The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
56
|
sequence length |
153
|
structure length |
153
|
Chain Sequence |
EKTPIQVWGWDYLMRQRALKRPIAPHLTIYKPQMTWMVSGLHRVTGCAMAGTLLIGGVGFSVLPLDFTTFVEFIRGLGIPWVILDTFKFIIAFPIAFHTLNGIRFIGFDMAKGTDIPSIYRGAYLVLGLAALISLAVVVYPRWERHKKATLPT
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb |
| molecule keywords |
Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
|
| molecule tags |
Oxidoreductase/oxidoreductase inhibitor
|
| total genus |
56
|
| structure length |
153
|
| sequence length |
153
|
| chains with identical sequence |
G
|
| ec nomenclature | |
| pdb deposition date | 2015-06-16 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| C | PF01127 | Sdh_cyt | Succinate dehydrogenase/Fumarate reductase transmembrane subunit |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Up-down Bundle | 3 helical TM bundles of succinate and fumarate reductases | Fumarate reductase/succinate dehydrogenase, transmembrane subunit |
#chains in the Genus database with same CATH superfamily 4YTP C; 1KF6 D; 3AEE D; 1KF6 C; 3AE8 C; 3AEF D; 3SFD D; 4YSX D; 1KFY D; 3SFD C; 3AE1 D; 3P4R D; 4YSX C; 2WDV C; 3SFE D; 3VR8 D; 1KFY C; 3AE3 D; 1ZOY D; 1QLB C; 3P4R C; 3SFE C; 3AE3 C; 3P4Q C; 1NEN D; 1NEN C; 3VRA D; 2BS3 C; 3AE2 D; 2WU2 D; 2BS4 C; 2WP9 D; 3VRA C; 2FBW D; 3AE9 C; 3AE2 C; 3VR9 D; 2WU2 C; 2WDQ D; 2WP9 C; 3P4S C; 2FBW C; 3VR9 C; 2WDQ C; 3AE8 D; 5C2T D; 2WDR C; 5C2T C; 5C3J D; 2WDV D; 3AEC C; 5C3J C; 3P4P C; 4YSY D; 3P4Q D; 4YXD D; 4YSY C; 1NEK D; 1L0V D; 4YXD C; 3AEB D; 3AEG D; 1NEK C; 1L0V C; 3AE9 D; 3AEB C; 3AE7 C; 3AEG C; 3P4S D; 3AE6 D; 4KX6 D; 4YSZ D; 3AE6 C; 2ACZ D; 2WDR D; 4KX6 C; 4YSZ C; 3CIR C; 2ACZ C; 3AEC D; 1YQ3 D; 3P4P D; 4YTN D; 2WS3 D; 2H89 D; 3VRB C; 3AE4 D; 1YQ3 C; 2H88 D; 3AEA C; 4YTN C; 2WS3 C; 2H89 C; 2WU5 D; 3AE4 C; 2H88 C; 2WQY D; 3AED D; 2WU5 C; 4YTM D; 1E7P C; 2WQY C; 3AED C; 3AE7 D; 4YTM C; 4YT0 D; 1YQ4 D; 3AEE C; 1ZP0 D; 4YT0 C; 1YQ4 C; 3CIR D; 1ZP0 C; 3AEF C; 3AE1 C; 3VR8 C; 3VRB D; 2BS2 C; 3AEA D; 3AE5 D; 1ZOY C; 2B76 D; 3AE5 C; 3ABV D; 2B76 C; 4YTP D; 3ABV C; #chains in the Genus database with same CATH topology 4YTP C; 4DHJ A; 1KF6 D; 3AEE D; 1KF6 C; 3AE8 C; 3AEF D; 