1NEND

Complex ii (succinate dehydrogenase) from e. coli with dinitrophenol-17 inhibitor co-crystallized at the ubiquinone binding site
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
113
structure length
113
Chain Sequence
b'SNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFFASAFTKVFTLLALFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYVIYGFVVVWGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase flavoprotein subunit
publication title Architecture of succinate dehydrogenase and reactive oxygen species generation
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase/electron transport
total genus 45
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2002-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 1nenD01
3AE3D 3VR9D 3AE5D 2WDRC 1YQ4D 2B76D 3AEFC 3VRBC 2H88D 3AEAC 5C2TC 1ZP0D 4YSZC 4YT0C 2H89D 2WDQD 3VR8D 3AE8D 3SFEC 3AEGD 2WDVC 1NENC 1YQ3C 2WU5C 4YSYD 2FBWC 1NEKC 3AE6D 3AECC 3AEBC 1L0VC 2WU2D 1ZOYD 4YXDD 4YSXD 5C3JC 3AE1D 3P4RC 2WS3C 3AE7C 3AE4D 1KF6C 3AEEC 3AEDD 4YTNC 3AE2C 3AEAD 3P4SC 5C2TD 3CIRC 3P4PC 3SFDD 4YTMC 4YT0D 2WQYC 3AE3C 3VR9C 4YTPD 3AE5C 2WP9D 1KFYC 2B76C 3SFED 3VRAD 2H88C 1YQ3D 2WU5D 1NEKD 1ZP0C 1E7PC 2WDQC 3VR8C 3AE8C 3AEBD 1QLBC 2ACZD 4YSYC 3AE9C 2WDRD 3VRBD 3AEFD 2WU2C 5C3JD 3P4RD 3P4QC 2WS3D 1KF6D 3AEED 4KX6C 4YSZD 4YTND 3ABVC 2BS4C 1ZOYC 3AE2D 1YQ4C 3P4SD 3CIRD 2WDVD 4YTMD 1NEND 2WQYD 3AE4C 2BS3C 3AEDC 2FBWD 1KFYD 2H89C 3AECD 1L0VD 3AEGC 3SFDC 4YTPC 2WP9C 3AE6C 3VRAC 2BS2C 3AE9D 3AE7D 3P4QD 4YXDC 4YSXC 2ACZC 3AE1C 3P4PD 4KX6D 3ABVD
chains in the Genus database with same CATH superfamily
3AE3D 3VR9D 3AE5D 2WDRC 1YQ4D 2B76D 3AEFC 3VRBC 2H88D 3AEAC 5C2TC 1ZP0D 4YSZC 4YT0C 2H89D 2WDQD 3VR8D 3AE8D 4DDIA 3SFEC 3AEGD 2WDVC 1NENC 1YQ3C 2WU5C 4YSYD 2FBWC 1NEKC 3AE6D 3AECC 3AEBC 1L0VC 2WU2D 4DHIB 1ZOYD 4YXDD 4YSXD 5C3JC 3AE1D 3P4RC 2WS3C 3AE7C 3AE4D 1KF6C 3AEEC 3AEDD 4I6LA 4DHZA 4YTNC 3AE2C 3AEAD 3P4SC 5C2TD 3CIRC 3P4PC 3SFDD 4YTMC 4YT0D 2WQYC 3AE3C 3VONA 3VR9C 4YTPD 3AE5C 2WP9D 1KFYC 2B76C 3SFED 3VRAD 2H88C 1YQ3D 2WU5D 1ZP0C 1NEKD 1E7PC 2WDQC 3VR8C 3AE8C 3AEBD 1QLBC 2ACZD 4YSYC 3AE9C 4DHJA 2WDRD 3VRBD 3AEFD 2WU2C 5C3JD 3P4RD 3P4QC 2WS3D 1KF6D 3AEED 4KX6C 4YSZD 4YTND 3ABVC 2BS4C 1ZOYC 3AE2D 1YQ4C 3P4SD 3CIRD 2WDVD 4YTMD 1NEND 4LDTA 2WQYD 3AE4C 2BS3C 3AEDC 2FBWD 1KFYD 2H89C 3AECD 4FJVA 1L0VD 3AEGC 3SFDC 4YTPC 4DDGA 2WP9C 3AE6C 3VRAC 2ZFYA 2BS2C 3AE9D 3AE7D 1TFFA 3P4QD 4YXDC 4YSXC 2ACZC 3AE1C 3P4PD 4KX6D 3ABVD
