1WRG A;  5KJ7 C;  1LGH B;  5CCH A;  1SFC A;  3IFM A;  1NTZ G;  1NU1 K;  3P4Q D;  4YTP D;  1P84 I;  1AQ5 A;  2NPS D;  1IO4 A;  2ZAE B;  3Q5P A;  1ZN5 A;  4W7Z A;  2KYV A;  3VMX A;  4B86 A;  1SFC C;  2KNC B;  1L0N E;  3HD7 A;  1OFC X;  4YT0 D;  3TNU B;  3AE8 D;  1L0L D;  1SVF A;  5APQ A;  2B76 C;  3P4R D;  3S4R A;  1DX7 A;  1M8O B;  2BCC G;  5KLV G;  2WSE H;  3RL0 B;  3CWB J;  4YSY D;  4EIJ A;  3CL3 D;  2YKO A;  2E75 D;  3L74 D;  1RF1 A;  4I1L A;  1EZV D;  3L72 D;  1SP4 A;  1ZRT E;  4IL6 H;  5H2F H;  3CCU P;  2BS3 C;  1GK6 A;  1PP9 G;  2ZYG A;  1R5S A;  4GKG A;  3CXH D;  4WY4 B;  3QH9 A;  4C46 A;  2J58 A;  4OGQ B;  2WS3 D;  4XFJ A;  3E1R A;  3AED D;  2OYI A;  2HLO A;  1BDC A;  2KSE A;  2OYI C;  4YTM C;  3GHG A;  2HR3 A;  1HWT C;  2O1J A;  1OVR A;  3GHG C;  3G4S P;  3VP9 A;  1KQF B;  1M90 Q;  4IFF A;  1KD1 Q;  3AE7 D;  2OTL P;  1GL2 A;  2JWD A;  2BCC D;  5CCH D;  3FX0 A;  1SQV K;  1CI6 B;  4RKU J;  1VQP P;  3GG2 A;  3ABV D;  3JCU E;  2QIW A;  1SQP J;  3LID A;  5GTI E;  2WTY A;  3HD7 D;  1S4X A;  1L0L E;  2QJP B;  1KN7 A;  3B71 A;  3H1K G;  1SQB K;  1QX8 A;  1PP9 D;  3AEG D;  2E76 B;  3E7K A;  1UII A;  1EXJ A;  3L4F A;  1VQM P;  2CPB A;  1RE4 A;  4JF7 A;  1AJY A;  2KIK A;  2WSF H;  2A45 H;  3L74 E;  3P7K A;  1EZV E;  3BRV B;  3L72 E;  1AV1 A;  3FWL A;  3CXH E;  3PH0 A;  1NEK D;  4K35 A;  1OMI A;  5C3J C;  1L4A A;  2QM8 A;  1RF0 A;  5KLI C;  3R4Y A;  4R4M A;  1H0T B;  2XV5 A;  1FOS F;  1Y8A A;  1L4A C;  3PJS K;  4GOE A;  2H88 D;  1RF0 C;  4L75 A;  1P84 H;  4PJ0 H;  5AW7 B;  5DJU B;  3B8E B;  3AE2 D;  2YNY A;  1HH0 A;  1FZC B;  1FAV A;  3II6 A;  1WT6 A;  3L75 J;  2E74 D;  1LT1 A;  1JNM A;  3CCS P;  2QJY C;  4OWF A;  2XND H;  1ZLL A;  1DIP A;  5CMZ A;  2ZFC A;  1NU1 J;  1M1J A;  5AVY B;  3MTU E;  1YQ4 C;  1YBK A;  4UB6 H;  2N1T C;  2JJL A;  4FJV A;  2P10 A;  3BCC J;  3H1L J;  3RK3 D;  2KK7 A;  1AA0 A;  4H13 C;  3H1K D;  1HBW A;  2M0B A;  2NPS B;  2BCC E;  5AVS B;  2WU5 C;  1MV8 A;  1GL2 D;  3V5B A;  2KNC A;  3TNU A;  3AE1 D;  4NPE A;  2H7H A;  