3CCLE

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535c. density for anisomycin is visible but not included in model.
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
172
structure length
172
Chain Sequence
PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGWEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVRVFQDGVYITRKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 38
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00347 Ribosomal_L6 Ribosomal protein L6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 3cclE02
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 3cclE01
4IO9E 2OTJE 4WF9E 4U67E 1VQME 1VQ4E 3G6EE 2QA4E 4IOAE 1YJ9E 1YJNE 5MLCH 3I56E 3CC7E 4IOCE 1VQKE 5JVHE 1VQ6E 3CCME 3CCEE 3CCSE 1Q82G 4WFBE 3CCJE 1VQ5E 1YHQE 5GAGG 1K8AG 2ZJRE 3G4SE 1M90G 3CMAE 1VQPE 3CXCE 5DM7E 3OW2E 1YITE 1K73G 3CCLE 1VQLE 1K9MG 1KQSE 1N8RG 3CC4E 1QVGE 1VQOE 5DM6E 3PIPE 1NJIG 1VQ7E 3CCRE 5GAEG 3CF5E 2CQLA 4WFAE 1Q7YG 1Q86G 2QEXE 4WCEE 3CPWE 4UY8G 3CCQE 3DLLE 2OTLE 1YI2E 3CCUE 2ZJPE 1Q81G 3CMEE 1S72E 5JVGE 1KD1G 1RL6A 3CC2E 1JJ2E 1M1KG 4WFNE 5GADG 1W2BE 1YJWE 3I55E 3CCVE 3J7ZG 1VQ9E 3PIOE 1QVFE 1KC8G 2ZJQE 1VQNE 1VQ8E 5H1SI 5GAHG 3CD6E 5AN9B 1YIJE 3G71E 5HL7E
chains in the Genus database with same CATH superfamily
4IO9E 2OTJE 4WF9E 4U67E 5B3MO 1VQME 1VQ4E 3G6EE 2OL6O 2QA4E 2PI3O 4IOAE 1YJ9E 1YJNE 5MLCH 3I56E 3CC7E 4IOCE 1VQKE 5JVHE 1P4PA 1VQ6E 3CCME 3CCEE 3CCSE 2G8CO 1Q82G 5B2AO 4WFBE 3CCJE 1VQ5E 1YHQE 5GAGG 1K8AG 2ZJRE 3IG9A 3G4SE 1M90G 3CMAE 1VQPE 3CXCE 5DM7E 3OW2E 1YITE 5B11O 1K73G 3CCLE 1VQLE 1K9MG 5B10O 1KQSE 1N8RG 1RJLC 2OL8O 3CC4E 3CKGA 1QVGE 1VQOE 2OY5O 5DM6E 3PIPE 1NJIG 2FKGA 1VQ7E 3CCRE 5GAEG 1OSPO 3CF5E 2CQLA 4WFAE 1Q7YG 1Q86G 2QEXE 4WCEE 3CPWE 4UY8G 3CCQE 3DLLE 2OTLE 2OY7A 1YI2E 2HKDA 3CCUE 2ZJPE 1Q81G 2FKJA 3CMEE 2OY1O 1S72E 2AF5A 5JVGE 3EC5A 1KD1G 1RL6A 3CC2E 1JJ2E 2OYBO 1M1KG 4WFNE 5GADG 1W2BE 1YJWE 3I55E 3AUMO 3CCVE 3CKFA 3J7ZG 1VQ9E 2OY8A 3PIOE 1QVFE 1KC8G 2ZJQE 1VQNE 1VQ8E 2OL7A 2I5ZO 5H1SI 2I5VO 5GAHG 3CD6E 5AN9B 1YIJE 1FJ1E 3G71E 5HL7E 3IGEA
chains in the Genus database with same CATH topology
4IO9E 2OTJE 4WF9E 4U67E 1VQME 1VQ4E 3G6EE 2QA4E 4IOAE 1YJ9E 1YJNE 5MLCH 3I56E 3CC7E 4IOCE 1VQKE 5JVHE 1VQ6E 3CCME 3CCEE 3CCSE 1Q82G 4WFBE 3CCJE 1VQ5E 1YHQE 5GAGG 1K8AG 2ZJRE 3G4SE 1M90G 3CMAE 1VQPE 3CXCE 5DM7E 3OW2E 1YITE 1K73G 3CCLE 1VQLE 1K9MG 1KQSE 1N8RG 3CC4E 1QVGE 1VQOE 5DM6E 3PIPE 1NJIG 1VQ7E 3CCRE 5GAEG 3CF5E 2CQLA 4WFAE 1Q7YG 1Q86G 2QEXE 4WCEE 3CPWE 4UY8G 3CCQE 3DLLE 2OTLE 1YI2E 3CCUE 2ZJPE 1Q81G 3CMEE 1S72E 5JVGE 1KD1G 1RL6A 3CC2E 1JJ2E 1M1KG 4WFNE 5GADG 1W2BE 1YJWE 3I55E 3CCVE 3J7ZG 1VQ9E 3PIOE 1QVFE 1KC8G 2ZJQE 1VQNE 1VQ8E 5H1SI 5GAHG 3CD6E 5AN9B 1YIJE 3G71E 5HL7E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IO9 E;  2OTJ E;  4WF9 E;  4U67 E;  1VQM E;  1VQ4 E;  3G6E E;  2QA4 E;  4IOA E;  1YJ9 E;  1YJN E;  5MLC H;  3I56 E;  3CC7 E;  4IOC E;  1VQK E;  5JVH E;  1VQ6 E;  3CCM E;  3CCE