The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
105
|
sequence length |
319
|
structure length |
319
|
Chain Sequence |
GARVDARGAADLLTAASSVSVICHVYPDADTIGAGLALAQVLAASGKHVEVSFATPAQLPESLQSLPGGHLLVAPEAMRRDADLVVTVDIPSINRLGALSGLAGPGREVLVIDHHASNQLFGTANYIDPSADSTTMLVAELLDAWGKPIDEKVAHCLYAGLTTDTGSFRWATARAHRLAARLVELGVDNASISRTLLDTHPFAWLPMLSRVLATARLLPDALDGRGFVYAVVPHDEWSEARPEEVESIVDIVRTTQQAEVAAVFKEIEPMHWSVSMRAKSVNLASVASAFGGGGHPHAAGYSATGSADDVVQALARALG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Unique subunit packing in mycobacterial nanoRNase leads to alternate substrate recognitions in DHH phosphodiesterases
pubmed doi rcsb |
| molecule tags |
Hydrolase
|
| source organism |
Mycobacterium smegmatis
|
| molecule keywords |
DHH family protein
|
| total genus |
105
|
| structure length |
319
|
| sequence length |
319
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2013-07-22 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01368 | DHH | DHH family |
| A | PF02272 | DHHA1 | DHHA1 domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | Roll | Diaminopimelate Epimerase; Chain A, domain 1 | Diaminopimelate Epimerase; Chain A, domain 1 | ||
| Alpha Beta | Alpha-Beta Complex | inorganic pyrophosphatase (n-terminal core) | inorganic pyrophosphatase (n-terminal core) |
#chains in the Genus database with same CATH superfamily 2QB8 A; 3W5W A; 4LS9 A; 2IW4 A; 3DEV A; 2HAW A; 1WPN A; 4PY9 A; 2QB6 A; 2ZXP A; 1K20 A; 1K23 A; 2QB7 A; 4RPA A; 1IR6 A; 2ZXR A; 2ZXO A; 1WPM A; 1WPP A; 2EB0 A; 2ENX A; 1I74 A; #chains in the Genus database with same CATH topology 1U1V A; 1SDJ A; 1U0K A; 4IK0 A; 2AZP A; 2YMA A; 3PVH A; 5GL3 A; 1XUA A; 2HAW A; 3EKM A; 4PY9 A; 2ZXP A; 1YM5 A; 4OA3 A; 2Q9J A; 1K20 A; 4RPA A; 1IR6 A; 1I74 A; 2QB8 A; 2GKE A; 3W5W A; 4K7X A; 4JBD A; 2OTN A; 5GKX A; 3FVE A; 4JUU A; 4K8L A; 4LS9 A; 1T6K A; 3WQZ A; 1XUB A; 2ZVF A; 2QB7 A; 4DUN A; 1WPP A; 4JD7 A; 2KPT A; 2Q9H A; 4FC5 A; 4Q60 A; 2IW4 A; 3DEV A; 4K7G B; 1WPN A; 4J9W A; 5GL4 A; 5M47 A; 1TM0 A; 5GL2 A; 2LT2 A; 4GL6 A; 1U1X A; 5HA4 A; 1BWZ A; 1W61 A; 5H2Y A; 2PVZ A; 1S7J A; 2ZXR A; 1WPM A; 2EB0 A; 2H9F A; 3ICJ A; 1W62 A; 4JCI A; 4IJZ A; 3PTJ A; 4Q2H A; 3EDN A; 4LB0 A; 4J9X A; 5IWE A; 1QYA A; 3EJX A; 3PW9 A; 1U1W A; 1GQZ A; 3G98 A; 2QB6 A; 2GKJ A; 2MPB A; 2PW0 A; 4DWZ A; 3IGH X; 5ANP A; 5H2G A; 1K23 A; 3G7K A; 4LG3 A; 2ZXO A; 1QY9 A; 2ENX A; 2KW7 A; #chains in the Genus database with same CATH homology 1U1V A; 1SDJ A; 1U0K A; 4IK0 A; 2AZP A; 2YMA A; 3PVH A; 5GL3 A; 1XUA A; 2HAW A; 3EKM A; 4PY9 A; 2ZXP A; 1YM5 A; 4OA3 A; 2Q9J A; 1K20 A; 4RPA A; 1IR6 A; 1I74 A; 2QB8 A; 2GKE A; 3W5W A; 4K7X A; 4JBD A; 2OTN A; 5GKX A; 3FVE A; 4JUU A; 4K8L A; 4LS9 A; 1T6K A; 3WQZ A; 1XUB A; 2ZVF A; 2QB7 A; 4DUN A; 1WPP A; 4JD7 A; 2KPT A; 2Q9H A; 4FC5 A; 4Q60 A; 2IW4 A; 3DEV A; 4K7G B; 1WPN A; 4J9W A; 5GL4 A; 5M47 A; 1TM0 A; 5GL2 A; 2LT2 A; 4GL6 A; 1U1X A; 5HA4 A; 1BWZ A; 1W61 A; 5H2Y A; 2PVZ A; 1S7J A; 2ZXR A; 1WPM A; 2EB0 A; 2H9F A; 3ICJ A; 1W62 A; 4JCI A; 4IJZ A; 3PTJ A; 4Q2H A; 3EDN A; 4LB0 A; 4J9X A; 5IWE A; 1QYA A; 3EJX A; 3PW9 A; 1U1W A; 1GQZ A; 3G98 A; 2QB6 A; 2GKJ A; 2MPB A; 2PW0 A; 4DWZ A; 3IGH X; 5ANP A; 5H2G A; 1K23 A; 3G7K A; 4LG3 A; 2ZXO A; 1QY9 A; 2ENX A; 2KW7 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