chains in the Genus database with same CATH topology
3AE3D 3VR9D 3AE5D 2WDRC 1YQ4D 2B76D 3AEFC 3VRBC 2H88D 3AEAC 5C2TC 1ZP0D 4YSZC 4YT0C 2H89D 2WDQD 3VR8D 3AE8D 3SFEC 3AEGD 2WDVC 1NENC 1YQ3C 2WU5C 4YSYD 2FBWC 1NEKC 3AE6D 3AECC 3AEBC 1L0VC 2WU2D 1ZOYD 4YXDD 4YSXD 5C3JC 3AE1D 3P4RC 2WS3C 3AE7C 3AE4D 1KF6C 3AEEC 3AEDD 4YTNC 3AE2C 3AEAD 3P4SC 5C2TD 3CIRC 3P4PC 3SFDD 4YTMC 4YT0D 2WQYC 3AE3C 3VR9C 4YTPD 3AE5C 2WP9D 1KFYC 2B76C 3SFED 3VRAD 2H88C 1YQ3D 2WU5D 1NEKD 1ZP0C 1E7PC 2WDQC 3VR8C 3AE8C 3AEBD 1QLBC 2ACZD 4YSYC 3AE9C 2WDRD 3VRBD 3AEFD 2WU2C 5C3JD 3P4RD 3P4QC 2WS3D 1KF6D 3AEED 4KX6C 4YSZD 4YTND 3ABVC 2BS4C 1ZOYC 3AE2D 1YQ4C 3P4SD 3CIRD 2WDVD 4YTMD 1NEND 2WQYD 3AE4C 2BS3C 3AEDC 2FBWD 1KFYD 2H89C 3AECD 1L0VD 3AEGC 3SFDC 4YTPC 2WP9C 3AE6C 3VRAC 2BS2C 3AE9D 3AE7D 3P4QD 4YXDC 4YSXC 2ACZC 3AE1C 3P4PD 4KX6D 3ABVD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AE3 D;  3VR9 D;  3AE5 D;  2WDR C;  1YQ4 D;  2B76 D;  3AEF C;  3VRB C;  2H88 D;  3AEA C;  5C2T C;  1ZP0 D;  4YSZ C;  4YT0 C;  2H89 D;  2WDQ D;  3VR8 D;  3AE8 D;  3SFE C;  3AEG D;  2WDV C;  1NEN C;  1YQ3 C;  2WU5 C;  4YSY D;  2FBW C;  1NEK C;  3AE6 D;  3AEC C;  3AEB C;  1L0V C;  2WU2 D;  1ZOY D;  4YXD D;  4YSX D;  5C3J C;  3AE1 D;  3P4R C;  2WS3 C;  3AE7 C;  3AE4 D;  1KF6 C;  3AEE C;  3AED D;  4YTN C;  3AE2 C;  3AEA D;  3P4S C;  5C2T D;  3CIR C;  3P4P C;  3SFD D;  4YTM C;  4YT0 D;  2WQY C;  3AE3 C;  3VR9 C;  4YTP D;  3AE5 C;  2WP9 D;  1KFY C;  2B76 C;  3SFE D;  3VRA D;  2H88 C;  1YQ3 D;  2WU5 D;  1NEK D;  1ZP0 C;  1E7P C;  2WDQ C;  3VR8 C;  3AE8 C;  3AEB D;  1QLB C;  2ACZ D;  4YSY C;  3AE9 C;  2WDR D;  3VRB D;  3AEF D;  2WU2 C;  5C3J D;  3P4R D;  3P4Q C;  2WS3 D;  1KF6 D;  3AEE D;  4KX6 C;  4YSZ D;  4YTN D;  3ABV C;  2BS4 C;  1ZOY C;  3AE2 D;  1YQ4 C;  3P4S D;  3CIR D;  2WDV D;  4YTM D;  1NEN D;  2WQY D;  3AE4 C;  2BS3 C;  3AED C;  2FBW D;  1KFY D;  2H89 C;  3AEC D;  1L0V D;  3AEG C;  3SFD C;  4YTP C;  2WP9 C;  3AE6 C;  3VRA C;  2BS2 C;  3AE9 D;  3AE7 D;  3P4Q D;  4YXD C;  4YSX C;  2ACZ C;  3AE1 C;  3P4P D;  4KX6 D;  3ABV D; 
#chains in the Genus database with same CATH topology