1NHL A;  1GK4 A;  5GTH E;  3W67 A;  3T97 B;  2R5D A;  4PV1 D;  1PP9 E;  2PRR A;  1BGY J;  4D6T G;  4EYY Q;  1SQX G;  2R3S A;  3USS A;  1KTM A;  1NGM B;  1KB9 I;  3BVH A;  1L0V D;  2O01 J;  4UB8 H;  4GOF A;  3AE9 C;  3C8V A;  5CCG C;  1Y9B A;  2P1J A;  4O9B A;  2WP9 C;  2WDQ D;  1SQQ G;  1R8E A;  2E5T A;  1OW6 A;  3VRA D;  3VR9 C;  4WY4 A;  3VN0 A;  3KHU A;  4Y99 B;  4TT3 H;  2C9N Y;  2KOG A;  2WPS A;  3RK2 B;  1S5L H;  3P4S D;  3K5B A;  1DD3 A;  4OGQ C;  3NMD A;  3QWO C;  1Y47 A;  3H1I J;  1NTK G;  3LIE A;  3D6Y A;  1RQV A;  1JOC A;  1JY3 P;  4PD4 H;  5AVZ B;  2A06 D;  2IYP A;  2JO1 A;  1SQV J;  2P2U A;  4ZKP A;  1DH3 A;  3RK3 E;  1N7S D;  3H1K E;  2R3C A;  1LNQ A;  1QGK B;  3TF5 A;  1SQX D;  2ACZ D;  1KIL D;  2M3B A;  2ZT9 C;  1SQB J;  1CI6 A;  3Q3D A;  2WPV B;  3MZW B;  3SFE C;  3CC7 P;  4LGD E;  1VQN P;  1MFT A;  1K05 A;  3WUU A;  2H43 A;  3WU2 H;  1DEE G;  1W2B O;  1OIP A;  3KDP B;  2YMY A;  2WQY D;  1NTM G;  5KAI E;  1EDJ A;  4N78 D;  2K9J B;  5B66 H;  2Y9Y A;  3CPW O;  1NYH A;  4CPG A;  1FDI A;  2WMM A;  1DD4 A;  3P32 A;  4YXD C;  4HJG H;  2OAR A;  1G1I A;  1VF5 C;  5H2F E;  4ZNC A;  2KSJ A;  4DT0 A;  1GU4 A;  4WY4 D;  2KZI A;  1NTK D;  1H0T A;  3ITK A;  4WWI A;  3GW6 A;  3VR8 D;  2Q5U A;  4YTN C;  3A7O A;  5BVZ A;  3P8C D;  1HUC A;  4IFD K;  4AQR D;  1FZC A;  3RGU A;  4JQ0 D;  4H44 B;  3A5T A; 
#chains in the Genus database with same CATH homology
 2H88 C;  1RQV A;  3IN6 A;  3AEA C;  2WQY C;  3SFE D;  1YQ4 C;  3AED C;  4YSZ C;  4IL6 X;  1KQF B;  4YTP D;  1KMI Z;  3P4Q D;  2JO1 A;  3D70 A;  2P10 A;  1KOR A;  1OW8 A;  3VR8 C;  4H13 C;  1RQU A;  1KFY D;  3Q5P A;  2BEZ F;  1ZP0 D;  3AEC D;  3AE7 D;  3AE2 C;  3RK3 E;  1OW7 A;  2WSC J;  2WDV C;  1S5L X;  1NEN D;  2E74 C;  2D2C D;  2FYN C;  4H44 D;  2YMK A;  4RKU J;  3ABV D;  3Q5R A;  2WU5 C;  4YT0 D;  1K04 A;  2OQQ A;  2QIW A;  3AE3 C;  3AE8 D;  2ACZ D;  2BS4 C;  3AEE C;  2D2C B;  2JP3 A;  2ZT9 C;  2G3A A;  3EWK A;  5M1B A;  1EXI A;  1HF9 A;  2QJK C;  3GMA A;  2B76 C;  1KIL E;  1VF5 