E;  3CCS E;  1Q82 G;  4WFB E;  3CCJ E;  1VQ5 E;  1YHQ E;  5GAG G;  1K8A G;  2ZJR E;  3G4S E;  1M90 G;  3CMA E;  1VQP E;  3CXC E;  5DM7 E;  3OW2 E;  1YIT E;  1K73 G;  3CCL E;  1VQL E;  1K9M G;  1KQS E;  1N8R G;  3CC4 E;  1QVG E;  1VQO E;  5DM6 E;  3PIP E;  1NJI G;  1VQ7 E;  3CCR E;  5GAE G;  3CF5 E;  2CQL A;  4WFA E;  1Q7Y G;  1Q86 G;  2QEX E;  4WCE E;  3CPW E;  4UY8 G;  3CCQ E;  3DLL E;  2OTL E;  1YI2 E;  3CCU E;  2ZJP E;  1Q81 G;  3CME E;  1S72 E;  5JVG E;  1KD1 G;  1RL6 A;  3CC2 E;  1JJ2 E;  1M1K G;  4WFN E;  5GAD G;  1W2B E;  1YJW E;  3I55 E;  3CCV E;  3J7Z G;  1VQ9 E;  3PIO E;  1QVF E;  1KC8 G;  2ZJQ E;  1VQN E;  1VQ8 E;  5H1S I;  5GAH G;  3CD6 E;  5AN9 B;  1YIJ E;  3G71 E;  5HL7 E; 
#chains in the Genus database with same CATH topology
 4IO9 E;  2OTJ E;  4WF9 E;  4U67 E;  5B3M O;  1VQM E;  1VQ4 E;  3G6E E;  2OL6 O;  2QA4 E;  2PI3 O;  4IOA E;  1YJ9 E;  1YJN E;  5MLC H;  3I56 E;  3CC7 E;  4IOC E;  1VQK E;  5JVH E;  1P4P A;  1VQ6 E;  3CCM E;  3CCE E;  3CCS E;  2G8C O;  1Q82 G;  5B2A O;  4WFB E;  3CCJ E;  1VQ5 E;  1YHQ E;  5GAG G;  1K8A G;  2ZJR E;  3IG9 A;  3G4S E;  1M90 G;  3CMA E;  1VQP E;  3CXC E;  5DM7 E;  3OW2 E;  1YIT E;  5B11 O;  1K73 G;  3CCL E;  1VQL E;  1K9M G;  5B10 O;  1KQS E;  1N8R G;  1RJL C;  2OL8 O;  3CC4 E;  3CKG A;  1QVG E;  1VQO E;  2OY5 O;  5DM6 E;  3PIP E;  1NJI G;  2FKG A;  1VQ7 E;  3CCR E;  5GAE G;  1OSP O;  3CF5 E;  2CQL A;  4WFA E;  1Q7Y G;  1Q86 G;  2QEX E;  4WCE E;  3CPW E;  4UY8 G;  3CCQ E;  3DLL E;  2OTL E;  2OY7 A;  1YI2 E;  2HKD A;  3CCU E;  2ZJP E;  1Q81 G;  2FKJ A;  3CME E;  2OY1 O;  1S72 E;  2AF5 A;  5JVG E;  3EC5 A;  1KD1 G;  1RL6 A;  3CC2 E;  1JJ2 E;  2OYB O;  1M1K G;  4WFN E;  5GAD G;  1W2B E;  1YJW E;  3I55 E;  3AUM O;  3CCV E;  3CKF A;  3J7Z G;  1VQ9 E;  2OY8 A;  3PIO E;  1QVF E;  1KC8 G;  2ZJQ E;  1VQN E;  1VQ8 E;  2OL7 A;  2I5Z O;  5H1S I;  2I5V O;  5GAH G;  3CD6 E;  5AN9 B;  1YIJ E;  1FJ1 E;  3G71 E;  5HL7 E;  3IGE A; 
#chains in the Genus database with same CATH homology
 4IO9 E;  2OTJ E;  4WF9 E;  4U67 E;  1VQM E;  1VQ4 E;  3G6E E;  2QA4 E;  4IOA E;  1YJ9 E;  1YJN E;  5MLC H;  3I56 E;  3CC7 E;  4IOC E;  1VQK E;  5JVH E;  1VQ6 E;  3CCM E;  3CCE E;  3CCS E;  1Q82 G;  4WFB E;  3CCJ E;  1VQ5 E;  1YHQ E;  5GAG G;  1K8A G;  2ZJR E;  3G4S E;  1M90 G;  3CMA E;  1VQP E;  3CXC E;  5DM7 E;  3OW2 E;  1YIT E;  1K73 G;  3CCL E;  1VQL E;  1K9M G;  1KQS E;  1N8R G;  3CC4 E;  1QVG E;  1VQO E;  5DM6 E;  3PIP E;  1NJI G;  1VQ7 E;  3CCR E;  5GAE G;  3CF5 E;  2CQL A;  4WFA E;  1Q7Y G;  1Q86 G;  2QEX E;  4WCE E;  3CPW E;  4UY8 G;  3CCQ E;  3DLL E;  2OTL E;  1YI2 E;  3CCU E;  2ZJP E;  1Q81 G;  3CME E;  1S72 E;  5JVG E;  1KD1 G;  1RL6 A;  3CC2 E;  1JJ2 E;  1M1K G;  4WFN E;  5GAD G;  1W2B E;  1YJW E;  3I55 E;  3CCV E;  3J7Z G;  1VQ9 E;  3PIO E;  1QVF E;  1KC8 G;  2ZJQ E;  1VQN E;  1VQ8 E;  5H1S I;  5GAH G;  3CD6 E;  5AN9 B;  1YIJ E;  3G71 E;  5HL7 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...