 3AE3 D;  3VR9 D;  3AE5 D;  2WDR C;  1YQ4 D;  2B76 D;  3AEF C;  3VRB C;  2H88 D;  3AEA C;  5C2T C;  1ZP0 D;  4YSZ C;  4YT0 C;  2H89 D;  2WDQ D;  3VR8 D;  3AE8 D;  4DDI A;  3SFE C;  3AEG D;  2WDV C;  1NEN C;  1YQ3 C;  2WU5 C;  4YSY D;  2FBW C;  1NEK C;  3AE6 D;  3AEC C;  3AEB C;  1L0V C;  2WU2 D;  4DHI B;  1ZOY D;  4YXD D;  4YSX D;  5C3J C;  3AE1 D;  3P4R C;  2WS3 C;  3AE7 C;  3AE4 D;  1KF6 C;  3AEE C;  3AED D;  4I6L A;  4DHZ A;  4YTN C;  3AE2 C;  3AEA D;  3P4S C;  5C2T D;  3CIR C;  3P4P C;  3SFD D;  4YTM C;  4YT0 D;  2WQY C;  3AE3 C;  3VON A;  3VR9 C;  4YTP D;  3AE5 C;  2WP9 D;  1KFY C;  2B76 C;  3SFE D;  3VRA D;  2H88 C;  1YQ3 D;  2WU5 D;  1ZP0 C;  1NEK D;  1E7P C;  2WDQ C;  3VR8 C;  3AE8 C;  3AEB D;  1QLB C;  2ACZ D;  4YSY C;  3AE9 C;  4DHJ A;  2WDR D;  3VRB D;  3AEF D;  2WU2 C;  5C3J D;  3P4R D;  3P4Q C;  2WS3 D;  1KF6 D;  3AEE D;  4KX6 C;  4YSZ D;  4YTN D;  3ABV C;  2BS4 C;  1ZOY C;  3AE2 D;  1YQ4 C;  3P4S D;  3CIR D;  2WDV D;  4YTM D;  1NEN D;  4LDT A;  2WQY D;  3AE4 C;  2BS3 C;  3AED C;  2FBW D;  1KFY D;  2H89 C;  3AEC D;  4FJV A;  1L0V D;  3AEG C;  3SFD C;  4YTP C;  4DDG A;  2WP9 C;  3AE6 C;  3VRA C;  2ZFY A;  2BS2 C;  3AE9 D;  3AE7 D;  1TFF A;  3P4Q D;  4YXD C;  4YSX C;  2ACZ C;  3AE1 C;  3P4P D;  4KX6 D;  3ABV D; 
#chains in the Genus database with same CATH homology
 3AE3 D;  3VR9 D;  3AE5 D;  2WDR C;  1YQ4 D;  2B76 D;  3AEF C;  3VRB C;  2H88 D;  3AEA C;  5C2T C;  1ZP0 D;  4YSZ C;  4YT0 C;  2H89 D;  2WDQ D;  3VR8 D;  3AE8 D;  3SFE C;  3AEG D;  2WDV C;  1NEN C;  1YQ3 C;  2WU5 C;  4YSY D;  2FBW C;  1NEK C;  3AE6 D;  3AEC C;  3AEB C;  1L0V C;  2WU2 D;  1ZOY D;  4YXD D;  4YSX D;  5C3J C;  3AE1 D;  3P4R C;  2WS3 C;  3AE7 C;  3AE4 D;  1KF6 C;  3AEE C;  3AED D;  4YTN C;  3AE2 C;  3AEA D;  3P4S C;  5C2T D;  3CIR C;  3P4P C;  3SFD D;  4YTM C;  4YT0 D;  2WQY C;  3AE3 C;  3VR9 C;  4YTP D;  3AE5 C;  2WP9 D;  1KFY C;  2B76 C;  3SFE D;  3VRA D;  2H88 C;  1YQ3 D;  2WU5 D;  1NEK D;  1ZP0 C;  1E7P C;  2WDQ C;  3VR8 C;  3AE8 C;  3AEB D;  1QLB C;  2ACZ D;  4YSY C;  3AE9 C;  2WDR D;  3VRB D;  3AEF D;  2WU2 C;  5C3J D;  3P4R D;  3P4Q C;  2WS3 D;  1KF6 D;  3AEE D;  4KX6 C;  4YSZ D;  4YTN D;  3ABV C;  2BS4 C;  1ZOY C;  3AE2 D;  1YQ4 C;  3P4S D;  3CIR D;  2WDV D;  4YTM D;  1NEN D;  2WQY D;  3AE4 C;  2BS3 C;  3AED C;  2FBW D;  1KFY D;  2H89 C;  3AEC D;  1L0V D;  3AEG C;  3SFD C;  4YTP C;  2WP9 C;  3AE6 C;  3VRA C;  2BS2 C;  3AE9 D;  3AE7 D;  3P4Q D;  4YXD C;  4YSX C;  2ACZ C;  3AE1 C;  3P4P D;  4KX6 D;  3ABV D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...