3SFD D; 4YSX D; 1KFY D; 3SFD C; 3AE1 D; 3P4R D; 4YSX C; 2WDV C; 3SFE D; 3VR8 D; 1KFY C; 3AE3 D; 1ZOY D; 1QLB C; 3P4R C; 3SFE C; 3AE3 C; 3P4Q C; 1NEN D; 1NEN C; 3VRA D; 2BS3 C; 3AE2 D; 2WU2 D; 4DHI B; 2BS4 C; 2WP9 D; 3VRA C; 2FBW D; 1TFF A; 3AE9 C; 3AE2 C; 2WU2 C; 2WDQ D; 3VR9 D; 2WP9 C; 3P4S C; 2FBW C; 3VR9 C; 2WDQ C; 3AE8 D; 5C2T D; 2WDR C; 5C2T C; 5C3J D; 2WDV D; 3AEC C; 5C3J C; 3P4P C; 4YSY D; 3P4Q D; 4YXD D; 4DDG A; 4YSY C; 1NEK D; 1L0V D; 4YXD C; 3AEB D; 3AEG D; 1NEK C; 1L0V C; 3AE9 D; 3AEB C; 3AE7 C; 3AEG C; 3P4S D; 3AE6 D; 4KX6 D; 4YSZ D; 2ZFY A; 3AE6 C; 2ACZ D; 4LDT A; 2WDR D; 4KX6 C; 4YSZ C; 3CIR C; 2ACZ C; 3AEC D; 1YQ3 D; 3P4P D; 4YTN D; 2WS3 D; 2H89 D; 3VRB C; 3AE4 D; 1YQ3 C; 2H88 D; 3AEA C; 4YTN C; 2WS3 C; 2H89 C; 2WU5 D; 3AE4 C; 2H88 C; 4DHZ A; 2WQY D; 3AED D; 4FJV A; 2WU5 C; 4YTM D; 1E7P C; 2WQY C; 3AED C; 3AE7 D; 4YTM C; 4YT0 D; 1YQ4 D; 3AEE C; 3VON A; 1ZP0 D; 4YT0 C; 1YQ4 C; 3CIR D; 1ZP0 C; 3AEF C; 4I6L A; 3AE1 C; 3VR8 C; 3VRB D; 2BS2 C; 3AEA D; 3AE5 D; 1ZOY C; 2B76 D; 3AE5 C; 4DDI A; 3ABV D; 2B76 C; 4YTP D; 3ABV C; #chains in the Genus database with same CATH homology 4YTP C; 1KF6 D; 3AEE D; 1KF6 C; 3AE8 C; 3AEF D; 3SFD D; 4YSX D; 1KFY D; 3SFD C; 3AE1 D; 3P4R D; 4YSX C; 2WDV C; 3SFE D; 3VR8 D; 1KFY C; 3AE3 D; 1ZOY D; 1QLB C; 3P4R C; 3SFE C; 3AE3 C; 3P4Q C; 1NEN D; 1NEN C; 3VRA D; 2BS3 C; 3AE2 D; 2WU2 D; 2BS4 C; 2WP9 D; 3VRA C; 2FBW D; 3AE9 C; 3AE2 C; 3VR9 D; 2WU2 C; 2WDQ D; 2WP9 C; 3P4S C; 2FBW C; 3VR9 C; 2WDQ C; 3AE8 D; 5C2T D; 2WDR C; 5C2T C; 5C3J D; 2WDV D; 3AEC C; 5C3J C; 3P4P C; 4YSY D; 3P4Q D; 4YXD D; 4YSY C; 1NEK D; 1L0V D; 4YXD C; 3AEB D; 3AEG D; 1NEK C; 1L0V C; 3AE9 D; 3AEB C; 3AE7 C; 3AEG C; 3P4S D; 3AE6 D; 4KX6 D; 4YSZ D; 3AE6 C; 2ACZ D; 2WDR D; 4KX6 C; 4YSZ C; 3CIR C; 2ACZ C; 3AEC D; 1YQ3 D; 3P4P D; 4YTN D; 2WS3 D; 2H89 D; 3VRB C; 3AE4 D; 1YQ3 C; 2H88 D; 3AEA C; 4YTN C; 2WS3 C; 2H89 C; 2WU5 D; 3AE4 C; 2H88 C; 2WQY D; 3AED D; 2WU5 C; 4YTM D; 1E7P C; 2WQY C; 3AED C; 3AE7 D; 4YTM C; 4YT0 D; 1YQ4 D; 3AEE C; 1ZP0 D; 4YT0 C; 1YQ4 C; 3CIR D; 1ZP0 C; 3AEF C; 3AE1 C; 3VR8 C; 3VRB D; 2BS2 C; 3AEA D; 3AE5 D; 1ZOY C; 2B76 D; 3AE5 C; 3ABV D; 2B76 C; 4YTP D; 3ABV C;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...