5JVHE

The crystal structure large ribosomal subunit (50s) of deinococcus radiodurans in complex with evernimicin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
171
structure length
171
Chain Sequence
b'GKQPIAVPSGVTVNAQDGVFKVKGPKGELTVPYNTELTVRQDGDQLLVERPSDAQKHRALHGLTRTLVANAVKGVSDGYTINLELRGVGFRAKLTGKALEMNIGYSHPVIIEPPAGVTFAVPEPTRIDVSGIDKQLVGQVAANVRKVRKPDAYHGKGVRFVGEQIALKAGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Avilamycin and evernimicin induce structural changes in rProteins uL16 and CTC that enhance the inhibition of A-site tRNA binding.
pubmed doi rcsb
molecule tags Ribosome
total genus 27
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2016-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00347 Ribosomal_L6 Ribosomal protein L6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 5jvhE02
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 5jvhE01
1QVFE 1RL6A 3J7ZG 1K9MG 1VQ6E 5DM7E 1VQ8E 1YJWE 3I55E 3CC7E 3OW2E 1VQOE 5GAGG 1M90G 3CPWE 1VQKE 3G71E 4IO9E 4WFBE 3CCVE 4WFNE 3G4SE 5GAHG 1NJIG 3CMAE 1Q7YG 3CCJE 5H1SI 1VQ7E 3CCRE 5GADG 3CMEE 4IOAE 1YIJE 3I56E 2ZJRE 5DM6E 1W2BE 3CF5E 1VQ5E 3CD6E 1QVGE 1YJNE 1VQPE 1VQNE 2ZJQE 1VQME 5GAEG 1YHQE 1VQ4E 5MLCH 5HL7E 1YJ9E 2CQLA 2OTLE 2ZJPE 3CC2E 3PIOE 1N8RG 5AN9B 1S72E 1M1KG 3CCUE 3PIPE 5JVHE 4U67E 3DLLE 1Q82G 2OTJE 3CCME 3CCLE 1VQ9E 1KQSE 1KD1G 1Q81G 4UY8G 1KC8G 1Q86G 5JVGE 2QEXE 2QA4E 3CCEE 3G6EE 3CCSE 4WFAE 1K8AG 4WF9E 3CC4E 1K73G 4IOCE 1YI2E 1JJ2E 3CXCE 1YITE 4WCEE 1VQLE 3CCQE
chains in the Genus database with same CATH superfamily
2OY7A 3CKGA 2OY1O 2OY5O 1QVFE 1RL6A 3J7ZG 2FKGA 1K9MG 1VQ6E 5DM7E 1VQ8E 1YJWE 3I55E 3CC7E 3OW2E 1VQOE 5GAGG 1M90G 3CPWE 1VQKE 3G71E 4IO9E 4WFBE 3CCVE 4WFNE 3G4SE 5GAHG 2I5ZO 1NJIG 5B11O 3CMAE 1Q7YG 2FKJA 3CCJE 5H1SI 1VQ7E 3CCRE 5B2AO 5GADG 3CKFA 3CMEE 4IOAE 5B10O 1YIJE 2PI3O 3I56E 3EC5A 2ZJRE 5DM6E 1W2BE 3CF5E 1VQ5E 2G8CO 3CD6E 1P4PA 1QVGE 2AF5A 1YJNE 1VQPE 1VQNE 2ZJQE 2OYBO 3IG9A 1VQME 5GAEG 2I5VO 1YHQE 1VQ4E 5MLCH 5HL7E 1YJ9E 2CQLA 2OTLE 2ZJPE 3CC2E 3PIOE 1N8RG 5AN9B 1S72E 1M1KG 3CCUE 3PIPE 5JVHE 4U67E 3DLLE 1FJ1E 1Q82G 2OTJE 3CCME 3CCLE 1VQ9E 3IGEA 1KQSE 1KD1G 1Q81G 1RJLC 4UY8G 1OSPO 1KC8G 1Q86G 2OY8A 5B3MO 2HKDA 5JVGE 2QEXE 2QA4E 3CCEE 3G6EE 3CCSE 4WFAE 1K8AG 4WF9E 3CC4E 1K73G 4IOCE 2OL6O 3AUMO 1YI2E 2OL7A 1JJ2E 3CXCE 1YITE 4WCEE 2OL8O 1VQLE 3CCQE
