1RJLC

Structure of the complex between ospb-ct and bactericidal fab-h6831
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
95
structure length
95
Chain Sequence
b'TVEIKEGTVTLKREIEKDGKVKVFLNDTAGSNKKTGKWEDSTSTLTISADSKKTKDLVFLTDGTITVQQYNTAGTSLEGSASEIKNLSELKNALK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab H6831 L-chain
publication title Structural Investigation of Borrelia burgdorferi OspB, a BactericidalFab Target.
pubmed doi rcsb
source organism Borrelia burgdorferi
molecule tags Immune system
total genus 15
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2003-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.930.30 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Outer Surface Protein A; domain 3 1rjlC00
2OY8A 2FKJA 1RJLC 2HKDA 2FKGA 2AF5A 3EC5A 2OY7A
chains in the Genus database with same CATH superfamily
2OY5O 3CCUE 5H1SI 5DM7E 3I55E 1VQ7E 3CC7E 4WF9E 3PIPE 1Q86G 1VQ4E 3CPWE 2AF5A 2I5ZO 3EC5A 5JVHE 4IOAE 1VQNE 3G4SE 2QEXE 1VQOE 2OL7A 1KQSE 1QVFE 4WFAE 1YI2E 3CMAE 4U67E 3CD6E 2G8CO 2OTJE 3CCSE 2ZJQE 1RL6A 3IG9A 1K8AG 2QA4E 1OSPO 3CCME 1JJ2E 3CCVE 3CCQE 4WCEE 1VQME 3CMEE 3CCEE 2OL6O 5B3MO 5MLCH 1RJLC 2HKDA 1VQ5E 1YJNE 4UY8G 2CQLA 5DM6E 1VQ8E 3CCRE 5B11O 1Q82G 5B10O 3CKFA 1QVGE 3G71E 2OY8A 1YIJE 1VQ6E 1FJ1E 1W2BE 5JVGE 2OTLE 2ZJRE 5GAGG 1N8RG 1M90G 3CF5E 1KD1G 1YJWE 1VQKE 2PI3O 2OY7A 5AN9B 2I5VO 3PIOE 4IO9E 3OW2E 2FKJA 3CXCE 1S72E 1P4PA 1KC8G 1VQ9E 3DLLE 3AUMO 1YJ9E 1VQLE 2OY1O 4WFNE 1NJIG 2FKGA 2OL8O 5B2AO 4IOCE 3IGEA 3CKGA 3J7ZG 3CCJE 5GADG 5GAEG 4WFBE 1K73G 1M1KG 3CC4E 1Q7YG 1K9MG 3G6EE 5HL7E 5GAHG 3CCLE 1Q81G 3I56E 1YITE 2OYBO 2ZJPE 1YHQE 1VQPE 3CC2E
chains in the Genus database with same CATH topology
2OY8A 2OY5O 2OY1O 2G8CO 1FJ1E 2FKGA 2OL8O 5B2AO 3IGEA 3CKGA 3IG9A 1OSPO 2OL6O 5B3MO 2PI3O 1RJLC 2HKDA 2AF5A 2I5ZO 3EC5A 2OY7A 2I5VO 2FKJA 2OYBO 1P4PA 5B11O 2OL7A 5B10O 3AUMO 3CKFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OY8 A;  2FKJ A;  1RJL C;  2HKD A;  2FKG A;  2AF5 A;  3EC5 A;  2OY7 A; 
#chains in the Genus database with same CATH topology
 2OY5 O;  3CCU E;  5H1S I;  5DM7 E;  3I55 E;  1VQ7 E;  3CC7 E;  4WF9 E;  3PIP E;  1Q86 G;  1VQ4 E;  3CPW E;  2AF5 A;  2I5Z O;  3EC5 A;  5JVH E;  4IOA E;  1VQN E;  3G4S E;  2QEX E;  1VQO E;  2OL7 A;  1KQS E;  1QVF E;  4WFA E;  1YI2 E;  3CMA E;  4U67 E;  3CD6 E;  2G8C O;  2OTJ E;  3CCS E;  2ZJQ E;  1RL6 A;  3IG9 A;  1K8A G;  2QA4 E;  1OSP O;  3CCM E;  1JJ2 E;  3CCV E;  3CCQ E;  4WCE E;  1VQM E;  3CME E;  3CCE E;  2OL6 O;  5B3M O;  5MLC H;  1RJL C;  2HKD A;  1VQ5 E;  1YJN E;  4UY8 G;  2CQL A;  5DM6 E;  1VQ8 E;  3CCR E;  5B11 O;  1Q82 G;  5B10 O;  3CKF A;  1QVG E;  3G71 E;  2OY8 A;  1YIJ E;  1VQ6 E;  1FJ1 E;  1W2B E;  5JVG E;  2OTL E;  2ZJR E;  5GAG G;  1N8R G;  1M90 G;  3CF5 E;  1KD1 G;  1YJW E;  1VQK E;  2PI3 O;  2OY7 A;  5AN9 B;  2I5V O;  3PIO E;  4IO9 E;  3OW2 E;  2FKJ A;  3CXC E;  1S72 E;  1P4P A;  1KC8 G;  1VQ9 E;  3DLL E;  3AUM O;  1YJ9 E;  1VQL E;  2OY1 O;  4WFN E;  1NJI G;  2FKG A;  2OL8 O;  5B2A O;  4IOC E;  3IGE A;  3CKG A;  3J7Z G;  3CCJ E;  5GAD G;  5GAE G;  4WFB E;  1K73 G;  1M1K G;  3CC4 E;  1Q7Y G;  1K9M G;  3G6E E;  5HL7 E;  5GAH G;  3CCL E;  1Q81 G;  3I56 E;  1YIT E;  2OYB O;  2ZJP E;  1YHQ E;  1VQP E;  3CC2 E; 
#chains in the Genus database with same CATH homology
 2OY8 A;  2OY5 O;  2OY1 O;  2G8C O;  1FJ1 E;  2FKG A;  2OL8 O;  5B2A O;  3IGE A;  3CKG A;  3IG9 A;  1OSP O;  2OL6 O;  5B3M O;  2PI3 O;  1RJL C;  2HKD A;  2AF5 A;  2I5Z O;  3EC5 A;  2OY7 A;  2I5V O;  2FKJ A;  2OYB O;  1P4P A;  5B11 O;  2OL7 A;  5B10 O;  3AUM O;  3CKF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...