B;  1UIX A;  2E76 D;  1GMJ A;  1U57 A;  3Q3D A;  1QLB C;  4R4L A;  3P4R D;  4KX6 D;  2E75 B;  2WPV B;  4I7Z B;  4Y28 J;  3AE6 D;  5L8R J;  3B71 A;  3GLM A;  3SFE C;  3AE1 D;  3AEB D;  2WU2 D;  4H0L B;  3AE9 D;  4YTP C;  3P4Q C;  4KT0 J;  3T97 B;  3AEG D;  2E76 B;  3Q1M A;  4PV1 D;  1Q90 D;  1K05 A;  1KFY C;  2WP9 D;  3P4S C;  3AE7 C;  3O6Q A;  5C3J D;  1FDO A;  4YSY D;  1PL5 A;  1TU3 F;  3RL0 g;  3VR9 D;  2IDB A;  1NEN C;  1EXJ A;  4YXD D;  1HJ0 A;  4H44 C;  1VF5 D;  1ZME C;  2FXP A;  4PV1 B;  1KTM A;  1ZOY D;  3ABV C;  2E75 D;  4YT0 C;  3AE8 C;  2H89 D;  1NGM B;  1KQG B;  3Q2Y A;  1AJY A;  3IAO A;  1ZRT E;  4YSY C;  4H0L D;  2WQY D;  3AE5 C;  4U7J A;  1L0V D;  2BS3 C;  3P4P D;  2BS2 C;  3P4R C;  2BEQ D;  3D6Z A;  3AE6 C;  3CIR D;  4YTN D;  2O01 J;  1PIX A;  3AE1 C;  3AEB C;  2WU2 C;  2MKV A;  3AE9 C;  4YSX D;  2WSE J;  3C8V A;  3AEF D;  3D71 A;  2WDV D;  1Y9B A;  3AEG C;  1NEK D;  4PV1 C;  1NYH A;  2WP9 C;  1ZP0 C;  1MKM A;  3AEC C;  1OMI A;  2WDQ D;  5C3J C;  1FDI A;  4H13 B;  1R8E A;  4YTM D;  1OW6 A;  4OGQ D;  1YQ3 D;  3VRA D;  1DD4 A;  2V7Q J;  3H25 A;  3AE4 D;  3VR9 C;  2D2C C;  3R4Y A;  5KLI C;  4R4M A;  3VRB D;  3S9O A;  4YXD C;  2E74 B;  4Z1M H;  1VF5 C;  2WSF J;  2K9Y A;  5C2T D;  1ZOY C;  2FBW D;  2E75 C;  4I7Z C;  1KF6 D;  2QJP C;  1VL2 A;  3SFD D;  2H89 C;  2WDR D;  4OGQ B;  2J5U A;  2G8Y A;  2ACZ C;  4XFJ A;  3G9R A;  2H88 D;  2WS3 D;  3AEA D;  4H0L C;  2NZ2 A;  1YQ4 D;  1L0V C;  4TT3 H;  3AED D;  2ZT9 B;  1PV3 A;  3P4P C;  4YSZ D;  4GDO A;  3GF7 A;  2E76 C;  5KKZ C;  4KX6 C;  1WMK A;  2QSI A;  3VR8 D;  3CIR C;  3Q5S A;  4YTN C;  1JB0 J;  4H13 D;  1IK7 A;  3P4S D;  3AE2 D;  4YSX C;  3AEF C;  3GF3 A;  2E74 D;  1NEK C;  1DD3 A;  2WDQ C;  4YTM C;  2QJY C;  2WU5 D;  4OGQ C;  3VRA C;  1YQ3 C;  3FGA D;  3AE3 D;  3AE4 C;  2YIU C;  3VRB C;  3AEE D;  1DIP A;  3LW5 J;  2ZT9 D;  3AE5 D;  5C2T C;  2FBW C;  2B76 D;  4H44 B;  1S1C X;  1KF6 C;  1E7P C;  3D6Y A;  3SFD C;  2WDR C;  2WS3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...