chains in the Genus database with same CATH topology
1QVFE 1RL6A 3J7ZG 1K9MG 1VQ6E 5DM7E 1VQ8E 1YJWE 3I55E 3CC7E 3OW2E 1VQOE 5GAGG 1M90G 3CPWE 1VQKE 3G71E 4IO9E 4WFBE 3CCVE 4WFNE 3G4SE 5GAHG 1NJIG 3CMAE 1Q7YG 3CCJE 5H1SI 1VQ7E 3CCRE 5GADG 3CMEE 4IOAE 1YIJE 3I56E 2ZJRE 5DM6E 1W2BE 3CF5E 1VQ5E 3CD6E 1QVGE 1YJNE 1VQPE 1VQNE 2ZJQE 1VQME 5GAEG 1YHQE 1VQ4E 5MLCH 5HL7E 1YJ9E 2CQLA 2OTLE 2ZJPE 3CC2E 3PIOE 1N8RG 5AN9B 1S72E 1M1KG 3CCUE 3PIPE 5JVHE 4U67E 3DLLE 1Q82G 2OTJE 3CCME 3CCLE 1VQ9E 1KQSE 1KD1G 1Q81G 4UY8G 1KC8G 1Q86G 5JVGE 2QEXE 2QA4E 3CCEE 3G6EE 3CCSE 4WFAE 1K8AG 4WF9E 3CC4E 1K73G 4IOCE 1YI2E 1JJ2E 3CXCE 1YITE 4WCEE 1VQLE 3CCQE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVF E;  1RL6 A;  3J7Z G;  1K9M G;  1VQ6 E;  5DM7 E;  1VQ8 E;  1YJW E;  3I55 E;  3CC7 E;  3OW2 E;  1VQO E;  5GAG G;  1M90 G;  3CPW E;  1VQK E;  3G71 E;  4IO9 E;  4WFB E;  3CCV E;  4WFN E;  3G4S E;  5GAH G;  1NJI G;  3CMA E;  1Q7Y G;  3CCJ E;  5H1S I;  1VQ7 E;  3CCR E;  5GAD G;  3CME E;  4IOA E;  1YIJ E;  3I56 E;  2ZJR E;  5DM6 E;  1W2B E;  3CF5 E;  1VQ5 E;  3CD6 E;  1QVG E;  1YJN E;  1VQP E;  1VQN E;  2ZJQ E;  1VQM E;  5GAE G;  1YHQ E;  1VQ4 E;  5MLC H;  5HL7 E;  1YJ9 E;  2CQL A;  2OTL E;  2ZJP E;  3CC2 E;  3PIO E;  1N8R G;  5AN9 B;  1S72 E;  1M1K G;  3CCU E;  3PIP E;  5JVH E;  4U67 E;  3DLL E;  1Q82 G;  2OTJ E;  3CCM E;  3CCL E;  1VQ9 E;  1KQS E;  1KD1 G;  1Q81 G;  4UY8 G;  1KC8 G;  1Q86 G;  5JVG E;  2QEX E;  2QA4 E;  3CCE E;  3G6E E;  3CCS E;  4WFA E;  1K8A G;  4WF9 E;  3CC4 E;  1K73 G;  4IOC E;  1YI2 E;  1JJ2 E;  3CXC E;  1YIT E;  4WCE E;  1VQL E;  3CCQ E; 
#chains in the Genus database with same CATH topology
 2OY7 A;  3CKG A;  2OY1 O;  2OY5 O;  1QVF E;  1RL6 A;  3J7Z G;  2FKG A;  1K9M G;  1VQ6 E;  5DM7 E;  1VQ8 E;  1YJW E;  3I55 E;  3CC7 E;  3OW2 E;  1VQO E;  5GAG G;  1M90 G;  3CPW E;  1VQK E;  3G71 E;  4IO9 E;  4WFB E;  3CCV E;  4WFN E;  3G4S E;  5GAH G;  2I5Z O;  1NJI G;  5B11 O;  3CMA E;  1Q7Y G;  2FKJ A;  3CCJ E;  5H1S I;  1VQ7 E;  3CCR E;  5B2A O;  5GAD G;  3CKF A;  3CME E;  4IOA E;  5B10 O;  1YIJ E;  2PI3 O;  3I56 E;  3EC5 A;  2ZJR E;  5DM6 E;  1W2B E;  3CF5 E;  1VQ5 E;  2G8C O;  3CD6 E;  1P4P A;  1QVG E;  2AF5 A;  1YJN E;  1VQP E;  1VQN E;  2ZJQ E;  2OYB O;  3IG9 A;  1VQM E;  5GAE G;  2I5V O;  1YHQ E;  1VQ4 E;  5MLC H;  5HL7 E;  1YJ9 E;  2CQL A;  2OTL E;  2ZJP E;  3CC2 E;  3PIO E;  1N8R G;  5AN9 B;  1S72 E;  1M1K G;  3CCU E;  3PIP E;  5JVH E;  4U67 E;  3DLL E;  1FJ1 E;  1Q82 G;  2OTJ E;  3CCM E;  3CCL E;  1VQ9 E;  3IGE A;  1KQS E;  1KD1 G;  1Q81 G;  1RJL C;  4UY8 G;  1OSP O;  1KC8 G;  1Q86 G;  2OY8 A;  5B3M O;  2HKD A;  5JVG E;  2QEX E;  2QA4 E;  3CCE E;  3G6E E;  3CCS E;  4WFA E;  1K8A G;  4WF9 E;  3CC4 E;  1K73 G;  4IOC E;  2OL6 O;  3AUM O;  1YI2 E;  2OL7 A;  1JJ2 E;  3CXC E;  1YIT E;  4WCE E;  2OL8 O;  1VQL E;  3CCQ E; 
#chains in the Genus database with same CATH homology
 1QVF E;  1RL6 A;  3J7Z G;  1K9M G;  1VQ6 E;  5DM7 E;  1VQ8 E;  1YJW E;  3I55 E;  3CC7 E;  3OW2 E;  1VQO E;  5GAG G;  1M90 G;  3CPW E;  1VQK E;  3G71 E;  4IO9 E;  4WFB E;  3CCV E;  4WFN E;  3G4S E;  5GAH G;  1NJI G;  3CMA E;  1Q7Y G;  3CCJ E;  5H1S I;  1VQ7 E;  3CCR E;  5GAD G;  3CME E;  4IOA E;  1YIJ E;  3I56 E;  2ZJR E;  5DM6 E;  1W2B E;  3CF5 E;  1VQ5 E;  3CD6 E;  1QVG E;  1YJN E;  1VQP E;  1VQN E;  2ZJQ E;  1VQM E;  5GAE G;  1YHQ E;  1VQ4 E;  5MLC H;  5HL7 E;  1YJ9 E;  2CQL A;  2OTL E;  2ZJP E;  3CC2 E;  3PIO E;  1N8R G;  5AN9 B;  1S72 E;  1M1K G;  3CCU E;  3PIP E;  5JVH E;  4U67 E;  3DLL E;  1Q82 G;  2OTJ E;  3CCM E;  3CCL E;  1VQ9 E;  1KQS E;  1KD1 G;  1Q81 G;  4UY8 G;  1KC8 G;  1Q86 G;  5JVG E;  2QEX E;  2QA4 E;  3CCE E;  3G6E E;  3CCS E;  4WFA E;  1K8A G;  4WF9 E;  3CC4 E;  1K73 G;  4IOC E;  1YI2 E;  1JJ2 E;  3CXC E;  1YIT E;  4WCE E;  1VQL E;  3CCQ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...